BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7184

Length=1093
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230345.1|  PREDICTED: putative RNA polymerase II subuni...    347   1e-109   
ref|XP_009771014.1|  PREDICTED: putative RNA polymerase II subuni...    343   2e-108   Nicotiana sylvestris
ref|XP_006358558.1|  PREDICTED: putative RNA polymerase II subuni...    343   3e-108   Solanum tuberosum [potatoes]
ref|XP_009629194.1|  PREDICTED: putative RNA polymerase II subuni...    343   3e-108   Nicotiana tomentosiformis
ref|XP_009629188.1|  PREDICTED: putative RNA polymerase II subuni...    343   4e-108   Nicotiana tomentosiformis
ref|XP_009602820.1|  PREDICTED: putative RNA polymerase II subuni...    342   8e-108   Nicotiana tomentosiformis
ref|XP_011087531.1|  PREDICTED: putative RNA polymerase II subuni...    333   2e-104   Sesamum indicum [beniseed]
ref|XP_011087530.1|  PREDICTED: putative RNA polymerase II subuni...    333   2e-104   Sesamum indicum [beniseed]
ref|XP_011087529.1|  PREDICTED: putative RNA polymerase II subuni...    333   5e-104   Sesamum indicum [beniseed]
emb|CAN62034.1|  hypothetical protein VITISV_014731                     330   3e-103   Vitis vinifera
ref|XP_002280625.1|  PREDICTED: putative RNA polymerase II subuni...    323   1e-100   Vitis vinifera
ref|XP_006428243.1|  hypothetical protein CICLE_v10011677mg             310   6e-98    
gb|EYU19406.1|  hypothetical protein MIMGU_mgv1a003240mg                313   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_006480289.1|  PREDICTED: putative RNA polymerase II subuni...    312   2e-95    Citrus sinensis [apfelsine]
ref|XP_007016926.1|  F2P16.20 protein, putative isoform 1               310   5e-95    
gb|KJB31664.1|  hypothetical protein B456_005G200700                    307   5e-94    Gossypium raimondii
emb|CDP15205.1|  unnamed protein product                                305   8e-93    Coffea canephora [robusta coffee]
gb|KHG00854.1|  hypothetical protein F383_23706                         301   2e-91    Gossypium arboreum [tree cotton]
ref|XP_012072543.1|  PREDICTED: putative RNA polymerase II subuni...    298   4e-91    Jatropha curcas
ref|XP_010097327.1|  hypothetical protein L484_006008                   299   5e-91    Morus notabilis
ref|XP_011044667.1|  PREDICTED: putative RNA polymerase II subuni...    298   1e-90    Populus euphratica
gb|KHG00855.1|  hypothetical protein F383_23706                         298   2e-90    Gossypium arboreum [tree cotton]
ref|XP_011044665.1|  PREDICTED: putative RNA polymerase II subuni...    298   2e-90    Populus euphratica
ref|XP_010042212.1|  PREDICTED: putative RNA polymerase II subuni...    295   2e-89    Eucalyptus grandis [rose gum]
ref|XP_002521936.1|  conserved hypothetical protein                     292   9e-89    Ricinus communis
ref|XP_007145767.1|  hypothetical protein PHAVU_007G265900g             292   3e-88    Phaseolus vulgaris [French bean]
ref|XP_002321396.2|  hypothetical protein POPTR_0015s01330g             291   4e-88    
gb|KEH41826.1|  RNA polymerase II subunit B1 CTD phosphatase RPAP...    287   2e-86    Medicago truncatula
ref|XP_004497627.1|  PREDICTED: putative RNA polymerase II subuni...    286   2e-86    Cicer arietinum [garbanzo]
ref|XP_008246291.1|  PREDICTED: putative RNA polymerase II subuni...    285   2e-85    Prunus mume [ume]
ref|XP_007208433.1|  hypothetical protein PRUPE_ppa002134mg             283   6e-85    Prunus persica
ref|XP_009366054.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    281   5e-84    
ref|XP_003537129.1|  PREDICTED: putative RNA polymerase II subuni...    280   8e-84    Glycine max [soybeans]
gb|KHN23219.1|  Putative RNA polymerase II subunit B1 CTD phospha...    280   1e-83    Glycine soja [wild soybean]
ref|XP_003519102.1|  PREDICTED: putative RNA polymerase II subuni...    280   1e-83    Glycine max [soybeans]
ref|XP_006575272.1|  PREDICTED: putative RNA polymerase II subuni...    280   1e-83    Glycine max [soybeans]
ref|NP_198028.2|  uncharacterized protein                               265   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302308.1|  PREDICTED: putative RNA polymerase II subuni...    270   6e-80    Fragaria vesca subsp. vesca
ref|XP_008388442.1|  PREDICTED: putative RNA polymerase II subuni...    270   7e-80    
ref|XP_007016928.1|  F2P16.20-like protein isoform 3                    268   4e-79    
ref|XP_010271590.1|  PREDICTED: putative RNA polymerase II subuni...    266   7e-79    Nelumbo nucifera [Indian lotus]
ref|XP_009335520.1|  PREDICTED: putative RNA polymerase II subuni...    267   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_010551019.1|  PREDICTED: putative RNA polymerase II subuni...    266   2e-78    Tarenaya hassleriana [spider flower]
ref|NP_974839.1|  uncharacterized protein                               266   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921352.1|  PREDICTED: putative RNA polymerase II subuni...    264   6e-78    Elaeis guineensis
ref|XP_008454119.1|  PREDICTED: putative RNA polymerase II subuni...    263   9e-78    Cucumis melo [Oriental melon]
gb|KDO45359.1|  hypothetical protein CISIN_1g0087651mg                  253   2e-76    Citrus sinensis [apfelsine]
ref|XP_010674526.1|  PREDICTED: putative RNA polymerase II subuni...    260   6e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004152151.1|  PREDICTED: putative RNA polymerase II subuni...    258   8e-76    Cucumis sativus [cucumbers]
ref|XP_006394906.1|  hypothetical protein EUTSA_v10003721mg             259   8e-76    Eutrema salsugineum [saltwater cress]
gb|KDO45358.1|  hypothetical protein CISIN_1g0087651mg                  254   1e-75    Citrus sinensis [apfelsine]
gb|AAB61054.1|  contains similarity to myosin heavy chain               261   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290171.1|  hypothetical protein CARUB_v10003849mg             255   5e-74    
ref|XP_008781193.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    254   5e-74    Phoenix dactylifera
emb|CDY05542.1|  BnaA02g31490D                                          256   8e-74    
ref|XP_009129907.1|  PREDICTED: putative RNA polymerase II subuni...    256   1e-73    Brassica rapa
gb|KFK26439.1|  hypothetical protein AALP_AA8G248600                    254   2e-73    Arabis alpina [alpine rockcress]
emb|CDY25002.1|  BnaC02g40060D                                          252   1e-72    Brassica napus [oilseed rape]
ref|XP_010421540.1|  PREDICTED: putative RNA polymerase II subuni...    253   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010493937.1|  PREDICTED: putative RNA polymerase II subuni...    243   9e-69    Camelina sativa [gold-of-pleasure]
ref|XP_006841578.1|  PREDICTED: putative RNA polymerase II subuni...    237   2e-68    Amborella trichopoda
gb|EPS64466.1|  hypothetical protein M569_10314                         236   5e-68    Genlisea aurea
gb|ABR17753.1|  unknown                                                 233   2e-66    Picea sitchensis
ref|XP_009389521.1|  PREDICTED: putative RNA polymerase II subuni...    233   2e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874325.1|  hypothetical protein ARALYDRAFT_326902             225   6e-62    
ref|XP_008345660.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    213   7e-62    
ref|XP_010921353.1|  PREDICTED: putative RNA polymerase II subuni...    215   7e-60    
ref|NP_001137038.1|  uncharacterized protein LOC100217208               200   3e-57    
ref|XP_006654013.1|  PREDICTED: putative RNA polymerase II subuni...    207   9e-57    Oryza brachyantha
sp|A2Y040.1|RPAP2_ORYSI  RecName: Full=Putative RNA polymerase II...    207   1e-56    Oryza sativa Indica Group [Indian rice]
sp|Q6AVZ9.1|RPAP2_ORYSJ  RecName: Full=Putative RNA polymerase II...    207   1e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569080.1|  PREDICTED: putative RNA polymerase II subuni...    207   2e-56    Brachypodium distachyon [annual false brome]
ref|XP_007016930.1|  F2P16.20-like protein isoform 5                    205   5e-56    
ref|XP_007016927.1|  F2P16.20-like protein isoform 2                    204   1e-55    
ref|XP_002440538.1|  hypothetical protein SORBIDRAFT_09g002730          204   2e-55    Sorghum bicolor [broomcorn]
ref|XP_008654513.1|  PREDICTED: uncharacterized protein LOC100217...    201   1e-54    
ref|XP_004960407.1|  PREDICTED: putative RNA polymerase II subuni...    194   8e-52    Setaria italica
gb|EMT25025.1|  hypothetical protein F775_26015                         191   7e-51    
gb|EMS49261.1|  hypothetical protein TRIUR3_22581                       187   2e-50    Triticum urartu
dbj|BAJ96888.1|  predicted protein                                      187   1e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009629198.1|  PREDICTED: putative RNA polymerase II subuni...    186   2e-49    
emb|CDX80586.1|  BnaC07g28580D                                          183   2e-48    
gb|KDO45360.1|  hypothetical protein CISIN_1g0087651mg                  176   8e-47    Citrus sinensis [apfelsine]
ref|XP_001782029.1|  predicted protein                                  179   2e-46    
emb|CDX88239.1|  BnaA06g28300D                                          170   5e-46    
ref|XP_007016929.1|  F2P16.20 protein, putative isoform 4               172   2e-44    
ref|XP_009771016.1|  PREDICTED: putative RNA polymerase II subuni...    166   2e-42    Nicotiana sylvestris
ref|XP_009629199.1|  PREDICTED: putative RNA polymerase II subuni...    165   4e-42    Nicotiana tomentosiformis
ref|XP_009602823.1|  PREDICTED: putative RNA polymerase II subuni...    163   2e-41    Nicotiana tomentosiformis
ref|XP_002990357.1|  hypothetical protein SELMODRAFT_447998             152   1e-37    Selaginella moellendorffii
ref|XP_002979385.1|  hypothetical protein SELMODRAFT_444189             152   1e-37    Selaginella moellendorffii
ref|XP_010921354.1|  PREDICTED: putative RNA polymerase II subuni...    131   3e-30    
ref|XP_008654514.1|  PREDICTED: uncharacterized protein LOC100217...    121   9e-27    
ref|XP_005844427.1|  hypothetical protein CHLNCDRAFT_139124           74.7    4e-11    Chlorella variabilis
gb|KDO45356.1|  hypothetical protein CISIN_1g0087652mg                60.5    2e-08    Citrus sinensis [apfelsine]
gb|ACG46670.1|  hypothetical protein                                  56.2    9e-07    Zea mays [maize]
gb|KIY99645.1|  hypothetical protein MNEG_8313                        52.0    7e-05    Monoraphidium neglectum
dbj|GAM26926.1|  hypothetical protein SAMD00019534_101010             52.0    7e-04    Acytostelium subglobosum LB1



>ref|XP_004230345.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Solanum lycopersicum]
Length=660

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG PNY++F+SED+WYDSPPE FN++LSPF TMF +LF WISSSSLAFIYG DES +E
Sbjct  458   RKPGMPNYDVFESEDSWYDSPPEGFNMTLSPFGTMFNSLFTWISSSSLAFIYGHDESNNE  517

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+IVL+DG S  IKQTLAGCL+RALP LVADLRLPVPISTLE+GM  L+
Sbjct  518   EYLSINGREYPRKIVLSDGRSTEIKQTLAGCLARALPGLVADLRLPVPISTLEQGMVLLL  577

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSFVDPLP+FRMKQWQLIVLLFLDALS+CRIP LTPYMTGRR   PKVLDGAQISA E
Sbjct  578   NTMSFVDPLPAFRMKQWQLIVLLFLDALSVCRIPTLTPYMTGRRTSFPKVLDGAQISAAE  637

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEIMKDLIIPLGRVP+F+MQSG 
Sbjct  638   YEIMKDLIIPLGRVPQFSMQSGG  660



>ref|XP_009771014.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
 ref|XP_009771015.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
Length=664

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG PNY++F+SED+WYDSPPE FNL+LSPFSTMF +LF WISSSSL+FIYG DES +E
Sbjct  462   RKPGVPNYDVFESEDSWYDSPPEGFNLNLSPFSTMFNSLFTWISSSSLSFIYGNDESFNE  521

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  +NG EYPR+IVL+DG S  IKQTLA CL+RALP LVADLRLPVPIS LE+G+  LI
Sbjct  522   EYLSVNGSEYPRKIVLSDGRSTEIKQTLARCLARALPGLVADLRLPVPISVLEQGLVLLI  581

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DTMSFVDPLP+FRMKQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA E
Sbjct  582   DTMSFVDPLPAFRMKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISAAE  641

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEI+KDLIIPLGRVP+F+MQSG 
Sbjct  642   YEILKDLIIPLGRVPQFSMQSGG  664



>ref|XP_006358558.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Solanum tuberosum]
Length=662

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG PNY++F+SED WYD PPE FN++LSPF+TMF +LF WISSSSLAFIYG DE+ +E
Sbjct  460   RKPGMPNYDVFESEDCWYDGPPEGFNMTLSPFATMFNSLFTWISSSSLAFIYGHDENNNE  519

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYP +IVL+DGLS  IKQTLAGCL+RALP LVADLRLPVPISTLE+GM  L+
Sbjct  520   EYLSINGREYPHKIVLSDGLSTEIKQTLAGCLARALPGLVADLRLPVPISTLEQGMVLLL  579

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSFVDPLP+FRMKQWQLIVLLFLDALS+CRIP LTPYMTGRR  LPKVLDGAQIS  E
Sbjct  580   NTMSFVDPLPAFRMKQWQLIVLLFLDALSVCRIPTLTPYMTGRRTSLPKVLDGAQISTAE  639

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEIMKDLIIPLGRVP+F+MQSG 
Sbjct  640   YEIMKDLIIPLGRVPQFSMQSGG  662



>ref|XP_009629194.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629196.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629197.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=664

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G PNY++F+SED+WYDSPPE FNL+LSPF+TMF +LF WISSSSL+FIYG DES++EEY 
Sbjct  465   GVPNYDVFESEDSWYDSPPEGFNLNLSPFATMFNSLFTWISSSSLSFIYGNDESSNEEYL  524

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
              INGREYPR+IVL+DG S  IKQTLA CL+RALP LVADLRLPVPIS LE+G+  LIDTM
Sbjct  525   SINGREYPRKIVLSDGRSTEIKQTLARCLARALPELVADLRLPVPISVLEQGVVLLIDTM  584

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA EYEI
Sbjct  585   SFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISAVEYEI  644

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             MKDLIIPLGRVP+F+MQSG 
Sbjct  645   MKDLIIPLGRVPQFSMQSGG  664



>ref|XP_009629188.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629189.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629190.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629192.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629193.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=680

 Score =   343 bits (880),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G PNY++F+SED+WYDSPPE FNL+LSPF+TMF +LF WISSSSL+FIYG DES++EEY 
Sbjct  481   GVPNYDVFESEDSWYDSPPEGFNLNLSPFATMFNSLFTWISSSSLSFIYGNDESSNEEYL  540

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
              INGREYPR+IVL+DG S  IKQTLA CL+RALP LVADLRLPVPIS LE+G+  LIDTM
Sbjct  541   SINGREYPRKIVLSDGRSTEIKQTLARCLARALPELVADLRLPVPISVLEQGVVLLIDTM  600

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA EYEI
Sbjct  601   SFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISAVEYEI  660

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             MKDLIIPLGRVP+F+MQSG 
Sbjct  661   MKDLIIPLGRVPQFSMQSGG  680



>ref|XP_009602820.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602821.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=664

 Score =   342 bits (877),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG PNY++F+SED+WYDSPPE FNL+LSPF+TMF +LF WISSSSL+FIYG DES++E
Sbjct  462   RKPGVPNYDVFESEDSWYDSPPEGFNLNLSPFATMFNSLFTWISSSSLSFIYGNDESSNE  521

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+IVL+DG S  IKQTLA CL+RALP LV DLRLPVPIS LE+G+  LI
Sbjct  522   EYLSINGREYPRKIVLSDGRSTEIKQTLARCLARALPGLVTDLRLPVPISVLEQGVVLLI  581

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DTMSFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGA ISA E
Sbjct  582   DTMSFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAHISAAE  641

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEIMKDL+IPLGRVP+F+MQSG 
Sbjct  642   YEIMKDLVIPLGRVPQFSMQSGG  664



>ref|XP_011087531.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
 ref|XP_011087533.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
Length=655

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  N +LFDSED+WYDSPPE F+L+LSPFSTMFMALFAWI+SSSLA+IYG++ES HEEY
Sbjct  455   PGFSNADLFDSEDSWYDSPPEGFSLTLSPFSTMFMALFAWITSSSLAYIYGKEESFHEEY  514

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP ++V+ DG S+ IKQTLAGCL+RALP LVA+LRLP+P+ST+E+GM  L+DT
Sbjct  515   ISVNGREYPHKVVMPDGRSSEIKQTLAGCLARALPGLVAELRLPIPMSTIEQGMGRLLDT  574

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLP+FRMKQWQ+IVLLFLDALS+ RIP LTPY+ GRRILLPKVL+GAQISAEE+E
Sbjct  575   MSFIDPLPAFRMKQWQVIVLLFLDALSVSRIPALTPYLMGRRILLPKVLEGAQISAEEFE  634

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             IMKDLIIPLGRVP+F+ QSG 
Sbjct  635   IMKDLIIPLGRVPQFSTQSGG  655



>ref|XP_011087530.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Sesamum indicum]
Length=687

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  N +LFDSED+WYDSPPE F+L+LSPFSTMFMALFAWI+SSSLA+IYG++ES HEEY
Sbjct  487   PGFSNADLFDSEDSWYDSPPEGFSLTLSPFSTMFMALFAWITSSSLAYIYGKEESFHEEY  546

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP ++V+ DG S+ IKQTLAGCL+RALP LVA+LRLP+P+ST+E+GM  L+DT
Sbjct  547   ISVNGREYPHKVVMPDGRSSEIKQTLAGCLARALPGLVAELRLPIPMSTIEQGMGRLLDT  606

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLP+FRMKQWQ+IVLLFLDALS+ RIP LTPY+ GRRILLPKVL+GAQISAEE+E
Sbjct  607   MSFIDPLPAFRMKQWQVIVLLFLDALSVSRIPALTPYLMGRRILLPKVLEGAQISAEEFE  666

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             IMKDLIIPLGRVP+F+ QSG 
Sbjct  667   IMKDLIIPLGRVPQFSTQSGG  687



>ref|XP_011087529.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Sesamum indicum]
Length=699

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  N +LFDSED+WYDSPPE F+L+LSPFSTMFMALFAWI+SSSLA+IYG++ES HEEY
Sbjct  499   PGFSNADLFDSEDSWYDSPPEGFSLTLSPFSTMFMALFAWITSSSLAYIYGKEESFHEEY  558

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP ++V+ DG S+ IKQTLAGCL+RALP LVA+LRLP+P+ST+E+GM  L+DT
Sbjct  559   ISVNGREYPHKVVMPDGRSSEIKQTLAGCLARALPGLVAELRLPIPMSTIEQGMGRLLDT  618

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLP+FRMKQWQ+IVLLFLDALS+ RIP LTPY+ GRRILLPKVL+GAQISAEE+E
Sbjct  619   MSFIDPLPAFRMKQWQVIVLLFLDALSVSRIPALTPYLMGRRILLPKVLEGAQISAEEFE  678

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             IMKDLIIPLGRVP+F+ QSG 
Sbjct  679   IMKDLIIPLGRVPQFSTQSGG  699



>emb|CAN62034.1| hypothetical protein VITISV_014731 [Vitis vinifera]
Length=659

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  + ++FDS+D+WYD+PPE F+L+LSPF+TM+MALFAWI+SSS+A+IYGRDES HEEY
Sbjct  459   PGISHSDIFDSDDSWYDTPPEGFSLTLSPFATMWMALFAWITSSSIAYIYGRDESFHEEY  518

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP++IVLTDG S+ IKQTLAGCLSRALP LVADLRLP+P+S LE+G+  L+DT
Sbjct  519   LSVNGREYPKKIVLTDGRSSEIKQTLAGCLSRALPGLVADLRLPIPVSNLEQGVGRLLDT  578

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD LPSFRMKQWQ+IVLLF+DALS+CRIP LTP+MT RR+L PKV D AQ+SAEEYE
Sbjct  579   MSFVDALPSFRMKQWQVIVLLFIDALSVCRIPALTPHMTSRRMLFPKVFDAAQVSAEEYE  638

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDLIIPLGRVP+F+ QSG 
Sbjct  639   VMKDLIIPLGRVPQFSAQSGG  659



>ref|XP_002280625.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659731.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659732.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 emb|CBI39649.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  + ++FDS+D+WYD+PPE F+L+LSPF+TM+MALFAWI+SSS+A+IYGRDES HEEY
Sbjct  459   PGISHSDIFDSDDSWYDTPPEGFSLTLSPFATMWMALFAWITSSSIAYIYGRDESFHEEY  518

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP++IVLTDG S+ IKQTLAGCL+RALP LVADLRLP+P+S LE+G+  L+DT
Sbjct  519   LSVNGREYPKKIVLTDGRSSEIKQTLAGCLARALPGLVADLRLPIPVSNLEQGVGRLLDT  578

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD LPSFRMKQWQ+IVLLF+DALS+C+IP LTP+M  +R+L PKV D AQ+SAEEYE
Sbjct  579   MSFVDALPSFRMKQWQVIVLLFIDALSVCQIPALTPHMISKRMLFPKVFDAAQVSAEEYE  638

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDLIIPLGRVP+F+ QSG 
Sbjct  639   VMKDLIIPLGRVPQFSAQSGG  659



>ref|XP_006428243.1| hypothetical protein CICLE_v10011677mg [Citrus clementina]
 gb|ESR41483.1| hypothetical protein CICLE_v10011677mg [Citrus clementina]
Length=460

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P   LFD ED+WYD PPE F+L+LSPF+TM+MA+FAWISSSSLA+IYGRDES HEEY
Sbjct  260   PGIPRSELFDPEDSWYDEPPEGFSLTLSPFATMWMAIFAWISSSSLAYIYGRDESFHEEY  319

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREY ++I++ DG S+ IKQTL+GCL+R  P LVADLRL +P+STLEKG+  L++T
Sbjct  320   LSVNGREYSQKIIMGDGHSSAIKQTLSGCLARTFPALVADLRLRIPVSTLEKGLEGLLNT  379

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLP+F++KQWQ+I +LFLDALS+CRIP LTP+MT R +LL KVLDGAQISAEEYE
Sbjct  380   MSFIDPLPAFKVKQWQVITVLFLDALSVCRIPALTPHMTNRTMLLRKVLDGAQISAEEYE  439

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKD ++PLGR P+F+ QSGA
Sbjct  440   VMKDFLMPLGRAPQFSSQSGA  460



>gb|EYU19406.1| hypothetical protein MIMGU_mgv1a003240mg [Erythranthe guttata]
Length=597

 Score =   313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  + +LFDSED+WYDSPPE FNL+LSPFSTMFM+LFAWISSSSLA+IYG++E  HE+Y
Sbjct  398   PGFSSEDLFDSEDSWYDSPPEGFNLTLSPFSTMFMSLFAWISSSSLAYIYGKEERFHEDY  457

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               INGREYP +I++ DG SA +K TLAGCL+RALP LV+++R+P P+ST+E+GM  L+DT
Sbjct  458   LSINGREYPPKIII-DGRSAEVKHTLAGCLARALPGLVSEIRIPTPVSTIEQGMGRLLDT  516

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF D LP FRMKQWQ+I LLFLDALS+ RIP L+PYMTGRRILLPKVL+GAQI+ EE+E
Sbjct  517   MSFTDALPGFRMKQWQVIALLFLDALSVSRIPALSPYMTGRRILLPKVLEGAQINVEEFE  576

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             IMKDLIIPLGRVP+F+ QSG 
Sbjct  577   IMKDLIIPLGRVPQFSTQSGG  597



>ref|XP_006480289.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Citrus sinensis]
Length=768

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P   LFD ED+WYD PPE F+L+LSPF+TM+MA+FAWISSSSLA+IYGRDES HEEY
Sbjct  568   PGIPRSELFDPEDSWYDEPPEGFSLTLSPFATMWMAIFAWISSSSLAYIYGRDESFHEEY  627

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREY ++I++ DG S+ IKQTL+GCL+R  P LVADLRL +P+STLEKG+  L++T
Sbjct  628   LSVNGREYSQKIIMGDGHSSAIKQTLSGCLARTFPALVADLRLRIPVSTLEKGLEGLLNT  687

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLP+F++KQWQ+I +LFLDALS+CRIP LTP+MT R +LL KVLDGAQISAEEYE
Sbjct  688   MSFIDPLPAFKVKQWQVITVLFLDALSVCRIPALTPHMTNRTMLLRKVLDGAQISAEEYE  747

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKD ++PLGR P+F+ QSGA
Sbjct  748   VMKDFLMPLGRAPQFSSQSGA  768



>ref|XP_007016926.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
Length=739

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P+ ++F+ ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDES HE
Sbjct  537   KKPGIPHSDMFNPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDESFHE  596

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+I L DG S+ IK+TLA C+SRALP +V DLRLP+PISTLE+GM  LI
Sbjct  597   EYLSINGREYPRKIALRDGRSSEIKETLASCISRALPAIVTDLRLPIPISTLEQGMGHLI  656

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DT+SF++ LP+FRMKQWQ+IVLLF+DALS+CRIP LTP+MT  R+LL KVLDGAQIS EE
Sbjct  657   DTISFMEALPAFRMKQWQVIVLLFIDALSVCRIPALTPHMTNGRMLLHKVLDGAQISMEE  716

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE+MKDLIIPLGR P F+ QSGA
Sbjct  717   YEVMKDLIIPLGRAPHFSAQSGA  739



>gb|KJB31664.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31665.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31666.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31667.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31668.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
Length=708

 Score =   307 bits (787),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P  + FD ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDE+ HEEY
Sbjct  508   PGIPRSDFFDPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDETFHEEY  567

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP++IVL DG S+ IK+TLAGC+SRA P +V  LRLP+PISTLE+GM  L+DT
Sbjct  568   LSVNGREYPQKIVLRDGRSSEIKETLAGCISRAFPAIVTALRLPIPISTLEQGMGRLLDT  627

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFV+ LP+FRMKQWQ+IVLL +DALS+CRIP LTP+MT  R+LL KVLDGAQIS EEYE
Sbjct  628   MSFVEALPAFRMKQWQVIVLLLIDALSVCRIPALTPHMTNGRMLLHKVLDGAQISMEEYE  687

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDLIIPLGR P F+ QSGA
Sbjct  688   VMKDLIIPLGRAPHFSAQSGA  708



>emb|CDP15205.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   305 bits (782),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 172/200 (86%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G  N +L D  D+WYD+PPE F+L+LSPF+TMFMALF WISSSSLA+IYG DES HE+Y 
Sbjct  563   GLSNSDLLDPNDSWYDTPPEGFSLNLSPFATMFMALFGWISSSSLAYIYGHDESLHEDYL  622

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
             +INGREYP +I  TDG S  IKQ LAGCL+RALP LVADL+LP+P+STLEK M  L+DTM
Sbjct  623   YINGREYPCKIFSTDGRSLEIKQALAGCLARALPALVADLQLPMPLSTLEKEMDHLLDTM  682

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SF+DPLP FRMKQWQL+VLL LDALS+CRIP LTPYMTGRRILLPKVL GAQISAEEYEI
Sbjct  683   SFMDPLPPFRMKQWQLLVLLLLDALSVCRIPALTPYMTGRRILLPKVLQGAQISAEEYEI  742

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             MKDLIIPLGRVP+F MQ GA
Sbjct  743   MKDLIIPLGRVPQFAMQCGA  762



>gb|KHG00854.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=729

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P  + FD ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDE+ HEEY
Sbjct  497   PGIPRSDFFDPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDETFHEEY  556

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP++IVL DG S+ IK+TLAGC+SRALP +V  LRLP+PISTLE+GM  L+DT
Sbjct  557   LSVNGREYPQKIVLRDGRSSEIKETLAGCISRALPAIVTALRLPIPISTLEQGMGRLLDT  616

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFV+ LP+FRMKQWQ++VLL +DALS+CRIP LTP+MT  R+LL KVLDGAQIS EEYE
Sbjct  617   MSFVEALPAFRMKQWQVLVLLLIDALSVCRIPALTPHMTNGRMLLHKVLDGAQISLEEYE  676

Query  499   IMKDLIIPLGRVPEFTMQ  446
             +MKDLIIPLGR P F+ Q
Sbjct  677   VMKDLIIPLGRAPHFSAQ  694



>ref|XP_012072543.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 ref|XP_012072544.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 ref|XP_012072546.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Jatropha curcas]
 gb|KDP37902.1| hypothetical protein JCGZ_05341 [Jatropha curcas]
Length=654

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 168/201 (84%), Gaps = 2/201 (1%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             P     +LFDSED+WYD+PPE F+L LSPF+TM+MALFAW++SSSLAFIYGRDE+AHE+Y
Sbjct  456   PAVEQSDLFDSEDSWYDAPPEGFSLMLSPFATMWMALFAWVTSSSLAFIYGRDETAHEDY  515

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP++IVL DG S+ IK T+ GCLSRA P +VADLRLP+PISTLE+G   L+DT
Sbjct  516   LSVNGREYPQKIVLRDGRSSEIKLTVEGCLSRAFPGVVADLRLPIPISTLEQGAGRLLDT  575

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD LP FRMKQWQ+   LF++ALS+CRIP LT YMT RR++L +VLDGAQISAEEYE
Sbjct  576   MSFVDALPPFRMKQWQVTAFLFIEALSVCRIPALTSYMTNRRMVLHQVLDGAQISAEEYE  635

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDL+IPLGR P    +SGA
Sbjct  636   VMKDLMIPLGRDPR--ARSGA  654



>ref|XP_010097327.1| hypothetical protein L484_006008 [Morus notabilis]
 gb|EXB67559.1| hypothetical protein L484_006008 [Morus notabilis]
Length=695

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG  + +LFD ED+W+D+PPE+F+L+LSPF+ M+ ALF W +SS+LA+IYGRDES HE
Sbjct  493   KKPGSQHSDLFDPEDSWFDAPPEDFSLTLSPFAKMWNALFTWTTSSTLAYIYGRDESLHE  552

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY+ +NGREYP +IV  DG S+ IKQTLAG L+RALP LVADLRL  PIS+LE+GM  L+
Sbjct  553   EYAVVNGREYPEKIVFGDGRSSEIKQTLAGSLARALPGLVADLRLSTPISSLEQGMGRLL  612

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DTMSFVD LP FRMKQWQ+I+LLFL+ALS+ R+P LTP+M  RR+L  KVLD AQISAEE
Sbjct  613   DTMSFVDALPPFRMKQWQVIILLFLEALSVYRLPALTPHMMYRRVLFHKVLDSAQISAEE  672

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE+MKDL+IPLGR P F+ QSGA
Sbjct  673   YEVMKDLVIPLGRTPHFSAQSGA  695



>ref|XP_011044667.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Populus euphratica]
Length=722

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P    FD E++WYD+PPE F+L LS F+T++MALFAW++SSSLA++YG+DES+HEEY
Sbjct  522   PGIPQSECFDPENSWYDAPPEGFSLELSSFATIWMALFAWVTSSSLAYVYGKDESSHEEY  581

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
             S +NGREYPR+IV  DG S  I+QT+ GCL RA PV+VADLRLP+PISTLE+G A+L+ T
Sbjct  582   SMVNGREYPRKIVSGDGRSFEIQQTIEGCLGRAFPVVVADLRLPIPISTLEQGAANLLGT  641

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+D +P+FRMKQWQ+I LLF++ALS+CRIP L  YM  RR+++ KV+DG ++SAEEYE
Sbjct  642   MSFLDAVPAFRMKQWQVIALLFIEALSVCRIPALISYMDNRRMVIQKVVDGVRMSAEEYE  701

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDL+IPLGR P+F+ QSGA
Sbjct  702   VMKDLMIPLGRAPQFSPQSGA  722



>gb|KHG00855.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=708

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 171/212 (81%), Gaps = 11/212 (5%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLS-----------LSPFSTMFMALFAWISSSSLAFI  893
             PG P  + FD ED+W+D+PPE F+L+           LS F+TM+ ALF WI+SSSLA+I
Sbjct  497   PGIPRSDFFDPEDSWFDAPPEGFSLTVSLIDGQECHKLSTFATMWNALFEWITSSSLAYI  556

Query  892   YGRDESAHEEYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPIST  713
             YGRDE+ HEEY  +NGREYP++IVL DG S+ IK+TLAGC+SRALP +V  LRLP+PIST
Sbjct  557   YGRDETFHEEYLSVNGREYPQKIVLRDGRSSEIKETLAGCISRALPAIVTALRLPIPIST  616

Query  712   LEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVL  533
             LE+GM  L+DTMSFV+ LP+FRMKQWQ++VLL +DALS+CRIP LTP+MT  R+LL KVL
Sbjct  617   LEQGMGRLLDTMSFVEALPAFRMKQWQVLVLLLIDALSVCRIPALTPHMTNGRMLLHKVL  676

Query  532   DGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  437
             DGAQIS EEYE+MKDLIIPLGR P F+ QSGA
Sbjct  677   DGAQISLEEYEVMKDLIIPLGRAPHFSAQSGA  708



>ref|XP_011044665.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
 ref|XP_011044666.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
Length=733

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 170/201 (85%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P    FD E++WYD+PPE F+L LS F+T++MALFAW++SSSLA++YG+DES+HEEY
Sbjct  533   PGIPQSECFDPENSWYDAPPEGFSLELSSFATIWMALFAWVTSSSLAYVYGKDESSHEEY  592

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
             S +NGREYPR+IV  DG S  I+QT+ GCL RA PV+VADLRLP+PISTLE+G A+L+ T
Sbjct  593   SMVNGREYPRKIVSGDGRSFEIQQTIEGCLGRAFPVVVADLRLPIPISTLEQGAANLLGT  652

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+D +P+FRMKQWQ+I LLF++ALS+CRIP L  YM  RR+++ KV+DG ++SAEEYE
Sbjct  653   MSFLDAVPAFRMKQWQVIALLFIEALSVCRIPALISYMDNRRMVIQKVVDGVRMSAEEYE  712

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDL+IPLGR P+F+ QSGA
Sbjct  713   VMKDLMIPLGRAPQFSPQSGA  733



>ref|XP_010042212.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Eucalyptus grandis]
 gb|KCW84978.1| hypothetical protein EUGRSUZ_B01798 [Eucalyptus grandis]
Length=672

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P  ++FD++D+WYD+PP+ FN++LSPF+TM+ ALFAW +SS+LA+IYG+DES HE
Sbjct  470   KKPGIPTADIFDADDSWYDAPPDGFNMTLSPFATMWGALFAWTTSSTLAYIYGKDESFHE  529

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  +NGREYP+++VL DG S  IKQTLAGCLSRALP L++DLRLP+P+STLE+G+  L+
Sbjct  530   EYMSVNGREYPQKLVLPDGRSTEIKQTLAGCLSRALPGLISDLRLPLPVSTLEQGLGRLL  589

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DTM+F+D LP+ R KQWQ+IVLLF+DALS+CR+P+LT +M+ R   L KVL  A++S EE
Sbjct  590   DTMTFMDALPALRTKQWQVIVLLFIDALSVCRVPVLTAHMSNRHPSLQKVLQAARMSVEE  649

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEIMKDL+IPLGR P+F+ QSGA
Sbjct  650   YEIMKDLLIPLGRAPQFSAQSGA  672



>ref|XP_002521936.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40460.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   292 bits (747),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 168/201 (84%), Gaps = 2/201 (1%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P  +LFD ED+WYD+PPE F+L+LSPF+TM+MALFAW++SSSLA+IYGRDESAHE+Y
Sbjct  447   PGIPQSDLFDPEDSWYDAPPEGFSLTLSPFATMWMALFAWVTSSSLAYIYGRDESAHEDY  506

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYPR+IVL DG S+ I+ T   CL+R  P LVA+LRLP+P+STLE+G   L++T
Sbjct  507   LSVNGREYPRKIVLRDGRSSEIRLTAESCLARTFPGLVANLRLPIPVSTLEQGAGRLLET  566

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD LP+FR KQWQ+I LLF++ALS+CRIP LT YMT RR++L +VLDGA ISAEEY+
Sbjct  567   MSFVDALPAFRTKQWQVIALLFIEALSVCRIPALTSYMTSRRMVLHQVLDGAHISAEEYD  626

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             IMKD ++PLGR P+   +SGA
Sbjct  627   IMKDFMVPLGRDPQ--ARSGA  645



>ref|XP_007145767.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
 gb|ESW17761.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
Length=706

 Score =   292 bits (747),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG  + + F+S+D+W+D+PPE F+L+LSPF+ M+ A+F+W++S SLA+IYGRDES HE
Sbjct  504   RKPGISDIDFFESDDSWFDAPPEGFSLTLSPFANMWNAIFSWMTSYSLAYIYGRDESFHE  563

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  +NGREYP ++VL+DG S+ IKQT AGCL+RA P LVA LRLP+PISTLE+GMA L+
Sbjct  564   EYLSVNGREYPCKVVLSDGRSSEIKQTFAGCLARAFPALVAGLRLPIPISTLEQGMACLL  623

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSFVD LP+FR KQWQ++ LLF+DALS+CRIP L  YMT RR L  KVL G+QI  EE
Sbjct  624   ETMSFVDALPAFRTKQWQVVALLFVDALSVCRIPSLISYMTDRRALFHKVLSGSQIGMEE  683

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEI+KDL++PLGR P  ++QSGA
Sbjct  684   YEILKDLVVPLGRAPHISVQSGA  706



>ref|XP_002321396.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
 gb|EEF05523.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
Length=696

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 167/201 (83%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P    FD E++WYD+PPE F+L LS F+T++MALFAW++SSSLA++YG+DES+HEEY
Sbjct  500   PGIPQSECFDPENSWYDAPPEGFSLELSSFATIWMALFAWVTSSSLAYVYGKDESSHEEY  559

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYPR+IVL DG S  I+QT+ GCL RA PV+VADLRLP+PISTLE+G A+L+ T
Sbjct  560   LMVNGREYPRKIVLGDGRSFEIQQTIEGCLGRAFPVVVADLRLPIPISTLEQGAANLLGT  619

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD +P+FRMKQWQ+I LLF++ALS+CRIP L  YM  RR+    V+DG ++SAEEYE
Sbjct  620   MSFVDAVPAFRMKQWQVIALLFIEALSVCRIPALISYMDNRRM----VVDGVRMSAEEYE  675

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDL+IPLGR P+F+ QSGA
Sbjct  676   VMKDLMIPLGRAPQFSPQSGA  696



>gb|KEH41826.1| RNA polymerase II subunit B1 CTD phosphatase RPAP2, putative 
[Medicago truncatula]
Length=702

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -1

Query  1033  PPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSF  854
             P  ++LFDSEDTW+D+PPE F+L+LSPF+TM+ A F+WI+SSSLA+IYGRD S HEE+  
Sbjct  504   PSEFDLFDSEDTWFDAPPEGFSLTLSPFATMWNAFFSWITSSSLAYIYGRDVSFHEEFLS  563

Query  853   INGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMS  674
             +NGREYP +IVLTDG S+ IKQ L GCL+RALP +V +LRLP+P+  LE+ M  L+DTMS
Sbjct  564   VNGREYPSKIVLTDGRSSEIKQALVGCLARALPAVVEELRLPIPVDILEQAMVRLLDTMS  623

Query  673   FVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIM  494
             FVD LP+FRMKQWQ++VLLF+DALS+ R+P L  YMT RR L  KVL G+QI  EEY+++
Sbjct  624   FVDALPAFRMKQWQVVVLLFVDALSVSRVPTLISYMTDRRDLFLKVLSGSQIGKEEYDVL  683

Query  493   KDLIIPLGRVPEFTMQSGA  437
             KD I+PLGR P F+ QSGA
Sbjct  684   KDFIVPLGRAPHFSSQSGA  702



>ref|XP_004497627.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cicer arietinum]
Length=666

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG  +++LF S+D+W+D+PPE F+L+LSPF+T++ A F+WI+SSSLA+IYGRD S +E
Sbjct  464   RKPGISDFDLFASDDSWFDAPPEGFSLTLSPFATLWNAFFSWITSSSLAYIYGRDVSFYE  523

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+  ++GREYP +IVL+DG S+ IKQTLA CL+RALP +VA+L+LP+P+STLE+GM  L+
Sbjct  524   EFLSVDGREYPCKIVLSDGRSSEIKQTLASCLARALPAVVAELKLPMPVSTLEQGMVCLL  583

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             DTMSFVDPLP FR KQWQ++ LLF+DALS+CRIP L  YMT RR L  KVL G+QI  EE
Sbjct  584   DTMSFVDPLPGFRFKQWQVVALLFVDALSVCRIPALISYMTDRRDLFHKVLSGSQIGMEE  643

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             Y ++KDLI+PLGR P F+ QSGA
Sbjct  644   YNVLKDLIVPLGRAPHFSSQSGA  666



>ref|XP_008246291.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Prunus mume]
Length=711

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P  +LFD ED+W+D+PPE F+L+LSPF+TM+ +LF WI+SS+LA+IYGRDES HEE+
Sbjct  511   PGIPCSDLFDPEDSWFDAPPEGFSLTLSPFATMWNSLFTWITSSTLAYIYGRDESFHEEF  570

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYP +IVL  G S+ IK+TL    +RALP +V++LRLP PIS+LE+GM  +++T
Sbjct  571   LSVNGREYPPKIVLAGGRSSEIKKTLDESFARALPGVVSELRLPTPISSLEQGMGRMLNT  630

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+D +P+FRMKQWQ+IVLLFL+ LS+CRIP LTP+MT RR+L  KVL+  QISAE+YE
Sbjct  631   MSFIDAIPAFRMKQWQVIVLLFLEGLSVCRIPALTPHMTNRRMLFYKVLENTQISAEQYE  690

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDLIIPLGR P+F+ QSGA
Sbjct  691   LMKDLIIPLGRAPQFSAQSGA  711



>ref|XP_007208433.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
 gb|EMJ09632.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
Length=711

 Score =   283 bits (725),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P  +LFD ED+W+D+PPE F+++LSPF+TM+ +LF WI+SS+LA+IYGRDES HE
Sbjct  509   RKPGIPCSDLFDPEDSWFDAPPEGFSVTLSPFATMWNSLFTWITSSTLAYIYGRDESFHE  568

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+  +NGREYP +IVL  G S+ IK+TL    +RALP +V++LRLP PIS+LE+GM  ++
Sbjct  569   EFLSVNGREYPPKIVLAGGRSSEIKKTLDESFARALPGVVSELRLPTPISSLEQGMGRML  628

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSF+D +P+FRMKQWQ+IVLLFL+ LS+CRIP LTP+MT RR+L  KVL+  QISAE+
Sbjct  629   NTMSFIDAIPAFRMKQWQVIVLLFLEGLSVCRIPALTPHMTNRRMLFYKVLENTQISAEQ  688

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE+MKDLIIPLGR P+F+ QSGA
Sbjct  689   YELMKDLIIPLGRAPQFSAQSGA  711



>ref|XP_009366054.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Pyrus x bretschneideri]
Length=704

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             ++PG PN++LFDSEDTW+D PPE F+L+LSPF TM  +LF WI+SS+LA+IYGRDE  HE
Sbjct  502   RNPGIPNFDLFDSEDTWFDDPPEGFSLTLSPFLTMGNSLFTWITSSTLAYIYGRDERFHE  561

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+  ING+EYPR+IVL  G S+ IK+TLA  L+R LP +V+ LRLP P+S+LE+ M+ ++
Sbjct  562   EFLSINGKEYPRKIVLAGGHSSEIKKTLAESLARTLPGIVSQLRLPTPVSSLEQEMSRML  621

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TM+FVD LP+FRMKQW+++VLLFL+ LS+CRIP L P M  RR+L  KVLDG++I+AE 
Sbjct  622   ETMTFVDALPAFRMKQWKVVVLLFLEGLSVCRIPALGPCMPDRRMLFHKVLDGSEITAEH  681

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE+MKD IIPLGR P+F+ QSGA
Sbjct  682   YELMKDHIIPLGRAPKFSAQSGA  704



>ref|XP_003537129.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Glycine max]
 gb|KHN37760.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   280 bits (717),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 162/203 (80%), Gaps = 0/203 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG    + F+S+D+W+D+ PE F+L+LSPF+TM+  LF+WI+SSSLA+IYGRDES  E
Sbjct  504   RKPGISEADFFESDDSWFDAAPEGFSLTLSPFATMWNTLFSWITSSSLAYIYGRDESFQE  563

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  +NGREYP ++VL DG S+ IKQTLA CL+RALP LVA LRLP+P+ST+E+GMA L+
Sbjct  564   EYLSVNGREYPCKVVLADGRSSEIKQTLASCLARALPTLVAVLRLPIPVSTMEQGMACLL  623

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSFVD LP+FR KQWQ++ LLF+DALS+CR+P L  YMT RR    +VL G+QI  EE
Sbjct  624   ETMSFVDALPAFRTKQWQVVALLFIDALSVCRLPALISYMTDRRASFHRVLSGSQIGMEE  683

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE++KDL +PLGR P  + QSGA
Sbjct  684   YEVLKDLAVPLGRAPHISAQSGA  706



>gb|KHN23219.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G    + F+S+D+W+D+PPE F+L+LSPF+TM+  LF+W +SSSLA+IYGRDES HEEY 
Sbjct  507   GISEADFFESDDSWFDAPPEGFSLTLSPFATMWNTLFSWTTSSSLAYIYGRDESFHEEYL  566

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
              +NGREYP ++VL DG S+ IKQTLA CL+RALP LVA LRLP+P+S +E+GMA L++TM
Sbjct  567   SVNGREYPCKVVLADGRSSEIKQTLASCLARALPALVAVLRLPIPVSIMEQGMACLLETM  626

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SFVD LP+FR KQWQ++ LLF+DALS+CR+P L  YMT RR    +VL G+QI  EEYE+
Sbjct  627   SFVDALPAFRTKQWQVVALLFIDALSVCRLPALISYMTDRRASFHRVLSGSQIRMEEYEV  686

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             +KDL++PLGR P  + QSGA
Sbjct  687   LKDLVVPLGRAPHISSQSGA  706



>ref|XP_003519102.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Glycine max]
Length=706

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G    + F+S+D+W+D+PPE F+L+LSPF+TM+  LF+W +SSSLA+IYGRDES HEEY 
Sbjct  507   GISEADFFESDDSWFDAPPEGFSLTLSPFATMWNTLFSWTTSSSLAYIYGRDESFHEEYL  566

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
              +NGREYP ++VL DG S+ IKQTLA CL+RALP LVA LRLP+P+S +E+GMA L++TM
Sbjct  567   SVNGREYPCKVVLADGRSSEIKQTLASCLARALPALVAVLRLPIPVSIMEQGMACLLETM  626

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SFVD LP+FR KQWQ++ LLF+DALS+CR+P L  YMT RR    +VL G+QI  EEYE+
Sbjct  627   SFVDALPAFRTKQWQVVALLFIDALSVCRLPALISYMTDRRASFHRVLSGSQIRMEEYEV  686

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             +KDL++PLGR P  + QSGA
Sbjct  687   LKDLVVPLGRAPHISSQSGA  706



>ref|XP_006575272.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Glycine max]
Length=716

 Score =   280 bits (716),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G    + F+S+D+W+D+PPE F+L+LSPF+TM+  LF+W +SSSLA+IYGRDES HEEY 
Sbjct  517   GISEADFFESDDSWFDAPPEGFSLTLSPFATMWNTLFSWTTSSSLAYIYGRDESFHEEYL  576

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTM  677
              +NGREYP ++VL DG S+ IKQTLA CL+RALP LVA LRLP+P+S +E+GMA L++TM
Sbjct  577   SVNGREYPCKVVLADGRSSEIKQTLASCLARALPALVAVLRLPIPVSIMEQGMACLLETM  636

Query  676   SFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEI  497
             SFVD LP+FR KQWQ++ LLF+DALS+CR+P L  YMT RR    +VL G+QI  EEYE+
Sbjct  637   SFVDALPAFRTKQWQVVALLFIDALSVCRLPALISYMTDRRASFHRVLSGSQIRMEEYEV  696

Query  496   MKDLIIPLGRVPEFTMQSGA  437
             +KDL++PLGR P  + QSGA
Sbjct  697   LKDLVVPLGRAPHISSQSGA  716



>ref|NP_198028.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU90076.1| At5g26760 [Arabidopsis thaliana]
 gb|AED93597.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=430

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 161/201 (80%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  234   PGIPDSDLFDRDQSWFDGPPEGFNLTLSNFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  293

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I++ DGLS+ IKQT+AGCL+RALP +V  LRLP+ IS LEKG+ SL++T
Sbjct  294   LLVNGKEYPRRIIMVDGLSSEIKQTIAGCLARALPRVVTHLRLPIAISELEKGLGSLLET  353

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSFR+K+W +IVLLFLDALS+ RIP + PY++ R     K+L+G+ I  EEYE
Sbjct  354   MSLTGAVPSFRVKEWLVIVLLFLDALSVSRIPRIAPYISNR----DKILEGSGIGNEEYE  409

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MKD+++PLGRVP+F  +SGA
Sbjct  410   TMKDILLPLGRVPQFATRSGA  430



>ref|XP_004302308.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Fragaria vesca subsp. vesca]
Length=692

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + P    ++LF+ ED+W+D+PP+ FNL+LSPF+TM+ ALF W +SS+LA+IYG+D+S HE
Sbjct  492   KKPESSQFDLFNPEDSWFDAPPDGFNLTLSPFATMWNALFTWTTSSTLAYIYGKDDSFHE  551

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+  +NGR YP +IVL DG S+ IK T+   LSRALP +VA+L L VP   LEKGM  ++
Sbjct  552   EFLNVNGRSYPHKIVLADGRSSEIKLTVGASLSRALPEIVAELGLAVP--NLEKGMGFML  609

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMSF++ LP+FRMKQWQ+I LLF++ LS+CR+P LTP+MT RR+L+ +VLDGA+IS EE
Sbjct  610   NTMSFIEALPAFRMKQWQVIALLFIEGLSVCRMPALTPHMTNRRVLIQRVLDGARISVEE  669

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YEIMKD +IPLGR P+F  QSGA
Sbjct  670   YEIMKDFLIPLGRAPQFASQSGA  692



>ref|XP_008388442.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Malus domestica]
Length=706

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -1

Query  1048  QQSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAH  869
             Q++PG PN++LFDS DTW+D PPE FNL+LSPF TM+ +LF WI+SS+LA+IYGRDES H
Sbjct  503   QRNPGIPNFDLFDSXDTWFDDPPEGFNLTLSPFLTMWNSLFTWITSSTLAYIYGRDESFH  562

Query  868   EEYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASL  689
             EE+  ING+EY R+IVL  G S+ IK+TLA  L+R LP +V+ LRL  PIS+LE+ M+ +
Sbjct  563   EEFLSINGKEYSRKIVLVGGHSSEIKKTLAESLARTLPGVVSQLRLATPISSLEQEMSCM  622

Query  688   IDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAE  509
             ++TM+FVD LP+FRMKQW+++VLL L+ LS+CRIP L P+M  RR L  KVLDG+QI+AE
Sbjct  623   LETMTFVDALPAFRMKQWKVVVLLLLEGLSVCRIPALGPHMPDRRTLFHKVLDGSQITAE  682

Query  508   EYEIMKDLIIPLGRVPEFTMQSGA  437
              YE+MKD I+PLGR PEF+ QSGA
Sbjct  683   XYELMKDHILPLGRAPEFSAQSGA  706



>ref|XP_007016928.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
 gb|EOY34547.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
Length=703

 Score =   268 bits (685),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P+ ++F+ ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDES HE
Sbjct  526   KKPGIPHSDMFNPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDESFHE  585

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+I L DG S+ IK+TLA C+SRALP +V DLRLP+PISTLE+GM  LI
Sbjct  586   EYLSINGREYPRKIALRDGRSSEIKETLASCISRALPAIVTDLRLPIPISTLEQGMGHLI  645

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQIS  515
             DT+SF++ LP+FRMKQWQ+IVLLF+DALS+CRIP LTP+MT  R+LL KVLDGAQIS
Sbjct  646   DTISFMEALPAFRMKQWQVIVLLFIDALSVCRIPALTPHMTNGRMLLHKVLDGAQIS  702



>ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
 ref|XP_010271591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
Length=650

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  985  PPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPRQIVLTDGL  806
            PP+ F++SLSPF T++MALF WI+SS+LA+IYGRDE++H E+  +NG+EYP ++V  DG 
Sbjct  468  PPDGFSMSLSPFGTIWMALFGWITSSTLAYIYGRDENSHLEFQLVNGKEYPCKVVFRDGR  527

Query  805  SAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLI  626
            S  IK+TLA CLSRALP LVAD+ LP PISTLE+GM  L+DTM+FV+ LPS RMKQW +I
Sbjct  528  SYEIKETLASCLSRALPGLVADVNLPTPISTLEQGMGCLLDTMTFVEALPSLRMKQWHVI  587

Query  625  VLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQ  446
            V LF+DALS+CR+P L P +T RR+LL KVLDGAQIS EEYE+MKD I+PLGR+P+F+ Q
Sbjct  588  VFLFVDALSVCRMPALNPLVTSRRMLLQKVLDGAQISGEEYELMKDHILPLGRLPQFSTQ  647

Query  445  SGA  437
            SG 
Sbjct  648  SGG  650



>ref|XP_009335520.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Pyrus x bretschneideri]
Length=705

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -1

Query  1048  QQSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAH  869
             +++PG PN++LFDSE+TW+D PPE FNL+LSPF TM+ +LF WI+SS+LA+IYGRDES H
Sbjct  502   RRNPGIPNFDLFDSENTWFDDPPEGFNLTLSPFLTMWNSLFTWITSSTLAYIYGRDESFH  561

Query  868   EEYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASL  689
             EE+  ING++Y R+IVL  G S+ IK+TLA  L+R LP +V+ LRL  PIS+LE+ M+ +
Sbjct  562   EEFLSINGKDYSRKIVLAGGHSSEIKKTLAESLARTLPGVVSQLRLATPISSLEQEMSCM  621

Query  688   IDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAE  509
             ++TM+FVD LP+FRMKQW+++VLL L+ LS+CRIP L P+M  RR L  KVLDG+QI+AE
Sbjct  622   LETMTFVDALPAFRMKQWKVVVLLLLEGLSVCRIPALGPHMPDRRTLFDKVLDGSQITAE  681

Query  508   EYEIMKDLIIPLGRVPEFTMQSGA  437
              YE+MKD ++PLGR PEF+ QSGA
Sbjct  682   HYELMKDHMLPLGRAPEFSAQSGA  705



>ref|XP_010551019.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Tarenaya hassleriana]
Length=719

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 164/201 (82%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  + +LFD + +W+D PPE F+L+LS F+ M+ A+F W+SSSSLA+IYG++E+ HEE+
Sbjct  523   PGILDSDLFDPDQSWFDGPPEAFSLTLSAFAMMWNAIFGWVSSSSLAYIYGKEENEHEEF  582

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREYPR+I+L+DG S+ IK+T+AGCL+R+LP L  DLRLP+PIS LEKG+ SL++T
Sbjct  583   VCVNGREYPRKIILSDGRSSEIKETIAGCLARSLPGLTTDLRLPIPISELEKGLGSLLET  642

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             M+F + +P+ RMKQWQ+IVLLF+DALS+ R+PLLT Y++       KVL+GA I  EEYE
Sbjct  643   MTFTEAIPALRMKQWQVIVLLFMDALSVSRLPLLTHYISN----TSKVLEGAGIGTEEYE  698

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKDL++PLGRVP+F+ +SGA
Sbjct  699   VMKDLLMPLGRVPQFSSRSGA  719



>ref|NP_974839.1| uncharacterized protein [Arabidopsis thaliana]
 sp|F4K1B1.1|RPAP2_ARATH RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Arabidopsis thaliana]
 gb|AED93598.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=735

 Score =   266 bits (679),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 161/201 (80%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  539   PGIPDSDLFDRDQSWFDGPPEGFNLTLSNFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  598

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I++ DGLS+ IKQT+AGCL+RALP +V  LRLP+ IS LEKG+ SL++T
Sbjct  599   LLVNGKEYPRRIIMVDGLSSEIKQTIAGCLARALPRVVTHLRLPIAISELEKGLGSLLET  658

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSFR+K+W +IVLLFLDALS+ RIP + PY++ R     K+L+G+ I  EEYE
Sbjct  659   MSLTGAVPSFRVKEWLVIVLLFLDALSVSRIPRIAPYISNR----DKILEGSGIGNEEYE  714

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MKD+++PLGRVP+F  +SGA
Sbjct  715   TMKDILLPLGRVPQFATRSGA  735



>ref|XP_010921352.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Elaeis guineensis]
Length=681

 Score =   264 bits (675),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ ED+W+D+PPE F+L+LS F+TM+MALF WI+ SSLA+IYG++ES+ +++  +N
Sbjct  485   DTDMFEVEDSWHDTPPEGFSLTLSSFATMWMALFGWITCSSLAYIYGQNESSQDDFLLVN  544

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP + VL DG S  I+QT+ G + RALP +V DL+LP P+STLEK +  L+DTMSFV
Sbjct  545   GREYPHKTVLGDGKSLEIRQTIDGFVCRALPSIVMDLKLPTPVSTLEKFVGRLLDTMSFV  604

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPSFR++QWQ+IVLLFLDALS+ R+P L P+MT R +LL KVL+ AQ+SAEEYE M+D
Sbjct  605   DALPSFRIRQWQVIVLLFLDALSVHRLPPLAPHMTNRNMLLHKVLNPAQVSAEEYESMRD  664

Query  487   LIIPLGRVPEFTMQSGA  437
             LIIPLGR PE +MQSG 
Sbjct  665   LIIPLGRFPELSMQSGG  681



>ref|XP_008454119.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
 ref|XP_008454120.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
Length=661

 Score =   263 bits (673),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -1

Query  1021  NLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGR  842
             +LFD  D+WYD+PPE F+L+LS F+TM+MA+FAW++SSSLA+IYG+D+  HEE+ +I+G+
Sbjct  467   DLFDPSDSWYDAPPEGFSLTLSSFATMWMAIFAWVTSSSLAYIYGKDDKFHEEFQYIDGK  526

Query  841   EYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDP  662
             EYP +IV  DG S+ IKQTLAGCL+RA+P L ++L+L  PIS LE GMA L+DTM+F+D 
Sbjct  527   EYPSKIVSADGRSSEIKQTLAGCLTRAIPGLASELKLSTPISRLEYGMAHLLDTMTFLDA  586

Query  661   LPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLI  482
             LP+FRMKQWQ+IVLLF++ALS+CRIP L  +M+  R L  KVLD AQI ++EYEIMKD I
Sbjct  587   LPAFRMKQWQVIVLLFMEALSVCRIPSLASHMSSSRNLYHKVLDRAQIQSDEYEIMKDHI  646

Query  481   IPLGRVPEFTMQSGA  437
             +PLG   + ++++ A
Sbjct  647   LPLGLTAQLSVENDA  661



>gb|KDO45359.1| hypothetical protein CISIN_1g0087651mg, partial [Citrus sinensis]
Length=397

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P   LFD ED+WYD PPE F+L+LSPF+TM+MA+FAWISSSSLA+IYGRDES HEEY
Sbjct  231   PGIPRSELFDPEDSWYDEPPEGFSLTLSPFATMWMAIFAWISSSSLAYIYGRDESFHEEY  290

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREY ++I++ DG S+ IKQTL+GCL+R  P LVADLRL +P+STLEKG+  L++T
Sbjct  291   LSVNGREYSQKIIMGDGHSSAIKQTLSGCLARTFPALVADLRLRIPVSTLEKGLEGLLNT  350

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPK  539
             MSF+DPLP+F++KQWQ+I +LFLDALS+CRIP LTP+MT R +LL K
Sbjct  351   MSFIDPLPAFKVKQWQVITVLFLDALSVCRIPALTPHMTNRTMLLRK  397



>ref|XP_010674526.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010674527.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
Length=730

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG  +   FDS+ +W+D+ PE F+L+LSPF+ M+ ALF+W++SSSLA+IYGR+E  HEEY
Sbjct  541   PGNLDSKFFDSDKSWFDAAPEGFSLTLSPFALMWDALFSWLTSSSLAYIYGREECCHEEY  600

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
              ++NGREYP + VL DG S  IK+TLA CL+RALP L+ADL+LP P+S LE  +A L+DT
Sbjct  601   MYVNGREYPSKAVLPDGRSPEIKRTLAACLARALPGLIADLKLPTPVSLLEHELAHLLDT  660

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSFVD LP FRMKQWQ+IVLLFLDALS+CRIP L  Y+T RRIL+PKVL GAQ+  EEYE
Sbjct  661   MSFVDALPPFRMKQWQVIVLLFLDALSVCRIPGLPAYLTSRRILIPKVLKGAQLRPEEYE  720

Query  499   IMKDLIIPLG  470
             IMKDL+IPLG
Sbjct  721   IMKDLMIPLG  730



>ref|XP_004152151.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 ref|XP_011653018.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 gb|KGN52984.1| hypothetical protein Csa_4G009360 [Cucumis sativus]
Length=662

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 157/195 (81%), Gaps = 0/195 (0%)
 Frame = -1

Query  1021  NLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGR  842
             +LFD  D+WYD+PPE F+L+LS F+TM+MA+FAW++SSSLA+IYG+D+  HEE+ +I+G+
Sbjct  468   DLFDPSDSWYDAPPEGFSLTLSSFATMWMAIFAWVTSSSLAYIYGKDDKFHEEFLYIDGK  527

Query  841   EYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDP  662
             EYP +IV  DG S+ IKQTLAGCL+RA+P L ++L L  PIS LE GMA L+DTM+F+D 
Sbjct  528   EYPSKIVSADGRSSEIKQTLAGCLTRAIPGLASELNLSTPISRLENGMAHLLDTMTFLDA  587

Query  661   LPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLI  482
             LP+FRMKQWQ+IVLLF++ALS+ RIP L  +M+  R L  KVLD AQI ++EYEIM+D I
Sbjct  588   LPAFRMKQWQVIVLLFIEALSVSRIPSLASHMSSSRNLYHKVLDRAQIRSDEYEIMRDHI  647

Query  481   IPLGRVPEFTMQSGA  437
             +PLGR  + + ++ A
Sbjct  648   LPLGRTAQLSDENDA  662



>ref|XP_006394906.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
 gb|ESQ32192.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
Length=720

 Score =   259 bits (662),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 160/203 (79%), Gaps = 3/203 (1%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
               PG P+ ++FD + +W D PPE FNL+LS F+ M+ +LF W SSSSLA+IYG+DE+AHE
Sbjct  521   NKPGIPDSDVFDRDQSWIDGPPEGFNLTLSTFAIMWDSLFGWASSSSLAYIYGKDEAAHE  580

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+  +NG+EYPR+I+L +GLS+ IK+T+AGCL+RALP +  DLRLP+ IS LEKG+ SL+
Sbjct  581   EFLSVNGKEYPRKIILGEGLSSEIKETIAGCLARALPKVATDLRLPIAISELEKGLGSLL  640

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMS    +PSFR++QW++IVL+FLDALS+ RIP + PY+  R     KVL+G+ I  EE
Sbjct  641   ETMSLTGAVPSFRVEQWRVIVLVFLDALSVTRIPRIAPYICNRN---NKVLEGSGIGNEE  697

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE MKD+++PLGR+P+F ++SGA
Sbjct  698   YETMKDILLPLGRIPQFAIRSGA  720



>gb|KDO45358.1| hypothetical protein CISIN_1g0087651mg, partial [Citrus sinensis]
Length=520

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P   LFD ED+WYD PPE F+L+LSPF+TM+MA+FAWISSSSLA+IYGRDES HEEY
Sbjct  354   PGIPRSELFDPEDSWYDEPPEGFSLTLSPFATMWMAIFAWISSSSLAYIYGRDESFHEEY  413

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NGREY ++I++ DG S+ IKQTL+GCL+R  P LVADLRL +P+STLEKG+  L++T
Sbjct  414   LSVNGREYSQKIIMGDGHSSAIKQTLSGCLARTFPALVADLRLRIPVSTLEKGLEGLLNT  473

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPK  539
             MSF+DPLP+F++KQWQ+I +LFLDALS+CRIP LTP+MT R +LL K
Sbjct  474   MSFIDPLPAFKVKQWQVITVLFLDALSVCRIPALTPHMTNRTMLLRK  520



>gb|AAB61054.1| contains similarity to myosin heavy chain [Arabidopsis thaliana]
Length=1133

 Score =   261 bits (666),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 119/225 (53%), Positives = 163/225 (72%), Gaps = 24/225 (11%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  909   PGIPDSDLFDRDQSWFDGPPEGFNLTLSNFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  968

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I++ DGLS+ IKQT+AGCL+RALP +V  LRLP+ IS LEKG+ SL++T
Sbjct  969   LLVNGKEYPRRIIMVDGLSSEIKQTIAGCLARALPRVVTHLRLPIAISELEKGLGSLLET  1028

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGR-------------RILLP-  542
             MS    +PSFR+K+W +IVLLFLDALS+ RIP + PY++ R             R L   
Sbjct  1029  MSLTGAVPSFRVKEWLVIVLLFLDALSVSRIPRIAPYISNRDKVCSSQLEHNKWRTLTEF  1088

Query  541   ----------KVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  437
                       ++L+G+ I  EEYE MKD+++PLGRVP+F  +SGA
Sbjct  1089  NLLINVGEKYQILEGSGIGNEEYETMKDILLPLGRVPQFATRSGA  1133



>ref|XP_006290171.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
 gb|EOA23069.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
Length=743

 Score =   255 bits (651),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D  PE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  547   PGIPDSDLFDRDQSWFDGAPEGFNLTLSSFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  606

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I+L DGLS+ IK+T+AGCL+RALP +   LRLP+ IS LEKG+ SL++T
Sbjct  607   LSVNGKEYPRKIILGDGLSSEIKETMAGCLARALPRVATYLRLPIAISELEKGLGSLLET  666

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PS +MK+W +IVLLFLDALS+ RIPL+ PY++     + K+L+G+ I  +EYE
Sbjct  667   MSLTGAVPSLKMKEWLVIVLLFLDALSVSRIPLIAPYLSN----INKILEGSGIGNDEYE  722

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKD+ +PLGRVP+F  +SGA
Sbjct  723   MMKDIFLPLGRVPQFATRSGA  743



>ref|XP_008781193.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Phoenix dactylifera]
Length=689

 Score =   254 bits (649),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ ED+W+D+PPE F+L+LS F+TM+MALF WI+ SSLA+IYG++ES+ ++   +N
Sbjct  493   DTDMFEVEDSWHDTPPESFSLTLSSFATMWMALFGWITCSSLAYIYGQNESSQDDXLLVN  552

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             G+EYPR+ VL DG S  I+QT+ G   RALP  V DL+LP P+STLEK +  L+DTMSFV
Sbjct  553   GKEYPRKTVLGDGKSLEIRQTIDGXCCRALPSFVMDLKLPTPVSTLEKFVGQLLDTMSFV  612

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPSFR++QW++IVLLFLDALS+ R+P L P+MT + +LL KVL+ AQ+SAEEYE M+D
Sbjct  613   DTLPSFRIRQWRVIVLLFLDALSVHRLPSLAPHMTNKNMLLHKVLNPAQVSAEEYESMRD  672

Query  487   LIIPLGRVPEFTMQSGA  437
             LIIPL R  E +MQSG 
Sbjct  673   LIIPLSRFLELSMQSGG  689



>emb|CDY05542.1| BnaA02g31490D [Brassica napus]
Length=827

 Score =   256 bits (654),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 157/201 (78%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D  PE FNL+LSPF+ M+ +LF W+SSSSLA+IYG+DESAHEE+
Sbjct  631   PGTPDSDLFDRDQSWFDETPEGFNLTLSPFAMMWDSLFGWVSSSSLAYIYGKDESAHEEF  690

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I L +GLS+ IK+T+AGCL+RA+  +   L+LPVPIS LEKG+ SL++T
Sbjct  691   VSVNGKEYPRRIRLGEGLSSEIKETIAGCLARAVSTVATVLKLPVPISELEKGLGSLLET  750

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSFR++QW ++VLLFLDALS+CRIP + PY+  R     KVL+G+ I  EEYE
Sbjct  751   MSLTGAVPSFRVEQWLVVVLLFLDALSVCRIPRIAPYLLNRN----KVLEGSGIGNEEYE  806

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MK++++PLGRVP+F    GA
Sbjct  807   TMKEILLPLGRVPQFATLCGA  827



>ref|XP_009129907.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brassica rapa]
Length=852

 Score =   256 bits (653),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 157/201 (78%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D  PE FNL+LSPF+ M+ +LF W+SSSSLA+IYG+DESAHEE+
Sbjct  656   PGTPDSDLFDRDQSWFDETPEGFNLTLSPFAMMWDSLFGWVSSSSLAYIYGKDESAHEEF  715

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I L +GLS+ IK+T+AGCL+RA+  +   L+LPVPIS LEKG+ SL++T
Sbjct  716   VSVNGKEYPRRIRLGEGLSSEIKETIAGCLARAVSTVATVLKLPVPISELEKGLGSLLET  775

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSFR++QW ++VLLFLDALS+CRIP + PY+  R     KVL+G+ I  EEYE
Sbjct  776   MSLTGAVPSFRVEQWLVVVLLFLDALSVCRIPRIAPYLLNRN----KVLEGSGIGNEEYE  831

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MK++++PLGRVP+F    GA
Sbjct  832   TMKEILLPLGRVPQFATLCGA  852



>gb|KFK26439.1| hypothetical protein AALP_AA8G248600 [Arabis alpina]
Length=791

 Score =   254 bits (650),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 160/201 (80%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PP+ F+LSLS F+ M+ +LF W+SSSSLA+IYG+D+SAHEE+
Sbjct  595   PGIPDTDLFDRDQSWFDGPPDGFSLSLSSFAMMWDSLFGWVSSSSLAYIYGKDDSAHEEF  654

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               ++G +Y R+I+L DGLS+ IK+T+AGCL+RALP +  DLRLP+ IS LEKG+ SL++T
Sbjct  655   LSVDGMQYLRKIILGDGLSSEIKETIAGCLARALPRVATDLRLPIAISELEKGLGSLLET  714

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSF+M+QW +IVLLFLDALS+ RIP + PY+  R     K+L+G+ I +EEYE
Sbjct  715   MSLTGAVPSFKMEQWLVIVLLFLDALSVSRIPRIAPYVCNRN----KILEGSGIGSEEYE  770

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
             +MKD+++PLGRVP+F  +SGA
Sbjct  771   LMKDILLPLGRVPQFASRSGA  791



>emb|CDY25002.1| BnaC02g40060D [Brassica napus]
Length=772

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 157/201 (78%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LF+ + +W+D  PE FNL+LSPF+ M+ +LF W+SSSSLA+IYG+DESAHEE+
Sbjct  576   PGTPDSDLFERDQSWFDETPEGFNLTLSPFAMMWDSLFGWVSSSSLAYIYGKDESAHEEF  635

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I L +GLS+ IK+T+AGCL+RA+  +   L+LPVPIS LEKG+ SL++T
Sbjct  636   LSVNGKEYPRRIRLGEGLSSEIKETIAGCLARAVSTVATVLKLPVPISELEKGLGSLLET  695

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             +S    +PSFR++QW ++VLLFLDALS+CRIP + PY+  R     KVL+G+ I  EEYE
Sbjct  696   LSLTGAVPSFRVEQWLVVVLLFLDALSVCRIPRIAPYLLNRS----KVLEGSGIGNEEYE  751

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MK++++PLGRVP+F    GA
Sbjct  752   TMKEILLPLGRVPQFATLCGA  772



>ref|XP_010421540.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=890

 Score =   253 bits (647),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 159/201 (79%), Gaps = 4/201 (2%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  694   PGIPDSDLFDRDQSWFDGPPEGFNLTLSSFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  753

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+++L DGLS+ IKQT+AG L+RALP +   LRLP+ IS LEKG+ SL++T
Sbjct  754   LSVNGKEYPRRMILGDGLSSEIKQTIAGYLARALPRVATYLRLPIAISELEKGLGSLLET  813

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSF++K+W +IVLLFLDALS+ RIP + PY++ R     K+L+G+ I  EEYE
Sbjct  814   MSLTGAVPSFKIKEWLVIVLLFLDALSVSRIPRIAPYISNR----DKILEGSGIGNEEYE  869

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MKD+++PLGRVP+F  +SGA
Sbjct  870   TMKDILLPLGRVPQFATRSGA  890



>ref|XP_010493937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=879

 Score =   243 bits (619),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 156/201 (78%), Gaps = 7/201 (3%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  686   PGIPDSDLFDRDQSWFDGPPEGFNLTLSSFALMWDSLFGWVSSSSLAYIYGKEESAHEEF  745

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +   EYPR+I+L DGLS+ IKQT+AG L+RALP +   LRLP+ IS LEKG+ SL++T
Sbjct  746   LSV---EYPRRIILGDGLSSEIKQTIAGYLARALPRVATYLRLPIAISELEKGLGSLLET  802

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSF++K+W +IVLLFLDALS+ RIP + PY++ R     K+L+G+ I  EEYE
Sbjct  803   MSLTGAVPSFKIKEWLVIVLLFLDALSVSRIPRIAPYISNR----DKILEGSGIGNEEYE  858

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MKD+++PLGRVP+F  +SGA
Sbjct  859   TMKDILLPLGRVPQFATRSGA  879



>ref|XP_006841578.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Amborella trichopoda]
 gb|ERN03253.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
Length=591

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -1

Query  1015  FDSE-DTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGRE  839
             FD+E D+WYD+PPE F+L+LS F+TM+MALF W+++SS+A+IYGR ESA EE+  ++GRE
Sbjct  406   FDTEEDSWYDAPPEGFSLTLSSFATMWMALFGWVTASSMAYIYGRAESAEEEFVVVDGRE  465

Query  838   YPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPL  659
             YP + VL DGLS+ IK+TL+GCL+RALP +VA+++LP PISTLE  +  L+DTM+F + L
Sbjct  466   YPHKFVLGDGLSSEIKETLSGCLARALPGVVANIKLPTPISTLEVALGRLLDTMTFTEAL  525

Query  658   PSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLII  479
             P FRMKQW +IVLLFLDALS+  +P L  ++  RR L+ K+L+ AQ+S EEY IM+DL +
Sbjct  526   PPFRMKQWHVIVLLFLDALSVHIVPALEQHIASRRTLVHKMLEDAQVSNEEYNIMRDLFL  585

Query  478   P  476
             P
Sbjct  586   P  586



>gb|EPS64466.1| hypothetical protein M569_10314, partial [Genlisea aurea]
Length=597

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG    +L +S+DT YD PP+ FNLSLSPF T+F +LF+WISSSSLA+IYG+D+S HEEY
Sbjct  408   PGFSEADLVESDDTLYDRPPDGFNLSLSPFCTLFNSLFSWISSSSLAYIYGKDDSFHEEY  467

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
                NGREYP ++V  DG S+ IKQTL+  L+RALP +V++LRLP PIS LE+GM  L+DT
Sbjct  468   VNANGREYPCKVVAEDGRSSEIKQTLSAALARALPGVVSELRLPTPISILEQGMGRLLDT  527

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MSF+DPLPS R KQWQ IVLLFL+ALS+ RIP L+ Y+  RR  + KVL+GA I  EE+E
Sbjct  528   MSFIDPLPSLRTKQWQAIVLLFLNALSVSRIPALSKYLEDRRASIQKVLEGAGIGVEEFE  587

Query  499   IMKDLIIPLG  470
             +MKDLIIPLG
Sbjct  588   VMKDLIIPLG  597



>gb|ABR17753.1| unknown [Picea sitchensis]
Length=668

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 150/201 (75%), Gaps = 0/201 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             P   +   +D+ + W+D PP+ F+L LSPF+TM+MAL  WI+ SS+A +YGRD+S  +++
Sbjct  468   PSTIDEEAYDARECWFDDPPDGFSLELSPFATMWMALDRWITCSSVAHLYGRDDSDADDF  527

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
             S +NGREYPR+IV   GLS  I++T+A C+SRALP +V  LRLP PIS+LE+ +   ++T
Sbjct  528   STVNGREYPRKIVSGGGLSTEIERTVASCISRALPAVVQSLRLPTPISSLEQALGRFLNT  587

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             M+F+D +P FRM QW++IV+LFLDALS+  IP L P +  +R L+ KVL+ A+++ EEY+
Sbjct  588   MTFIDAIPPFRMNQWRVIVVLFLDALSVHHIPSLGPQIMNKRPLIHKVLEAAEMTYEEYK  647

Query  499   IMKDLIIPLGRVPEFTMQSGA  437
              MK+L+IPLGR P F+ QSG 
Sbjct  648   TMKELLIPLGRCPRFSSQSGG  668



>ref|XP_009389521.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Musa acuminata subsp. malaccensis]
Length=668

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++FD ED+W+D+PPE F+L LS F+TM+MALF WI+ SSLA+IYG D+S+ E++ ++N
Sbjct  476   DTDMFDVEDSWHDTPPEGFDLKLSSFATMWMALFGWITCSSLAYIYGCDKSSQEDFLYVN  535

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP +I+L DG S+ I++T+ GC+ RAL  LV ++ LPVP+STLE+ +  L+DTMSFV
Sbjct  536   GREYPHKIILKDGHSSEIRRTIDGCICRALSGLVMEISLPVPLSTLERTVGCLLDTMSFV  595

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPSF+++QWQ++VLLFLDALS+ R+P L   +T   +LL KVL+ A++S++EY+ M+D
Sbjct  596   DALPSFKLEQWQVVVLLFLDALSVHRLPSLASEVTNMDLLLHKVLNPAEVSSQEYDSMRD  655

Query  487   LIIPLGR  467
             L  PLGR
Sbjct  656   LFTPLGR  662



>ref|XP_002874325.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50584.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
Length=1147

 Score =   225 bits (574),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 106/210 (50%), Positives = 150/210 (71%), Gaps = 17/210 (8%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P+ +LFD + +W+D PPE FNL+LS F+ M+ +LF W+SSSSLA+IYG++ESAHEE+
Sbjct  946   PGIPDSDLFDRDQSWFDGPPEGFNLTLSNFAVMWDSLFGWVSSSSLAYIYGKEESAHEEF  1005

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDT  680
               +NG+EYPR+I+L DGLS+ IK+T+AGCL+RALP +   LRLP+ IS LEKG+ SL++T
Sbjct  1006  ISVNGKEYPRRIILGDGLSSEIKETMAGCLARALPRVTTYLRLPIAISELEKGLGSLLET  1065

Query  679   MSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYE  500
             MS    +PSF++K+W +IVLLFLDALS+ +  L+T            ++ G  +S     
Sbjct  1066  MSLTGAVPSFKIKEWLVIVLLFLDALSVSQARLVTVNFN--------IIKGESLSEFNLL  1117

Query  499   IM---------KDLIIPLGRVPEFTMQSGA  437
             IM         +D+++PLGRVP+F  +SGA
Sbjct  1118  IMLVKNIRFWKEDILLPLGRVPQFATRSGA  1147



>ref|XP_008345660.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Malus domestica]
Length=333

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             N++LFDSE+TW+D PPE F+L+LSPF TM+ +LF WI+SS+LA+IYGRDE  HEE+  IN
Sbjct  166   NFDLFDSEBTWFDDPPEGFSLTLSPFLTMWNSLFTWITSSTLAYIYGRDERFHEEFLSIN  225

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             G+EYP +IVL  G S+ IK+TLA  L+R LP +V+ LRLP P+S+LE+ M+ +++TM+FV
Sbjct  226   GKEYPXKIVLAGGHSSEIKKTLAESLARTLPGVVSQLRLPTPVSSLEQEMSRMLETMTFV  285

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPK  539
             D LP+FRMKQW+++VLLFL+ LS+ RIP L P M  RR+L  K
Sbjct  286   DALPAFRMKQWKVVVLLFLEGLSVXRIPALGPCMPDRRMLFHK  328



>ref|XP_010921353.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Elaeis guineensis]
Length=664

 Score =   215 bits (548),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ ED+W+D+PPE F+L+LS F+TM+MALF WI+ SSLA+IYG++ES+ +++  +N
Sbjct  485   DTDMFEVEDSWHDTPPEGFSLTLSSFATMWMALFGWITCSSLAYIYGQNESSQDDFLLVN  544

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP + VL DG S  I+QT+ G + RALP +V DL+LP P+STLEK +  L+DTMSFV
Sbjct  545   GREYPHKTVLGDGKSLEIRQTIDGFVCRALPSIVMDLKLPTPVSTLEKFVGRLLDTMSFV  604

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDG  527
             D LPSFR++QWQ+IVLLFLDALS+ R+P L P+MT R +LL K   G
Sbjct  605   DALPSFRIRQWQVIVLLFLDALSVHRLPPLAPHMTNRNMLLHKAAHG  651



>ref|NP_001137038.1| uncharacterized protein LOC100217208 [Zea mays]
 gb|ACF83133.1| unknown [Zea mays]
Length=324

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + +LF+ +D+W+D PPE F+L+LS F TM+ ALF WISSSSLA++YG +  + EE    N
Sbjct  131   DTDLFEVDDSWHDMPPEGFSLTLSAFGTMWAALFGWISSSSLAYVYGLERGSVEELLIAN  190

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GRE P + VL DGLS  I++ L  C+  A+PVL+++LRL +P+S LE  +  LIDTMSFV
Sbjct  191   GRECPEKTVLKDGLSLEIRRALDSCVCNAVPVLISNLRLQIPVSKLEITLGYLIDTMSFV  250

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPS R +QWQ +VL+ LDALS+ ++P L P  +  + L+ K+L+ AQ+S EEY+ M D
Sbjct  251   DALPSLRSRQWQAVVLVMLDALSVHQLPALAPVFSNSK-LVQKMLNAAQVSREEYDSMVD  309

Query  487   LIIPLGR  467
             L +P GR
Sbjct  310   LFLPFGR  316



>ref|XP_006654013.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog, partial [Oryza brachyantha]
Length=660

 Score =   207 bits (526),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++FD +D+W+D+PPE F+L+LS F+TM+ ALF WIS SSLA++YG DES+ E+    +
Sbjct  465   DTDMFDVDDSWHDTPPEGFSLTLSTFATMWAALFGWISRSSLAYVYGLDESSMEDLLVAS  524

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GRE PR++VL DG S+ I++ L  C+  ALPVLV++ R+ +P+S LE  +  LIDTMSFV
Sbjct  525   GRECPRKMVLNDGHSSEIRRALDTCVCNALPVLVSNWRMQIPVSKLEITLGYLIDTMSFV  584

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPS R +QWQ++VL+ LDALSI ++P L   M+  R LL K+L+ AQ+S EEY+ M D
Sbjct  585   DALPSLRSRQWQVMVLVLLDALSIHQLPGLAQTMSDSR-LLHKLLNSAQVSREEYDSMID  643

Query  487   LIIPLGR  467
             LI+P GR
Sbjct  644   LILPFGR  650



>sp|A2Y040.1|RPAP2_ORYSI RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Indica Group]
 gb|EAY96450.1| hypothetical protein OsI_18345 [Oryza sativa Indica Group]
Length=726

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++FD +D+W+D+PPE F+L+LS F+TM+ ALF W+S SSLA++YG DES+ E+     
Sbjct  531   DTDMFDVDDSWHDTPPEGFSLTLSSFATMWAALFGWVSRSSLAYVYGLDESSMEDLLIAG  590

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GRE P++ VL DG S+ I++ L  C+  ALPVLV++LR+ +P+S LE  +  L+DTMSFV
Sbjct  591   GRECPQKRVLNDGHSSEIRRALDTCVCNALPVLVSNLRMQIPVSKLEITLGYLLDTMSFV  650

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPS R +QWQL+VL+ LDALS+ R+P L P M+  + LL K+L+ AQ+S EEY+ M D
Sbjct  651   DALPSLRSRQWQLMVLVLLDALSLHRLPALAPIMSDSK-LLQKLLNSAQVSREEYDSMID  709

Query  487   LIIPLGR  467
             L++P GR
Sbjct  710   LLLPFGR  716



>sp|Q6AVZ9.1|RPAP2_ORYSJ RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Japonica Group]
 gb|AAT94046.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE62232.1| hypothetical protein OsJ_17019 [Oryza sativa Japonica Group]
Length=726

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++FD +D+W+D+PPE F+L+LS F+TM+ ALF W+S SSLA++YG DES+ E+     
Sbjct  531   DTDMFDVDDSWHDTPPEGFSLTLSSFATMWAALFGWVSRSSLAYVYGLDESSMEDLLIAG  590

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GRE P++ VL DG S+ I++ L  C+  ALPVLV++LR+ +P+S LE  +  L+DTMSFV
Sbjct  591   GRECPQKRVLNDGHSSEIRRALDTCVCNALPVLVSNLRMQIPVSKLEITLGYLLDTMSFV  650

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPS R +QWQL+VL+ LDALS+ R+P L P M+  + LL K+L+ AQ+S EEY+ M D
Sbjct  651   DALPSLRSRQWQLMVLVLLDALSLHRLPALAPIMSDSK-LLQKLLNSAQVSREEYDSMID  709

Query  487   LIIPLGR  467
             L++P GR
Sbjct  710   LLLPFGR  716



>ref|XP_003569080.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brachypodium distachyon]
Length=746

 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE FNL+LS F+TM+  LF WIS SSLA++Y  D S+ EE    +
Sbjct  547   DTDMFEVDDSWHDTPPEGFNLTLSAFATMWATLFGWISRSSLAYVYMLDGSSVEELLISS  606

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP++ V  D  S+ IK+TLA C+  ALPVL ++LR+ +P+S LE  +  LIDTMSFV
Sbjct  607   GREYPQKTVSKDSQSSEIKRTLATCIGNALPVLTSNLRMQIPVSKLETTLGYLIDTMSFV  666

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             + LP  R +QWQL+VL+ LDALS+CR+P L P M+  + LL KVL+ +Q+S EEY+ M D
Sbjct  667   EALPPLRSRQWQLMVLVLLDALSVCRLPGLAPVMSDSK-LLQKVLNSSQVSREEYDSMVD  725

Query  487   LIIPLGR  467
             L +P GR
Sbjct  726   LFLPFGR  732



>ref|XP_007016930.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
 gb|EOY34549.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
Length=708

 Score =   205 bits (522),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P+ ++F+ ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDES HE
Sbjct  537   KKPGIPHSDMFNPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDESFHE  596

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+I L DG S+ IK+TLA C+SRALP +V DLRLP+PISTLE+GM  LI
Sbjct  597   EYLSINGREYPRKIALRDGRSSEIKETLASCISRALPAIVTDLRLPIPISTLEQGMGHLI  656

Query  685   DTMSFVDPLPSFRMKQWQL  629
             DT+SF++ LP+FRMKQW++
Sbjct  657   DTISFMEALPAFRMKQWEI  675



>ref|XP_007016927.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
 gb|EOY34546.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
Length=679

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P+ ++F+ ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDES HE
Sbjct  537   KKPGIPHSDMFNPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDESFHE  596

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             EY  INGREYPR+I L DG S+ IK+TLA C+SRALP +V DLRLP+PISTLE+GM  LI
Sbjct  597   EYLSINGREYPRKIALRDGRSSEIKETLASCISRALPAIVTDLRLPIPISTLEQGMGHLI  656

Query  685   DTMSFVDPLPSFRMKQWQLIV  623
             DT+SF++ LP+FRMKQW  +V
Sbjct  657   DTISFMEALPAFRMKQWCWMV  677



>ref|XP_002440538.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
 gb|EES18968.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
Length=746

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE F+L+LS F T++ ALF WIS SSLA++YG +  + EE    N
Sbjct  553   DTDMFEVDDSWHDTPPEGFSLTLSAFGTIWAALFGWISRSSLAYVYGLERGSVEELLIAN  612

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP +IVL DGLS+ I++ L  C+  A+PVL+++LRL +P+S LE  +  LIDTMSFV
Sbjct  613   GREYPEKIVLKDGLSSEIRRALDSCVCNAVPVLISNLRLQIPVSKLEITLGYLIDTMSFV  672

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             + LPS R +QWQ +VL+ LDALS+ ++P L P  +  + L+ K+L+ AQ+S EEY+ M D
Sbjct  673   EALPSLRSRQWQAVVLVMLDALSVHQLPALAPVFSNSK-LVQKMLNAAQVSREEYDSMVD  731

Query  487   LIIPLGRVPEFT  452
             L +P GR  + T
Sbjct  732   LFLPFGRSVQAT  743



>ref|XP_008654513.1| PREDICTED: uncharacterized protein LOC100217208 isoform X1 [Zea 
mays]
 gb|AFW82703.1| hypothetical protein ZEAMMB73_107648 [Zea mays]
Length=725

 Score =   201 bits (512),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + +LF+ +D+W+D PPE F+L+LS F TM+ ALF WISSSSLA++YG +  + EE    N
Sbjct  532   DTDLFEVDDSWHDMPPEGFSLTLSAFGTMWAALFGWISSSSLAYVYGLERGSVEELLIAN  591

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GRE P + VL DGLS  I++ L  C+  A+PVL+++LRL +P+S LE  +  LIDTMSFV
Sbjct  592   GRECPEKTVLKDGLSLEIRRALDSCVCNAVPVLISNLRLQIPVSKLEITLGYLIDTMSFV  651

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LPS R +QWQ +VL+ LDALS+ ++P L P  +  + L+ K+L+ AQ+S EEY+ M D
Sbjct  652   DALPSLRSRQWQAVVLVMLDALSVHQLPALAPVFSNSK-LVQKMLNAAQVSREEYDSMVD  710

Query  487   LIIPLGR  467
             L +P GR
Sbjct  711   LFLPFGR  717



>ref|XP_004960407.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Setaria italica]
Length=739

 Score =   194 bits (492),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 141/194 (73%), Gaps = 1/194 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE F+L+LS F+TM+ ALF WIS +SLA++YG D  + E+    N
Sbjct  546   DTDMFEVDDSWHDTPPEGFSLTLSGFATMWAALFGWISRASLAYVYGLDGCSVEDLLIAN  605

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP +IVL DG SA I++ L  C+  ALPVLV++LRL +P+S LE  +  LIDTMSF 
Sbjct  606   GREYPEKIVLKDGHSAEIRRALDTCVCNALPVLVSNLRLRIPVSKLEITLGYLIDTMSFF  665

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             DPLPS R +QWQL+VL+ LD LSI ++P L P ++  + L+ K+L+ AQ+S EEYE M D
Sbjct  666   DPLPSLRSRQWQLVVLVMLDVLSIHQLPALAPVVSNSK-LVQKMLNAAQVSREEYESMVD  724

Query  487   LIIPLGRVPEFTMQ  446
             L +P GR  +  MQ
Sbjct  725   LFLPFGRSIQTFMQ  738



>gb|EMT25025.1| hypothetical protein F775_26015 [Aegilops tauschii]
Length=711

 Score =   191 bits (485),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE F+L+LS F+TM+  +F WIS SSL ++Y  D+S+ EE    N
Sbjct  518   DTDMFEVDDSWHDTPPEGFSLTLSAFATMWTTIFGWISRSSLTYVYMLDDSSVEEMLISN  577

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP + V  D  S+ IK+ LA C+S ALPVLV+++R+ +P+S LE  +  LIDTMS V
Sbjct  578   GREYPEKRVSKDSQSSEIKRALASCISNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLV  637

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LP+ R +QWQL+VL+ LDALS+ R+P L P ++  + L+ KVL+ AQ+S EEY+ + D
Sbjct  638   DALPALRSRQWQLLVLVLLDALSVHRLPALAPVISDSK-LVHKVLNSAQVSREEYDSIVD  696

Query  487   LIIPLGR  467
             LI+P GR
Sbjct  697   LILPFGR  703



>gb|EMS49261.1| hypothetical protein TRIUR3_22581 [Triticum urartu]
Length=543

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 138/196 (70%), Gaps = 10/196 (5%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE F+L+LS F+TM+  +F WIS SSLA++Y  D+S+ EE    N
Sbjct  341   DTDMFEVDDSWHDTPPEGFSLTLSAFATMWTTIFGWISRSSLAYVYMLDDSSVEEMLISN  400

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP + V  D  S+ IK+ LA C+S ALPVLV+++R+ +P+S LE  +  LIDTMS V
Sbjct  401   GREYPEKRVSKDSQSSEIKRALASCISNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLV  460

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKV---------LDGAQIS  515
             D LP+ R +QWQL+VL+ LDALS+ ++P L P ++  + L+ KV         L+ AQ+S
Sbjct  461   DALPALRSRQWQLLVLVLLDALSVHQLPALAPVISDSK-LVQKVAFLFRTSLILNSAQVS  519

Query  514   AEEYEIMKDLIIPLGR  467
              EEY+ M DLI+P GR
Sbjct  520   REEYDSMVDLILPFGR  535



>dbj|BAJ96888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   187 bits (476),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + ++F+ +D+W+D+PPE F+L+LS F+TM+  +F WIS SSLA++Y  D+S+ EE    N
Sbjct  550   DTDMFEVDDSWHDTPPEGFSLTLSAFATMWTTIFGWISRSSLAYVYMLDDSSVEEMLISN  609

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFV  668
             GREYP + V  D  S+ IK+ LA C+S ALPVLV+++R+ +P+S LE  +  LIDTMS V
Sbjct  610   GREYPEKRVSKDSQSSEIKRALASCISNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLV  669

Query  667   DPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKD  488
             D LP+ R +QWQL+VL+ LDALS+ R+P L P ++  + L+ K+L+ AQ+S EEY+ M D
Sbjct  670   DALPALRSRQWQLLVLMLLDALSVHRLPALAPVISDSK-LVQKILNSAQVSREEYDSMVD  728

Query  487   LIIPLGR  467
             LI+P GR
Sbjct  729   LILPFGR  735



>ref|XP_009629198.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Nicotiana tomentosiformis]
Length=656

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -1

Query  1036  GPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYS  857
             G PNY++F+SED+WYDSPPE FNL+LSPF+TMF +LF WISSSSL+FIYG DES++EEY 
Sbjct  481   GVPNYDVFESEDSWYDSPPEGFNLNLSPFATMFNSLFTWISSSSLSFIYGNDESSNEEYL  540

Query  856   FINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASL  689
              INGREYPR+IVL+DG S  IKQTLA CL+RALP LVADLRLPVPIS LE+G+ +L
Sbjct  541   SINGREYPRKIVLSDGRSTEIKQTLARCLARALPELVADLRLPVPISVLEQGVCAL  596



>emb|CDX80586.1| BnaC07g28580D [Brassica napus]
Length=607

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 130/203 (64%), Gaps = 31/203 (15%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
               PG P++++FD + +W+D PP    LSL+                   +IYG+DESA+E
Sbjct  436   NKPGMPDFDIFDPDQSWFDGPP--IGLSLTA-----------------TYIYGKDESAYE  476

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLI  686
             E+ F+NG EYPR+I+L D LS+ IK+T++GCL+RA         LP+ I  L KG+ SL+
Sbjct  477   EFLFVNGNEYPRRIMLVDRLSSEIKETISGCLARA--------GLPIAIYELGKGLGSLV  528

Query  685   DTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEE  506
             +TMS    +PSFR++QWQ+IV + LDALS+CRIP + PY+  +     KVL+G  I  E+
Sbjct  529   ETMSLTWAVPSFRVEQWQVIVFVLLDALSVCRIPRIAPYIFNKN----KVLEGRGIGNED  584

Query  505   YEIMKDLIIPLGRVPEFTMQSGA  437
             YE MKD+++PLGRVP F  + G 
Sbjct  585   YETMKDILLPLGRVPRFDTRCGG  607



>gb|KDO45360.1| hypothetical protein CISIN_1g0087651mg [Citrus sinensis]
Length=469

 Score =   176 bits (447),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -1

Query  1039  PGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEY  860
             PG P   LFD ED+WYD PPE F+L+LSPF+TM+MA+FAWISSSSLA+IYGRDES HEEY
Sbjct  354   PGIPRSELFDPEDSWYDEPPEGFSLTLSPFATMWMAIFAWISSSSLAYIYGRDESFHEEY  413

Query  859   SFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMA  695
               +NGREY ++I++ DG S+ IKQTL+GCL+R  P LVADLRL +P+STLEKG+A
Sbjct  414   LSVNGREYSQKIIMGDGHSSAIKQTLSGCLARTFPALVADLRLRIPVSTLEKGLA  468



>ref|XP_001782029.1| predicted protein [Physcomitrella patens]
 gb|EDQ53172.1| predicted protein [Physcomitrella patens]
Length=863

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 121/175 (69%), Gaps = 0/175 (0%)
 Frame = -1

Query  961  LSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPRQIVLTDGLSAXIKQTL  782
            +S F T+FMAL +W S ++LA IYG++    ++Y  +NGREY RQ+V+ DG+S+ I +T 
Sbjct  689  VSLFGTIFMALESWTSGAALAHIYGKEPQEEDQYLSVNGREYSRQVVIGDGVSSEILRTF  748

Query  781  AGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDAL  602
            + C+SRALP +V  LRLPVP+STLE  M  LI  MSFV+ LP    KQW+++V++ LDAL
Sbjct  749  SLCVSRALPEVVRALRLPVPMSTLEVAMGKLIKNMSFVEALPPLSTKQWRMLVIVLLDAL  808

Query  601  SICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  437
            S+ R+P L  ++   R +L KVLD    S  EY++ +D+++PLGR P F+  SG 
Sbjct  809  SVQRLPRLGVHLMNNRSVLRKVLDSTGTSESEYDVFRDVLLPLGRSPTFSTLSGG  863



>emb|CDX88239.1| BnaA06g28300D [Brassica napus]
Length=303

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 21/175 (12%)
 Frame = -1

Query  961  LSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPRQIVLTDGLSAXIKQTL  782
            LS F  M+ +LF+W SSSSLA+IYG+D+SAHEE+ F+ G+EYPR+I+L DGLS+ IK+T+
Sbjct  150  LSTFGMMWDSLFSWASSSSLAYIYGKDKSAHEEFLFVYGKEYPRRIILVDGLSSEIKETI  209

Query  781  AGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDAL  602
            AGCL+RALP +  DLRLP+PIS L KG+                 ++QWQ+IV + LDAL
Sbjct  210  AGCLARALPRVATDLRLPIPISELGKGL-----------------VEQWQVIVFVLLDAL  252

Query  601  SICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  437
            S+CRIP + PY+  R     KVL+G+ I  E+YE MKD+++PLGRVP+F  + G 
Sbjct  253  SVCRIPRIAPYIFNRN----KVLEGSGIGNEDYETMKDILLPLGRVPQFATRCGG  303



>ref|XP_007016929.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
 gb|EOY34548.1| F2P16.20 protein, putative isoform 4 [Theobroma cacao]
Length=607

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHE  866
             + PG P+ ++F+ ED+W+D+PPE F+L+LS F+TM+ ALF WI+SSSLA+IYGRDES HE
Sbjct  483   KKPGIPHSDMFNPEDSWFDAPPEGFSLTLSTFATMWNALFEWITSSSLAYIYGRDESFHE  542

Query  865   EYSFINGREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGM  698
             EY  INGREYPR+I L DG S+ IK+TLA C+SRALP +V DLRLP+PISTLE+GM
Sbjct  543   EYLSINGREYPRKIALRDGRSSEIKETLASCISRALPAIVTDLRLPIPISTLEQGM  598



>ref|XP_009771016.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana sylvestris]
Length=576

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  691  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  512
            LIDTMSFVDPLP+FRMKQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA
Sbjct  492  LIDTMSFVDPLPAFRMKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISA  551

Query  511  EEYEIMKDLIIPLGRVPEFTMQSGA  437
             EYEI+KDLIIPLGRVP+F+MQSG 
Sbjct  552  AEYEILKDLIIPLGRVPQFSMQSGG  576


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTM  941
             + PG PNY++F+SED+WYDSPPE FNL++    TM
Sbjct  462   RKPGVPNYDVFESEDSWYDSPPEGFNLNVLLIDTM  496



>ref|XP_009629199.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X4 [Nicotiana tomentosiformis]
Length=592

 Score =   165 bits (418),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  691  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  512
            LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA
Sbjct  508  LIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISA  567

Query  511  EEYEIMKDLIIPLGRVPEFTMQSGA  437
             EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  568  VEYEIMKDLIIPLGRVPQFSMQSGG  592



>ref|XP_009602823.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=576

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -1

Query  691  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  512
            LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGA ISA
Sbjct  492  LIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAHISA  551

Query  511  EEYEIMKDLIIPLGRVPEFTMQSGA  437
             EYEIMKDL+IPLGRVP+F+MQSG 
Sbjct  552  AEYEIMKDLVIPLGRVPQFSMQSGG  576


 Score = 52.8 bits (125),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  1045  QSPGPPNYNLFDSEDTWYDSPPEEFNLSLSPFSTM  941
             + PG PNY++F+SED+WYDSPPE FNL++    TM
Sbjct  462   RKPGVPNYDVFESEDSWYDSPPEGFNLNVLLIDTM  496


 Score = 20.4 bits (41),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 8/18 (44%), Positives = 9/18 (50%), Gaps = 0/18 (0%)
 Frame = -3

Query  1091  NGQVXGAEPHSQNWPTKP  1038
             N +V   EP    WP KP
Sbjct  447   NDEVLDTEPAPLKWPRKP  464



>ref|XP_002990357.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
 gb|EFJ08626.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
Length=608

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 8/192 (4%)
 Frame = -1

Query  1009  SEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPR  830
             S  +WY +PP+ +   +SPF  ++MAL  W+SS +LA IYGRD+   EE+  +NGR  P 
Sbjct  424   SRSSWYSAPPKPYKAEVSPFGLLWMALDEWVSSGTLAHIYGRDD---EEFRDVNGR-VP-  478

Query  829   QIVLTDGLSA-XIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPS  653
               V  DG S+  I +T++ C+SR LP +V  L +  P+S +E+ +  L+ TM F   LP+
Sbjct  479   --VDGDGSSSPDILRTISSCVSRVLPDVVQALAIAEPLSVIERAVGRLLGTMHFSQALPA  536

Query  652   FRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPL  473
             F  K W++I  LFLDALS+ R+P L   MT  R LL K++  + ++  EYE  K+L++PL
Sbjct  537   FTTKHWRMIAALFLDALSVHRLPGLGSQMTNNRALLRKLIIDSGMNDPEYESFKELLLPL  596

Query  472   GRVPEFTMQSGA  437
             GR+P F    G 
Sbjct  597   GRLPAFASGGGG  608



>ref|XP_002979385.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
 gb|EFJ19793.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
Length=608

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 8/192 (4%)
 Frame = -1

Query  1009  SEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPR  830
             S  +WY +PP+ +   +SPF  ++MAL  W+SS +LA IYGRD+   EE+  +NGR  P 
Sbjct  424   SRSSWYSAPPKPYKAEVSPFGLLWMALDEWVSSGTLAHIYGRDD---EEFRDVNGR-VP-  478

Query  829   QIVLTDGLSA-XIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPS  653
               V  DG S+  I +T++ C+SR LP +V  L +  P+S +E+ +  L+ TM F   LP+
Sbjct  479   --VDGDGSSSPDILRTISSCVSRVLPDVVQALAIAEPLSVIERAVGRLLGTMHFSQALPA  536

Query  652   FRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPL  473
             F  K W++I  LFLDALS+ R+P L   MT  R LL K++  + ++  EYE  K+L++PL
Sbjct  537   FTTKHWRMIAALFLDALSVHRLPGLGGQMTNNRALLRKLIIDSGMNDPEYESFKELLLPL  596

Query  472   GRVPEFTMQSGA  437
             GR+P F    G 
Sbjct  597   GRLPAFASGGGG  608



>ref|XP_010921354.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Elaeis guineensis]
Length=593

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  691  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  512
            L+DTMSFVD LPSFR++QWQ+IVLLFLDALS+ R+P L P+MT R +LL KVL+ AQ+SA
Sbjct  509  LLDTMSFVDALPSFRIRQWQVIVLLFLDALSVHRLPPLAPHMTNRNMLLHKVLNPAQVSA  568

Query  511  EEYEIMKDLIIPLGRVPEFTMQSGA  437
            EEYE M+DLIIPLGR PE +MQSG 
Sbjct  569  EEYESMRDLIIPLGRFPELSMQSGG  593



>ref|XP_008654514.1| PREDICTED: uncharacterized protein LOC100217208 isoform X2 [Zea 
mays]
Length=645

 Score =   121 bits (304),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  1027  NYNLFDSEDTWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFIN  848
             + +LF+ +D+W+D PPE F+L+LS F TM+ ALF WISSSSLA++YG +  + EE    N
Sbjct  532   DTDLFEVDDSWHDMPPEGFSLTLSAFGTMWAALFGWISSSSLAYVYGLERGSVEELLIAN  591

Query  847   GREYPRQIVLTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLE  707
             GRE P + VL DGLS  I++ L  C+  A+PVL+++LRL +P+S LE
Sbjct  592   GRECPEKTVLKDGLSLEIRRALDSCVCNAVPVLISNLRLQIPVSKLE  638



>ref|XP_005844427.1| hypothetical protein CHLNCDRAFT_139124 [Chlorella variabilis]
 gb|EFN52325.1| hypothetical protein CHLNCDRAFT_139124 [Chlorella variabilis]
Length=905

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 83/169 (49%), Gaps = 17/169 (10%)
 Frame = -1

Query  973  FNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPRQIVLTDGLSAXI  794
            F L LS F T F  L AW++SS+   +    ++               ++ L    S  +
Sbjct  751  FRLQLSFFGTFFTHLEAWVTSSTAELLASGPDA---------------ELALPPPTSPEV  795

Query  793  KQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLF  614
               L+ CLS ALP + A L+       +E+ +  L+ T+  V PLP+F+  QWQ++ +LF
Sbjct  796  LAALSRCLSAALPPVCAGLQAAAARGQVERSLDELLRTLRLVGPLPAFKASQWQVVAVLF  855

Query  613  LDALSICRIPLLTPYMTGRRIL--LPKVLDGAQISAEEYEIMKDLIIPL  473
            L ALS+ R P L      R  +  L ++L     ++EE+  + +L+ P+
Sbjct  856  LKALSLERCPALREAFETRDGITRLNRLLASLSFTSEEFYAILELLCPV  904



>gb|KDO45356.1| hypothetical protein CISIN_1g0087652mg, partial [Citrus sinensis]
 gb|KDO45357.1| hypothetical protein CISIN_1g0087652mg, partial [Citrus sinensis]
Length=34

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  538  VLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  437
            VLDGAQISAEEYE+MKD ++PLGR P+F+ QSGA
Sbjct  1    VLDGAQISAEEYEVMKDFLMPLGRAPQFSSQSGA  34



>gb|ACG46670.1| hypothetical protein [Zea mays]
Length=54

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  691  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTP  572
            +IDT+SFVD LPS R +QWQ +VL+ LDALS+ ++P L P
Sbjct  1    MIDTLSFVDALPSLRSRQWQAVVLVMLDALSVHQLPALAP  40



>gb|KIY99645.1| hypothetical protein MNEG_8313 [Monoraphidium neglectum]
Length=104

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -1

Query  772  LSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSIC  593
            L  ALP ++A LR+ VP S + + +++L+ T+    PLPS + +QWQ +V L L  LS  
Sbjct  2    LGAALPPVLAALRVKVPASDVSRHVSALVRTLDLSRPLPSLQARQWQAVVALLLAGLSWG  61

Query  592  RIPLLTPYMTGRR  554
            R+  L P  +  R
Sbjct  62   RLEGLRPVFSRAR  74



>dbj|GAM26926.1| hypothetical protein SAMD00019534_101010 [Acytostelium subglobosum 
LB1]
Length=504

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 66/140 (47%), Gaps = 16/140 (11%)
 Frame = -1

Query  1000 TWYDSPPEEFNLSLSPFSTMFMALFAWISSSSLAFIYGRDESAHEEYSFINGREYPRQIV  821
            T +  P     L +S + +++  L  W +  +  F+    +++ +   FI   + P    
Sbjct  344  TGFLEPSASKQLPISNYHSVYAPLSEWRTEVTETFLKSPTDTSTD---FIRSDQVPH---  397

Query  820  LTDGLSAXIKQTLAGCLSRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMK  641
                    IK  L   LS+  P +V  L L   IS+ E  MASL+ T S + P+PS    
Sbjct  398  --------IKMALNQYLSQYYPTVVKVLDLQDYISSHE--MASLVHTFSLIRPIPSLSPN  447

Query  640  QWQLIVLLFLDALSICRIPL  581
             W++IV++F+ ALS+  I L
Sbjct  448  HWRMIVMVFIKALSLRSIEL  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2883090749160