BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7116

Length=836
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG09712.1|  Chaperonin CPN60-2, mitochondrial                       313   2e-101   Gossypium arboreum [tree cotton]
ref|XP_004147171.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       317   1e-100   Cucumis sativus [cucumbers]
ref|XP_008460701.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       316   4e-100   Cucumis melo [Oriental melon]
gb|KHG09711.1|  Chaperonin CPN60-2, mitochondrial                       316   4e-100   Gossypium arboreum [tree cotton]
gb|KHG24292.1|  Chaperonin CPN60-2, mitochondrial                       316   5e-100   Gossypium arboreum [tree cotton]
gb|KJB37765.1|  hypothetical protein B456_006G219200                    315   6e-100   Gossypium raimondii
ref|XP_010097984.1|  Chaperonin CPN60-2                                 311   7e-100   
sp|Q05046.1|CH62_CUCMA  RecName: Full=Chaperonin CPN60-2, mitocho...    314   3e-99    Cucurbita maxima [Boston marrow]
ref|XP_009800688.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       314   3e-99    Nicotiana sylvestris
gb|ABP01596.1|  heat shock protein 60                                   306   4e-99    Ageratina adenophora
ref|NP_001064784.1|  Os10g0462900                                       313   5e-99    
ref|XP_010264000.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       313   6e-99    Nelumbo nucifera [Indian lotus]
gb|KDO43056.1|  hypothetical protein CISIN_1g013743mg                   307   6e-99    Citrus sinensis [apfelsine]
ref|XP_009616503.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       313   6e-99    Nicotiana tomentosiformis
gb|KDO43055.1|  hypothetical protein CISIN_1g013743mg                   308   8e-99    Citrus sinensis [apfelsine]
sp|Q05045.1|CH61_CUCMA  RecName: Full=Chaperonin CPN60-1, mitocho...    312   1e-98    Cucurbita maxima [Boston marrow]
gb|AAP54159.2|  Chaperonin CPN60-1, mitochondrial precursor, puta...    313   2e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004247810.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       312   2e-98    Solanum lycopersicum
emb|CDO99385.1|  unnamed protein product                                311   2e-98    Coffea canephora [robusta coffee]
ref|XP_006340914.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    311   2e-98    Solanum tuberosum [potatoes]
ref|XP_010243653.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    311   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_002285608.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       311   2e-98    Vitis vinifera
ref|XP_008349053.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    306   3e-98    
emb|CDX93002.1|  BnaA03g37240D                                          310   3e-98    
ref|XP_010527490.1|  PREDICTED: chaperonin CPN60, mitochondrial         311   3e-98    Tarenaya hassleriana [spider flower]
ref|XP_009135882.1|  PREDICTED: chaperonin CPN60, mitochondrial         311   3e-98    Brassica rapa
emb|CDX94835.1|  BnaC03g43530D                                          311   3e-98    
gb|EYU46365.1|  hypothetical protein MIMGU_mgv1a026299mg                310   5e-98    Erythranthe guttata [common monkey flower]
gb|AFW68650.1|  chaperonin 1                                            298   6e-98    
ref|XP_006662418.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    310   6e-98    Oryza brachyantha
ref|XP_003591643.1|  Chaperonin CPN60-like protein                      310   9e-98    Medicago truncatula
emb|CDX79518.1|  BnaC03g18540D                                          297   9e-98    
ref|XP_002303091.1|  Chaperonin CPN60-2 family protein                  310   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_008810807.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       310   1e-97    Phoenix dactylifera
ref|XP_010556941.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    310   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_011024539.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    309   2e-97    Populus euphratica
ref|XP_006492150.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    309   2e-97    Citrus sinensis [apfelsine]
ref|XP_007225634.1|  hypothetical protein PRUPE_ppa003391mg             309   2e-97    Prunus persica
ref|XP_008224072.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       309   2e-97    Prunus mume [ume]
ref|XP_007034504.1|  Heat shock protein 60 isoform 1                    309   2e-97    
ref|XP_010513304.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    309   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010466805.1|  PREDICTED: chaperonin CPN60, mitochondrial         308   3e-97    Camelina sativa [gold-of-pleasure]
ref|XP_002518171.1|  chaperonin-60kD, ch60, putative                    308   5e-97    Ricinus communis
gb|AGT98547.1|  heat shock protein 60                                   296   6e-97    Paeonia lactiflora [common garden peony]
ref|XP_002885624.1|  hypothetical protein ARALYDRAFT_898985             308   8e-97    Arabidopsis lyrata subsp. lyrata
gb|EMS57340.1|  Chaperonin CPN60-2, mitochondrial                       308   8e-97    Triticum urartu
ref|NP_189041.1|  heat shock protein 60                                 307   1e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAA77646.1|  chaperonin hsp60                                       307   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918836.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       307   1e-96    Elaeis guineensis
ref|XP_011091383.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       307   1e-96    Sesamum indicum [beniseed]
ref|XP_010023772.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       306   2e-96    Eucalyptus grandis [rose gum]
ref|XP_010933209.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    306   2e-96    Elaeis guineensis
emb|CDY59050.1|  BnaC07g48200D                                          299   2e-96    Brassica napus [oilseed rape]
gb|ABK92479.1|  unknown                                                 302   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008812917.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    308   2e-96    Phoenix dactylifera
ref|XP_009599981.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    306   3e-96    Nicotiana tomentosiformis
ref|XP_004239874.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       306   3e-96    Solanum lycopersicum
ref|XP_006355738.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    305   5e-96    Solanum tuberosum [potatoes]
ref|XP_006410460.1|  hypothetical protein EUTSA_v10016425mg             305   6e-96    Eutrema salsugineum [saltwater cress]
ref|XP_009362047.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    305   7e-96    Pyrus x bretschneideri [bai li]
ref|XP_006297236.1|  hypothetical protein CARUB_v10013241mg             306   1e-95    
ref|XP_009371099.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    305   1e-95    Pyrus x bretschneideri [bai li]
gb|ACN31425.1|  unknown                                                 297   1e-95    Zea mays [maize]
gb|EMT21164.1|  Chaperonin CPN60-2, mitochondrial                       306   1e-95    
ref|XP_009758421.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    304   1e-95    Nicotiana sylvestris
ref|XP_007201704.1|  hypothetical protein PRUPE_ppa004110mg             303   1e-95    
ref|XP_006410461.1|  hypothetical protein EUTSA_v10016427mg             304   2e-95    Eutrema salsugineum [saltwater cress]
ref|XP_012077667.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       304   2e-95    Jatropha curcas
ref|XP_012085173.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    304   2e-95    Jatropha curcas
gb|AAN63805.1|  heat shock protein 60                                   303   2e-95    Prunus dulcis [sweet almond]
ref|XP_006841664.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       303   3e-95    Amborella trichopoda
ref|XP_003536270.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    303   3e-95    Glycine max [soybeans]
ref|XP_004496080.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    303   3e-95    Cicer arietinum [garbanzo]
ref|XP_010522438.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    303   4e-95    Tarenaya hassleriana [spider flower]
gb|KJB42389.1|  hypothetical protein B456_007G151700                    301   4e-95    Gossypium raimondii
ref|XP_002299295.2|  Chaperonin CPN60-2 family protein                  303   4e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008346198.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       303   4e-95    
ref|XP_008372428.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    303   4e-95    
ref|XP_009377449.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       303   5e-95    Pyrus x bretschneideri [bai li]
gb|KFK31072.1|  hypothetical protein AALP_AA6G064600                    303   5e-95    Arabis alpina [alpine rockcress]
ref|XP_003556325.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    302   7e-95    Glycine max [soybeans]
gb|KJB42386.1|  hypothetical protein B456_007G151700                    302   7e-95    Gossypium raimondii
ref|XP_010550847.1|  PREDICTED: chaperonin CPN60, mitochondrial-like    302   9e-95    Tarenaya hassleriana [spider flower]
gb|KHN00995.1|  Chaperonin CPN60-2, mitochondrial                       302   9e-95    Glycine soja [wild soybean]
ref|XP_004299212.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       302   1e-94    Fragaria vesca subsp. vesca
ref|XP_009420744.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       301   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002149.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       301   2e-94    Populus euphratica
ref|XP_004982955.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    301   3e-94    Setaria italica
gb|AFK46346.1|  unknown                                                 294   3e-94    Medicago truncatula
dbj|BAK05600.1|  predicted protein                                      301   4e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009405691.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    300   4e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002467123.1|  hypothetical protein SORBIDRAFT_01g020010          300   4e-94    Sorghum bicolor [broomcorn]
ref|XP_004496079.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    300   5e-94    
ref|XP_003574012.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       300   6e-94    Brachypodium distachyon [annual false brome]
ref|XP_003558831.1|  PREDICTED: chaperonin CPN60-1, mitochondrial       300   6e-94    Brachypodium distachyon [annual false brome]
ref|XP_002521151.1|  chaperonin-60kD, ch60, putative                    300   6e-94    Ricinus communis
ref|XP_007145430.1|  hypothetical protein PHAVU_007G238500g             300   7e-94    Phaseolus vulgaris [French bean]
ref|XP_006651029.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    300   7e-94    Oryza brachyantha
ref|XP_003535967.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    300   8e-94    Glycine max [soybeans]
ref|XP_010109672.1|  Chaperonin CPN60-2                                 299   1e-93    Morus notabilis
ref|XP_007144180.1|  hypothetical protein PHAVU_007G135100g             299   1e-93    Phaseolus vulgaris [French bean]
emb|CAA77645.1|  chaperonin hsp60                                       299   1e-93    Zea mays [maize]
ref|XP_008644293.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    299   2e-93    
ref|NP_001105690.1|  chaperonin CPN60-2, mitochondrial precursor        299   2e-93    Zea mays [maize]
sp|P29185.2|CH61_MAIZE  RecName: Full=Chaperonin CPN60-1, mitocho...    299   2e-93    Zea mays [maize]
emb|CAA78101.1|  mitochondrial chaperonin-60                            299   2e-93    Zea mays [maize]
ref|NP_001105716.1|  chaperonin CPN60-1, mitochondrial precursor        299   2e-93    Zea mays [maize]
emb|CDX84697.1|  BnaA03g15330D                                          298   2e-93    
ref|XP_010413901.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    298   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010469503.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    298   3e-93    Camelina sativa [gold-of-pleasure]
gb|EMT05673.1|  Chaperonin CPN60-2, mitochondrial                       298   3e-93    
ref|XP_003555721.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    298   4e-93    Glycine max [soybeans]
ref|XP_010509916.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    298   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_003591642.1|  Chaperonin CPN60-2                                 297   8e-93    Medicago truncatula
gb|AAC04902.1|  mitochondrial chaperonin (HSP60)                        296   8e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049890.1|  Heat shock protein 60 isoform 1                    297   9e-93    
ref|XP_009132917.1|  PREDICTED: chaperonin CPN60, mitochondrial         297   1e-92    Brassica rapa
gb|AAA33450.1|  chaperonin 60                                           296   1e-92    Zea mays [maize]
ref|NP_001189665.1|  heat shock protein 60-2                            296   2e-92    Arabidopsis thaliana [mouse-ear cress]
sp|P35480.1|CH60_BRANA  RecName: Full=Chaperonin CPN60, mitochond...    296   2e-92    Brassica napus [oilseed rape]
ref|NP_850203.1|  heat shock protein 60-2                               296   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358471.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       296   2e-92    
ref|NP_001048938.1|  Os03g0143400                                       296   3e-92    
ref|XP_004290029.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    295   4e-92    Fragaria vesca subsp. vesca
gb|ERN04382.1|  hypothetical protein AMTR_s00147p00091670               295   5e-92    Amborella trichopoda
ref|XP_011622760.1|  PREDICTED: chaperonin CPN60, mitochondrial         295   5e-92    Amborella trichopoda
gb|EMS53265.1|  Chaperonin CPN60-2, mitochondrial                       297   6e-92    Triticum urartu
emb|CDY17152.1|  BnaA05g10360D                                          295   7e-92    Brassica napus [oilseed rape]
emb|CDY19471.1|  BnaC04g11280D                                          295   7e-92    Brassica napus [oilseed rape]
ref|XP_009143882.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    295   9e-92    Brassica rapa
ref|XP_004139642.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    294   1e-91    Cucumis sativus [cucumbers]
ref|XP_002881268.1|  hypothetical protein ARALYDRAFT_902390             295   1e-91    Arabidopsis lyrata subsp. lyrata
gb|KFK31073.1|  hypothetical protein AALP_AA6G064700                    294   1e-91    Arabis alpina [alpine rockcress]
ref|XP_006293894.1|  hypothetical protein CARUB_v10022887mg             292   7e-91    Capsella rubella
ref|XP_004985740.1|  PREDICTED: chaperonin CPN60-1, mitochondrial...    290   4e-90    Setaria italica
emb|CDP03832.1|  unnamed protein product                                289   1e-89    Coffea canephora [robusta coffee]
ref|XP_011020718.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    287   5e-89    Populus euphratica
ref|XP_010666478.1|  PREDICTED: chaperonin CPN60-2, mitochondrial       284   7e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU43803.1|  hypothetical protein MIMGU_mgv1a003536mg                283   2e-87    Erythranthe guttata [common monkey flower]
ref|XP_008235753.1|  PREDICTED: chaperonin CPN60-2, mitochondrial...    281   6e-87    Prunus mume [ume]
ref|XP_001772410.1|  predicted protein                                  281   1e-86    
ref|XP_002966324.1|  hypothetical protein SELMODRAFT_85251              276   6e-85    
gb|KFK24236.1|  hypothetical protein AALP_AAs53933U000100               262   3e-84    Arabis alpina [alpine rockcress]
ref|XP_001783814.1|  predicted protein                                  275   3e-84    
ref|XP_002978237.1|  hypothetical protein SELMODRAFT_108429             274   4e-84    
ref|XP_001760735.1|  predicted protein                                  273   2e-83    
ref|XP_001762115.1|  predicted protein                                  270   3e-82    
gb|AEZ00902.1|  putative mitochondrial chaperonin HSP60 protein         253   1e-80    Elaeis guineensis
ref|XP_008808005.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    257   4e-79    Phoenix dactylifera
ref|XP_010106240.1|  hypothetical protein L484_005105                   260   5e-79    
ref|XP_009410784.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    261   7e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT28156.1|  Chaperonin CPN60-like 2, mitochondrial                  259   4e-78    
dbj|BAJ88210.1|  predicted protein                                      259   5e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001140224.1|  uncharacterized protein LOC100272259               255   5e-78    
ref|XP_010925015.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    254   9e-78    
ref|XP_008807997.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    258   1e-77    Phoenix dactylifera
ref|XP_004961365.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    258   1e-77    Setaria italica
ref|XP_002441451.1|  hypothetical protein SORBIDRAFT_09g026970          256   7e-77    Sorghum bicolor [broomcorn]
ref|XP_008647482.1|  PREDICTED: uncharacterized protein LOC100272...    255   9e-77    Zea mays [maize]
ref|XP_008647480.1|  PREDICTED: uncharacterized protein LOC100272...    255   1e-76    
ref|XP_010242227.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    255   1e-76    Nelumbo nucifera [Indian lotus]
ref|XP_010925013.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    255   1e-76    Elaeis guineensis
gb|KDO65217.1|  hypothetical protein CISIN_1g0081811mg                  242   4e-76    Citrus sinensis [apfelsine]
gb|AFW78925.1|  putative TCP-1/cpn60 chaperonin family protein          255   4e-76    
ref|XP_008391328.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    253   5e-76    Malus domestica [apple tree]
ref|XP_010654528.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    252   2e-75    Vitis vinifera
gb|KJB56921.1|  hypothetical protein B456_009G141700                    248   2e-75    Gossypium raimondii
ref|XP_003567994.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    252   2e-75    Brachypodium distachyon [annual false brome]
emb|CAN78641.1|  hypothetical protein VITISV_031740                     252   2e-75    Vitis vinifera
emb|CBI35954.3|  unnamed protein product                                251   2e-75    Vitis vinifera
ref|XP_009341038.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    251   4e-75    Pyrus x bretschneideri [bai li]
gb|KHN11282.1|  Chaperonin CPN60-like 2, mitochondrial                  251   4e-75    Glycine soja [wild soybean]
ref|XP_006655538.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    251   4e-75    Oryza brachyantha
ref|XP_006585518.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   4e-75    
ref|XP_002967038.1|  hypothetical protein SELMODRAFT_87823              250   5e-75    
ref|XP_007215308.1|  hypothetical protein PRUPE_ppa003440mg             250   1e-74    Prunus persica
ref|XP_003627097.1|  Chaperonin CPN60-like protein                      249   2e-74    Medicago truncatula
gb|KJB56920.1|  hypothetical protein B456_009G141700                    248   2e-74    Gossypium raimondii
ref|XP_003531614.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   2e-74    Glycine max [soybeans]
ref|XP_012068975.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   2e-74    Jatropha curcas
ref|XP_012068973.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    249   3e-74    Jatropha curcas
gb|KJB56919.1|  hypothetical protein B456_009G141700                    248   4e-74    Gossypium raimondii
ref|XP_008228292.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    248   5e-74    Prunus mume [ume]
gb|AFK48092.1|  unknown                                                 241   7e-74    Lotus japonicus
ref|XP_002960969.1|  hypothetical protein SELMODRAFT_74977              247   8e-74    
ref|XP_006385442.1|  hypothetical protein POPTR_0003s04540g             241   2e-73    
ref|XP_004510380.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    246   2e-73    Cicer arietinum [garbanzo]
gb|EYU21369.1|  hypothetical protein MIMGU_mgv1a003594mg                246   3e-73    Erythranthe guttata [common monkey flower]
emb|CDO97909.1|  unnamed protein product                                246   4e-73    Coffea canephora [robusta coffee]
ref|XP_007024507.1|  Heat shock protein 60-3A isoform 3                 245   4e-73    
ref|NP_566466.1|  heat shock protein 60-3A                              246   5e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002946991.1|  hypothetical protein VOLCADRAFT_79395              245   7e-73    Volvox carteri f. nagariensis
ref|XP_010534892.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    245   7e-73    Tarenaya hassleriana [spider flower]
ref|XP_007024505.1|  Heat shock protein 60-3A isoform 1                 245   8e-73    
ref|XP_011072524.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    245   9e-73    Sesamum indicum [beniseed]
ref|XP_004297534.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    245   9e-73    Fragaria vesca subsp. vesca
ref|XP_002884993.1|  hypothetical protein ARALYDRAFT_478789             244   2e-72    Arabidopsis lyrata subsp. lyrata
ref|NP_001056181.1|  Os05g0540300                                       244   2e-72    
ref|XP_006583012.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    244   2e-72    Glycine max [soybeans]
ref|XP_010487162.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    243   4e-72    Camelina sativa [gold-of-pleasure]
gb|KFK38736.1|  hypothetical protein AALP_AA3G153700                    243   4e-72    Arabis alpina [alpine rockcress]
ref|XP_010465258.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    243   4e-72    Camelina sativa [gold-of-pleasure]
ref|XP_007135549.1|  hypothetical protein PHAVU_010G138700g             243   5e-72    Phaseolus vulgaris [French bean]
ref|XP_001691353.1|  chaperonin 60C                                     242   5e-72    Chlamydomonas reinhardtii
ref|XP_010501368.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    243   5e-72    Camelina sativa [gold-of-pleasure]
gb|EEC79614.1|  hypothetical protein OsI_20809                          243   8e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_006466018.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    242   8e-72    Citrus sinensis [apfelsine]
ref|XP_006426562.1|  hypothetical protein CICLE_v10025257mg             242   8e-72    Citrus clementina [clementine]
ref|XP_002527401.1|  chaperonin-60kD, ch60, putative                    242   9e-72    Ricinus communis
emb|CBL93634.1|  mitochondrial chaperonin 60 precursor                  242   9e-72    Chlamydomonas reinhardtii
ref|XP_010685392.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    242   1e-71    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX82514.1|  BnaA03g33070D                                          242   1e-71    
gb|KHN39306.1|  Chaperonin CPN60-like 2, mitochondrial                  242   1e-71    Glycine soja [wild soybean]
emb|CDX75733.1|  BnaC03g38160D                                          242   1e-71    
ref|XP_009135334.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    241   2e-71    Brassica rapa
ref|XP_006296696.1|  hypothetical protein CARUB_v10013333mg             241   3e-71    Capsella rubella
ref|XP_006342978.1|  PREDICTED: LOW QUALITY PROTEIN: chaperonin C...    240   5e-71    
ref|XP_009796310.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    240   6e-71    Nicotiana sylvestris
ref|XP_004235594.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    240   7e-71    Solanum lycopersicum
ref|XP_010062630.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    239   1e-70    Eucalyptus grandis [rose gum]
ref|XP_009629888.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    238   2e-70    Nicotiana tomentosiformis
ref|XP_011659644.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    238   3e-70    Cucumis sativus [cucumbers]
gb|KDP40768.1|  hypothetical protein JCGZ_24767                         245   5e-70    Jatropha curcas
ref|XP_006407158.1|  hypothetical protein EUTSA_v10020386mg             237   8e-70    Eutrema salsugineum [saltwater cress]
gb|KCW69759.1|  hypothetical protein EUGRSUZ_F03134                     238   1e-69    Eucalyptus grandis [rose gum]
emb|CDY37741.1|  BnaA04g19270D                                          238   1e-69    Brassica napus [oilseed rape]
dbj|GAM29219.1|  hypothetical protein SAMD00019534_123950               233   8e-69    Acytostelium subglobosum LB1
gb|ABX76300.1|  heat shock protein 60                                   233   1e-68    Ageratina adenophora
ref|XP_008462350.1|  PREDICTED: chaperonin CPN60-like 2, mitochon...    234   1e-68    Cucumis melo [Oriental melon]
gb|EWM24608.1|  Chaperonin Cpn60/TCP-1                                  233   3e-68    Nannochloropsis gaditana
gb|EWM24609.1|  Chaperonin Cpn60/TCP-1                                  233   4e-68    Nannochloropsis gaditana
ref|XP_002881304.1|  predicted protein                                  220   6e-68    
dbj|BAL45644.1|  heat shock protein 60                                  229   1e-66    Ulva pertusa
dbj|BAL45642.1|  heat shock protein 60                                  228   2e-66    Ulva pertusa
gb|EPS57724.1|  hypothetical protein M569_17093                         216   2e-66    Genlisea aurea
ref|XP_004359903.1|  chaperonin 60                                      227   5e-66    Cavenderia fasciculata
ref|XP_007034505.1|  Heat shock protein 60 isoform 2                    225   8e-66    
ref|XP_008299606.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    224   8e-66    Stegastes partitus
ref|XP_005848352.1|  hypothetical protein CHLNCDRAFT_51922              224   1e-65    Chlorella variabilis
ref|XP_011401079.1|  Chaperonin CPN60, mitochondrial                    226   1e-65    Auxenochlorella protothecoides
gb|KDD77186.1|  TCP-1/cpn60 chaperonin                                  226   2e-65    Helicosporidium sp. ATCC 50920
emb|CBJ29791.1|  conserved unknown protein                              225   3e-65    Ectocarpus siliculosus
ref|XP_008299605.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    224   5e-65    Stegastes partitus
ref|XP_003286221.1|  chaperonin 60                                      224   5e-65    Dictyostelium purpureum
ref|XP_636839.1|  chaperonin 60                                         224   7e-65    Dictyostelium discoideum AX4
gb|AAK49534.1|AF359268_1  chaperonin 60                                 223   8e-65    Dictyostelium discoideum
gb|ADM73510.1|  heat shock protein                                      223   2e-64    Epinephelus akaara
gb|EUC55864.1|  TCP-1/cpn60 chaperonin family protein                   213   2e-64    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_010746058.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    222   2e-64    
gb|AIS72878.1|  heat shock protein 60                                   223   3e-64    Epinephelus coioides [estuary cod]
ref|XP_010746059.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    223   3e-64    
ref|XP_003064760.1|  predicted protein                                  221   4e-64    Micromonas pusilla CCMP1545
ref|XP_006811178.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    214   5e-64    Saccoglossus kowalevskii
gb|KEP47507.1|  heat shock protein                                      213   5e-64    Rhizoctonia solani 123E
ref|XP_009141297.1|  PREDICTED: chaperonin CPN60-like 1, mitochon...    221   7e-64    
ref|XP_003961681.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    221   9e-64    
ref|WP_025898344.1|  molecular chaperone GroEL                          220   1e-63    Sneathiella glossodoripedis
emb|CDY66712.1|  BnaCnng52030D                                          221   1e-63    Brassica napus [oilseed rape]
emb|CAG02593.1|  unnamed protein product                                221   2e-63    Tetraodon nigroviridis
gb|KJB42388.1|  hypothetical protein B456_007G151700                    219   2e-63    Gossypium raimondii
emb|CBK24112.2|  unnamed protein product                                220   2e-63    Blastocystis hominis
gb|ADK27679.1|  heat shock protein 60                                   219   4e-63    Tanichthys albonubes
ref|XP_008862079.1|  chaperonin GroL                                    219   6e-63    Aphanomyces invadans
ref|XP_008862081.1|  chaperonin GroL                                    219   7e-63    Aphanomyces invadans
ref|XP_002504338.1|  predicted protein                                  218   7e-63    Micromonas commoda
ref|XP_005816401.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   7e-63    Xiphophorus maculatus
ref|XP_007227826.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   8e-63    
ref|XP_007578942.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    219   8e-63    Poecilia formosa
ref|XP_008435956.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    218   1e-62    Poecilia reticulata
ref|XP_002110795.1|  hypothetical protein TRIADDRAFT_54071              218   1e-62    Trichoplax adhaerens
emb|CCQ48609.1|  chaperonin 60                                          218   1e-62    Channa striata [banded snakehead]
ref|XP_002963470.1|  hypothetical protein SELMODRAFT_405358             216   2e-62    
ref|XP_003456322.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    218   2e-62    Oreochromis niloticus
ref|XP_004086930.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    218   2e-62    Oryzias latipes [Japanese rice fish]
ref|WP_033067622.1|  molecular chaperone GroEL                          217   2e-62    Thalassospira australica
gb|ABB76381.1|  heat shock protein 60 kDa                               218   2e-62    Paralichthys olivaceus [bastard halibut]
ref|XP_011471912.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    218   2e-62    
gb|AGU38790.1|  60 kDa heat shock protein                               218   2e-62    Sparus aurata [gilthead bream]
gb|ABB76384.1|  heat shock protein 60 kDa                               218   2e-62    Paralichthys olivaceus [bastard halibut]
ref|WP_028831782.1|  molecular chaperone GroEL                          217   2e-62    
gb|ACZ97602.1|  heat shock protein 60                                   207   3e-62    
ref|XP_009842908.1|  chaperonin GroL                                    217   3e-62    
emb|CEF99267.1|  Chaperonin Cpn60                                       217   3e-62    
gb|AEM65177.1|  heat shock protein 60                                   217   3e-62    
ref|XP_006805883.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    217   4e-62    
gb|ACN60194.1|  60 kDa heat shock protein, mitochondrial precursor      209   5e-62    
ref|XP_003081465.1|  chaperonin-60, mitochondrial precursor (IC)        218   6e-62    
gb|KEP46963.1|  heat shock protein                                      216   7e-62    
ref|NP_851847.1|  60 kDa heat shock protein, mitochondrial              216   8e-62    
ref|WP_037990063.1|  molecular chaperone GroEL                          215   8e-62    
gb|ADU34083.1|  60 kDa heat shock protein                               216   8e-62    
ref|WP_007090383.1|  molecular chaperone GroEL                          215   9e-62    
ref|WP_045776103.1|  molecular chaperone GroEL                          212   1e-61    
ref|WP_043647224.1|  molecular chaperone GroEL                          205   1e-61    
ref|XP_009535382.1|  hypothetical protein PHYSODRAFT_549587             215   1e-61    
gb|AAH18545.1|  Hspd1 protein                                           207   1e-61    
ref|WP_022079109.1|  molecular chaperone GroEL                          215   1e-61    
ref|WP_008829923.1|  molecular chaperone GroEL                          214   1e-61    
emb|CCO36244.1|  Heat shock protein 60 AltName: Full=60 kDa chape...    215   1e-61    
ref|WP_036528739.1|  molecular chaperone GroEL                          214   2e-61    
gb|EJY67525.1|  hypothetical protein OXYTRI_11964                       215   2e-61    
ref|WP_026986320.1|  molecular chaperone GroEL                          215   2e-61    
ref|XP_002988181.1|  hypothetical protein SELMODRAFT_159265             214   2e-61    
ref|XP_005646765.1|  mitochondrial chaperonin 60                        215   2e-61    
ref|XP_004569892.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    215   2e-61    
ref|WP_022730236.1|  molecular chaperone GroEL                          214   2e-61    
ref|XP_001419890.1|  chaperonin 60, mitochondrial                       215   2e-61    
ref|XP_002785716.1|  heat shock protein 60, putative                    215   2e-61    
ref|WP_022187336.1|  molecular chaperone GroEL                          214   2e-61    
ref|WP_044827409.1|  molecular chaperone GroEL                          214   2e-61    
ref|XP_007510337.1|  chaperonin GroEL                                   215   2e-61    
gb|ADR79280.1|  Hsp60                                                   215   2e-61    
ref|WP_022727012.1|  molecular chaperone GroEL                          214   2e-61    
ref|XP_005746374.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    215   2e-61    
ref|WP_029009456.1|  molecular chaperone GroEL                          214   2e-61    
ref|XP_003886122.1|  KLLA0F09449p, related                              215   2e-61    
emb|CEG63693.1|  Putative Chaperonin Cpn60                              215   2e-61    
emb|CCI46088.1|  unnamed protein product                                215   2e-61    
emb|CEI91416.1|  Putative Heat shock protein 60                         215   2e-61    
emb|CBM69252.1|  heat shock protein 60                                  214   2e-61    
ref|XP_504920.1|  YALI0F02805p                                          214   3e-61    
emb|CCA20827.1|  mitochondriatargeted chaperonin putative               214   3e-61    
emb|CDS09381.1|  Putative Hsp60-like protein                            214   3e-61    
gb|ABE02805.1|  heat shock protein 60                                   215   3e-61    
emb|CCO36707.1|  Heat shock protein 60 AltName: Full=60 kDa chape...    214   3e-61    
emb|CEL61194.1|  Heat shock protein 60, mitochondrial OS=Paracocc...    214   3e-61    
ref|XP_007586200.1|  putative heat shock protein mitochondrial pr...    214   4e-61    
gb|AAD38419.1|  heat shock protein 60                                   214   4e-61    
gb|EKF32414.1|  chaperonin HSP60/CNP60, putative                        204   5e-61    
ref|XP_002367122.1|  heat shock protein 60                              214   5e-61    
ref|WP_014745213.1|  molecular chaperone GroEL                          213   5e-61    
gb|ABQ85794.1|  chaperonin 60                                           214   5e-61    
ref|XP_008883792.1|  heat shock protein HSP60                           214   5e-61    
ref|WP_020694061.1|  molecular chaperone GroEL                          213   5e-61    
gb|KDQ33327.1|  hypothetical protein PLEOSDRAFT_1073596                 214   5e-61    
gb|EKG16075.1|  Chaperonin Cpn60                                        214   6e-61    
ref|WP_022005890.1|  molecular chaperone GroEL                          213   6e-61    
gb|ABE02806.1|  heat shock protein 60                                   214   6e-61    
gb|ABN11936.1|  putative 60 kDa heat shock protein                      203   6e-61    
gb|ABJ97613.1|  mitochondrial 60 kDa heat shock protein                 212   6e-61    
ref|WP_046022245.1|  molecular chaperone GroEL                          213   7e-61    
ref|XP_004338977.1|  chaperonin GroL, putative                          213   8e-61    
ref|WP_008890519.1|  molecular chaperone GroEL                          213   8e-61    
gb|KFP74423.1|  hypothetical protein N311_07171                         209   8e-61    
ref|XP_008604447.1|  chaperonin GroL                                    213   9e-61    
ref|WP_044418420.1|  molecular chaperone GroEL                          205   9e-61    
ref|XP_009863848.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   9e-61    
ref|XP_007341550.1|  chaperonin GroL                                    213   1e-60    
gb|EIE82168.1|  hsp60-like protein                                      213   1e-60    
ref|XP_002778119.1|  heat shock protein 60, putative                    213   1e-60    
ref|WP_027298755.1|  molecular chaperone GroEL                          213   1e-60    
ref|XP_002783469.1|  heat shock protein 60, putative                    213   1e-60    
ref|XP_008894090.1|  chaperonin GroL                                    213   1e-60    
gb|ESA22226.1|  hypothetical protein GLOINDRAFT_115691                  213   1e-60    
gb|KHJ33155.1|  putative heat shock protein 60                          213   2e-60    
gb|AAR88509.1|  mitochondrial 60 kDa heat shock protein                 213   2e-60    
gb|EIE77419.1|  hsp60-like protein                                      213   2e-60    
ref|WP_025291094.1|  molecular chaperone GroEL                          212   2e-60    
gb|EKF28291.1|  chaperonin HSP60/CNP60, putative                        204   2e-60    
gb|ACI33148.1|  60 kDa heat shock protein, mitochondrial precursor      212   2e-60    
ref|WP_038036676.1|  molecular chaperone GroEL                          211   2e-60    
emb|CDQ81357.1|  unnamed protein product                                212   2e-60    
ref|XP_002901426.1|  chaperonin CPN60-1, mitochondrial precursor        213   2e-60    
gb|AGK38254.1|  HSP60                                                   212   2e-60    
ref|XP_819510.1|  chaperonin HSP60, mitochondrial precursor             204   3e-60    
ref|XP_005708137.1|  chaperonin GroEL                                   213   3e-60    
ref|XP_010878297.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    212   3e-60    
ref|WP_024080866.1|  molecular chaperone GroEL                          211   3e-60    
gb|ADN34111.1|  chaperonin-60 kDa protein                               216   3e-60    
ref|WP_014239089.1|  molecular chaperone GroEL                          211   3e-60    
gb|EPQ64594.1|  Tetradecameric mitochondrial chaperonin                 211   4e-60    
ref|WP_018455623.1|  hypothetical protein                               202   4e-60    
ref|WP_018316496.1|  molecular chaperone GroEL                          202   5e-60    
ref|WP_028336830.1|  hypothetical protein                               201   5e-60    
gb|ELU39076.1|  heat shock protein 60                                   211   5e-60    
ref|XP_005230978.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    211   6e-60    
ref|XP_009227414.1|  heat shock protein 60                              211   6e-60    
ref|XP_007267381.1|  chaperonin GroL                                    211   6e-60    
ref|WP_011387923.1|  molecular chaperone GroEL                          210   7e-60    
ref|NP_001012934.1|  60 kDa heat shock protein, mitochondrial pre...    211   7e-60    
ref|XP_003716826.1|  heat shock protein 60                              211   8e-60    
ref|XP_010083615.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    211   8e-60    
emb|CDW59388.1|  chaperonin protein heat shock protein60                211   8e-60    
ref|WP_040966135.1|  molecular chaperone GroEL                          210   9e-60    
ref|WP_028142935.1|  hypothetical protein                               201   9e-60    
ref|WP_020399994.1|  molecular chaperone GroEL                          210   9e-60    
ref|WP_028343952.1|  hypothetical protein                               200   9e-60    
ref|WP_028739813.1|  hypothetical protein                               202   1e-59    
ref|XP_002765682.1|  heat shock protein 60, putative                    210   1e-59    
ref|XP_011324894.1|  heat shock protein 60                              211   1e-59    
ref|WP_011542364.1|  molecular chaperone GroEL                          209   1e-59    
emb|CDQ82625.1|  unnamed protein product                                210   1e-59    
ref|WP_028339955.1|  hypothetical protein                               199   1e-59    
gb|AHN60091.1|  heat shock protein 60                                   210   1e-59    
ref|WP_035670811.1|  molecular chaperone GroEL                          209   1e-59    
gb|ACN11370.1|  60 kDa heat shock protein, mitochondrial precursor      210   1e-59    
ref|XP_663693.1|  HS60_PARBR Heat shock protein 60, mitochondrial...    210   1e-59    
gb|KFZ46253.1|  hypothetical protein N321_13520                         209   1e-59    
emb|CCU80781.1|  heat shock protein 60, mitochondrial precursor         210   1e-59    
ref|XP_009923792.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   1e-59    
ref|XP_010161784.1|  PREDICTED: LOW QUALITY PROTEIN: 60 kDa heat ...    209   1e-59    
ref|WP_020818487.1|  MULTISPECIES: molecular chaperone GroEL            209   2e-59    
ref|WP_010339470.1|  molecular chaperone GroEL                          209   2e-59    
ref|WP_041954938.1|  molecular chaperone GroEL                          199   2e-59    
gb|EWZ01910.1|  heat shock protein 60, mitochondrial                    207   2e-59    
gb|KIJ57314.1|  hypothetical protein M422DRAFT_773922                   210   2e-59    
ref|WP_028154362.1|  hypothetical protein                               199   2e-59    
gb|AIU47033.1|  heat shock protein                                      210   2e-59    
ref|WP_029002347.1|  molecular chaperone GroEL                          209   2e-59    
ref|XP_006636350.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   2e-59    
ref|XP_010156395.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   2e-59    
ref|XP_010210566.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   2e-59    
gb|EWG43456.1|  heat shock protein 60, mitochondrial                    207   2e-59    
ref|WP_028344430.1|  hypothetical protein                               200   2e-59    
ref|WP_028166259.1|  molecular chaperone GroEL                          209   2e-59    
gb|EDL32336.1|  mCG116284                                               207   2e-59    
ref|WP_018009709.1|  hypothetical protein                               199   2e-59    
emb|CDH58893.1|  heat shock protein 60                                  209   2e-59    
ref|XP_007910972.1|  putative heat shock protein 60 protein             209   2e-59    
ref|WP_042702032.1|  molecular chaperone GroEL                          209   2e-59    
ref|XP_009816210.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   2e-59    
ref|XP_001395564.1|  heat shock protein 60                              209   2e-59    
ref|XP_009252354.1|  hypothetical protein FPSE_00959                    211   3e-59    
ref|WP_039337605.1|  molecular chaperone GroEL                          208   3e-59    
ref|WP_012384725.1|  molecular chaperone GroEL                          209   3e-59    
gb|EFA83887.1|  chaperonin 60                                           209   3e-59    
ref|WP_022196717.1|  molecular chaperone GroEL                          209   3e-59    
ref|WP_027298450.1|  molecular chaperone GroEL                          209   3e-59    
ref|WP_027298203.1|  molecular chaperone GroEL                          208   3e-59    
ref|XP_010144262.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   3e-59    
ref|XP_010281402.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   3e-59    
dbj|GAO14262.1|  hypothetical protein UVI_013200                        209   3e-59    
ref|WP_028170603.1|  hypothetical protein                               198   3e-59    
ref|XP_010005666.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   3e-59    
gb|EQL02142.1|  hsp60 mitochondrial precursor-like protein              209   3e-59    
ref|WP_033073924.1|  molecular chaperone GroEL                          208   3e-59    
gb|ABE73686.1|  mitochondrial chaperonin Hsp56                          209   4e-59    
ref|XP_009888462.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   4e-59    
emb|CDK26533.1|  unnamed protein product                                209   4e-59    
gb|KFR00091.1|  hypothetical protein N306_13046                         207   4e-59    
gb|AHB82279.1|  heat shock protein 60                                   209   4e-59    
ref|XP_009329761.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   4e-59    
ref|WP_025548312.1|  MULTISPECIES: molecular chaperone GroEL            208   4e-59    
emb|CDS13330.1|  Putative Heat shock protein 60, mitochondrial          209   4e-59    
ref|XP_009980100.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   4e-59    
ref|XP_009923791.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   4e-59    
ref|WP_038383540.1|  molecular chaperone GroEL                          201   4e-59    
ref|XP_010185448.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    209   5e-59    
ref|XP_971630.1|  PREDICTED: 60 kDa heat shock protein, mitochond...    209   5e-59    
ref|XP_007792474.1|  putative heat shock protein 60 protein             209   5e-59    
gb|AGK45628.1|  heat shock protein 60                                   209   5e-59    
gb|KFZ52788.1|  hypothetical protein N338_03137                         208   5e-59    
ref|WP_019646754.1|  molecular chaperone GroEL                          208   5e-59    
ref|WP_008946164.1|  molecular chaperone GroEL                          208   5e-59    
ref|XP_009966601.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   5e-59    
gb|EYE97023.1|  chaperonin GroL                                         209   5e-59    
ref|XP_009486204.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   5e-59    
ref|XP_009581096.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   5e-59    
ref|XP_009460526.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   5e-59    
gb|AEE61633.1|  unknown                                                 208   5e-59    
ref|XP_008713891.1|  hsp60-like protein                                 209   5e-59    
ref|XP_010200226.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   5e-59    
emb|CCE01863.1|  60 kDa chaperonin (Protein Cpn60) (groEL protein...    200   5e-59    
ref|XP_003031435.1|  hypothetical protein SCHCODRAFT_82538              209   6e-59    
ref|WP_024325676.1|  hypothetical protein                               199   6e-59    
ref|WP_027534447.1|  hypothetical protein                               200   6e-59    
ref|XP_001218472.1|  heat shock protein 60, mitochondrial precursor     209   6e-59    
gb|KHO02050.1|  Heat shock protein 60 precursor (Antigen HIS-62)        208   6e-59    
ref|XP_009936202.1|  PREDICTED: LOW QUALITY PROTEIN: 60 kDa heat ...    207   6e-59    
ref|XP_010017601.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   6e-59    
ref|WP_021243898.1|  molecular chaperone GroEL                          207   7e-59    
ref|XP_009076628.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|XP_009641875.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|XP_009707568.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|XP_005021933.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|XP_007401713.1|  hypothetical protein PHACADRAFT_265217             208   7e-59    
ref|WP_014248859.1|  molecular chaperone GroEL                          207   7e-59    
ref|XP_009908885.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|XP_007320147.1|  hypothetical protein SERLADRAFT_416470             208   7e-59    
ref|XP_011574404.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   7e-59    
ref|WP_007013258.1|  molecular chaperone GroEL                          207   7e-59    
ref|XP_009501500.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    207   8e-59    
ref|XP_006961679.1|  hsp60 mitochondrial precursor-like protein         208   8e-59    
gb|ABW76102.1|  chaperonin 60                                           207   8e-59    
ref|XP_003207490.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   8e-59    
ref|WP_007406588.1|  MULTISPECIES: molecular chaperone GroEL            207   8e-59    
dbj|GAA86507.1|  heat shock protein 60, mitochondrial precursor         208   8e-59    
gb|ENN78676.1|  hypothetical protein YQE_04848                          209   8e-59    
gb|EAW70151.1|  heat shock 60kDa protein 1 (chaperonin), isoform ...    203   8e-59    
ref|XP_009282961.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    208   8e-59    
ref|WP_045368212.1|  molecular chaperone GroEL                          207   9e-59    
emb|CAA70287.1|  60kDa heat shock protein                               199   9e-59    
ref|WP_044425354.1|  molecular chaperone GroEL                          207   9e-59    
dbj|GAM33428.1|  mitochondrial heat shock protein                       208   1e-58    
gb|KJZ80377.1|  Heat shock protein 60                                   208   1e-58    
ref|WP_008833305.1|  molecular chaperone GroEL                          207   1e-58    
ref|XP_003657887.1|  hypothetical protein THITE_127923                  207   1e-58    
emb|CAC33756.1|  60 kDa chaperonin                                      199   1e-58    
ref|XP_009086360.1|  PREDICTED: 60 kDa heat shock protein, mitoch...    207   1e-58    
ref|WP_018318688.1|  hypothetical protein                               199   1e-58    



>gb|KHG09712.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
Length=380

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  204  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  263

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  264  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  323

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  324  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  370



>ref|XP_004147171.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis sativus]
 gb|KGN61548.1| hypothetical protein Csa_2G169720 [Cucumis sativus]
Length=575

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPKDEKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKEVPA  565



>ref|XP_008460701.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Cucumis melo]
Length=575

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVELP+DEKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPQDEKEVPA  565



>gb|KHG09711.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
Length=575

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  565



>gb|KHG24292.1| Chaperonin CPN60-2, mitochondrial [Gossypium arboreum]
 gb|KJB37762.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37763.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
 gb|KJB37764.1| hypothetical protein B456_006G219100 [Gossypium raimondii]
Length=575

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  565



>gb|KJB37765.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
 gb|KJB37766.1| hypothetical protein B456_006G219200 [Gossypium raimondii]
Length=575

 Score =   315 bits (808),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  565



>ref|XP_010097984.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXB73714.1| Chaperonin CPN60-2 [Morus notabilis]
Length=439

 Score =   311 bits (797),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 159/167 (95%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  267  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  326

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            +L TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  327  ELQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  386

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKD+K+ PA
Sbjct  387  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDDKDVPA  433



>sp|Q05046.1|CH62_CUCMA RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Cucurbita maxima]
 pir||S29316 chaperonin 60 - cucurbit
 emb|CAA50218.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/167 (95%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPKDEKE PA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKEVPA  565



>ref|XP_009800688.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana sylvestris]
Length=575

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KEL+
Sbjct  399  RLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD+ DLGYDAAKGEYV
Sbjct  459  KLETANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  565



>gb|ABP01596.1| heat shock protein 60 [Ageratina adenophora]
Length=359

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  193  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  252

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKG+YV
Sbjct  253  KLQTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGQYV  312

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSLLTTTEAV+VELPKDEKE+PA
Sbjct  313  DMVKGGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKESPA  359



>ref|NP_001064784.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|AAN05528.1| mitochondrial chaperonin-60 [Oryza sativa Japonica Group]
 dbj|BAF26698.1| Os10g0462900 [Oryza sativa Japonica Group]
 gb|EEC67118.1| hypothetical protein OsI_33923 [Oryza sativa Indica Group]
 gb|EEE51095.1| hypothetical protein OsJ_31804 [Oryza sativa Japonica Group]
 gb|ADR66966.1| 60 kDa chaperonin [Oryza sativa Japonica Group]
Length=574

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+EKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  565



>ref|XP_010264000.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nelumbo nucifera]
Length=575

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/166 (96%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKE P
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKEAP  564



>gb|KDO43056.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
 gb|KDO43057.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
Length=382

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  203  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELE  262

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  263  KLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  322

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPK+EKE P
Sbjct  323  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  368



>ref|XP_009616503.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Nicotiana tomentosiformis]
Length=575

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 159/166 (96%), Positives = 165/166 (99%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KEL+
Sbjct  399  RLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD+ADLGYDAAKGEYV
Sbjct  459  KLETANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDADLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMV+AGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP
Sbjct  519  DMVRAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  564



>gb|KDO43055.1| hypothetical protein CISIN_1g013743mg [Citrus sinensis]
Length=437

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  258  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELE  317

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  318  KLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  377

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPK+EKE P
Sbjct  378  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  423



>sp|Q05045.1|CH61_CUCMA RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Cucurbita maxima]
 pir||S29315 chaperonin 60 - cucurbit
 emb|CAA50217.1| chaperonin 60 [Cucurbita cv. Kurokawa Amakuri]
Length=575

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/167 (95%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD+ DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE VVVELPKDE E PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEVVVVELPKDENEVPA  565



>gb|AAP54159.2| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=634

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 165/167 (99%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  459  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  518

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  519  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  578

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+EKE PA
Sbjct  579  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  625



>ref|XP_004247810.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=579

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA++EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAARELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLL+QDN DLGYDAAKGEYV
Sbjct  459  NLTTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLDQDNLDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE+PA
Sbjct  519  DMIKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESPA  565



>emb|CDO99385.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/167 (96%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVSSLLTTTEAVVVELPKDEK  PA
Sbjct  519  DMVKAGIIDPLKVLRTALVDAASVSSLLTTTEAVVVELPKDEKAAPA  565



>ref|XP_006340914.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=575

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA++EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAARELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLL+QDN DLGYDAAKGEYV
Sbjct  459  NLTTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLDQDNLDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE+PA
Sbjct  519  DMIKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESPA  565



>ref|XP_010243653.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nelumbo nucifera]
Length=574

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/167 (95%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVE PKDEKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVEFPKDEKEVPA  565



>ref|XP_002285608.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Vitis vinifera]
 emb|CBI33329.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/167 (95%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPT+NFDQKIGVQIIQNALKTPV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTSNFDQKIGVQIIQNALKTPVFTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKEVPA  565



>ref|XP_008349053.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Malus domestica]
Length=426

 Score =   306 bits (785),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+SGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKELE
Sbjct  250  RLAKISGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELE  309

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  310  KLXTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  369

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETPA
Sbjct  370  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPA  416



>emb|CDX93002.1| BnaA03g37240D [Brassica napus]
Length=550

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  371  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  430

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  431  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  490

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKDE E+
Sbjct  491  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  535



>ref|XP_010527490.1| PREDICTED: chaperonin CPN60, mitochondrial [Tarenaya hassleriana]
Length=574

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/165 (96%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYASKELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDENES  562



>ref|XP_009135882.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=577

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>emb|CDX94835.1| BnaC03g43530D [Brassica napus]
Length=577

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/165 (95%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>gb|EYU46365.1| hypothetical protein MIMGU_mgv1a026299mg, partial [Erythranthe 
guttata]
Length=548

 Score =   310 bits (794),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/166 (95%), Positives = 162/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  379  RLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  438

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQK+GVQIIQNALK PVHTIASNAGVEG+VVVGKLLEQDN DLGYDAAKGEYV
Sbjct  439  KLQTANFDQKVGVQIIQNALKAPVHTIASNAGVEGSVVVGKLLEQDNPDLGYDAAKGEYV  498

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDEKE+P
Sbjct  499  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEKESP  544



>gb|AFW68650.1| chaperonin 1 [Zea mays]
Length=203

 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  27   RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  86

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  87   KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  146

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  147  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  188



>ref|XP_006662418.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=574

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE++VVE+PK+EKE PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIVVEIPKEEKEAPA  565



>ref|XP_003591643.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|ABE86688.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61894.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=574

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL 
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELS  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPK++K+TPA
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKEDKDTPA  565



>emb|CDX79518.1| BnaC03g18540D [Brassica napus]
Length=202

 Score =   297 bits (761),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  17   RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  76

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLE DN DLGYDAAKGEYV
Sbjct  77   KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAAKGEYV  136

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASVSSLLTTTEAVV E+P  E  +PA
Sbjct  137  DMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  183



>ref|XP_002303091.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE82364.1| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=575

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  400  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  460  KLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPK EKETPA
Sbjct  520  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKVEKETPA  566



>ref|XP_008810807.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Phoenix dactylifera]
Length=576

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS ELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVV+GKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVIGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVD+ASVSSL+TTTEAVVVELPK+EK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDSASVSSLMTTTEAVVVELPKEEKDVPA  565



>ref|XP_010556941.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=576

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 165/168 (98%), Gaps = 1/168 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV++GKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIIGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE-TPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+PK+EKE +PA
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPKEEKEASPA  566



>ref|XP_011024539.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Populus euphratica]
Length=575

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  400  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  460  KLHTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPK EKETPA
Sbjct  520  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVSELPKVEKETPA  566



>ref|XP_006492150.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Citrus sinensis]
Length=578

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/166 (94%), Positives = 163/166 (98%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPK+EKE P
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAP  564



>ref|XP_007225634.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
 gb|EMJ26833.1| hypothetical protein PRUPE_ppa003391mg [Prunus persica]
Length=578

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAgmgggmggmggMD  295
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELP D KETPA  GG  GGMGGMD
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPSD-KETPAMGGGMGGGMGGMD  577

Query  294  Y  292
            Y
Sbjct  578  Y  578



>ref|XP_008224072.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Prunus mume]
Length=578

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/181 (94%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAgmgggmggmggMD  295
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELP D KETPA  GG  GGMGGMD
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPSD-KETPAMGGGMGGGMGGMD  577

Query  294  Y  292
            Y
Sbjct  578  Y  578



>ref|XP_007034504.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOY05430.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGI+DP+KVIRTALVDAASVSSL+TTTEA+VVELPKDEK+  A
Sbjct  519  DMVKAGIVDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKDVSA  565



>ref|XP_010513304.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Camelina sativa]
Length=577

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKD+ E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDDSES  562



>ref|XP_010466805.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
 ref|XP_010488513.1| PREDICTED: chaperonin CPN60, mitochondrial [Camelina sativa]
Length=577

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKD+ E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDDSES  562



>ref|XP_002518171.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF44304.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=574

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/167 (95%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYATKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNYDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKDE   PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDESAAPA  565



>gb|AGT98547.1| heat shock protein 60, partial [Paeonia lactiflora]
Length=214

 Score =   296 bits (757),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 162/167 (97%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAV EGIVPGGGVALLYAS+EL+
Sbjct  37   RLAKLSGGVAVLKIGGASEAEVNEKKDRVTDALNATKAAVVEGIVPGGGVALLYASRELD  96

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN +LGYDAAKGEYV
Sbjct  97   KLQTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPELGYDAAKGEYV  156

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE-TP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVELPKD+KE TP
Sbjct  157  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDDKEATP  203



>ref|XP_002885624.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61883.1| hypothetical protein ARALYDRAFT_898985 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE E+
Sbjct  518  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDESES  562



>gb|EMS57340.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=587

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  410  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLD  469

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  470  KLPTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  529

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA++VE+PK++K  PA
Sbjct  530  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEDKAAPA  576



>ref|NP_189041.1| heat shock protein 60 [Arabidopsis thaliana]
 sp|P29197.2|CH60A_ARATH RecName: Full=Chaperonin CPN60, mitochondrial; AltName: Full=HSP60; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03017.1| chaperonin hsp60, mitochondrial precursor (HSP60) [Arabidopsis 
thaliana]
 gb|AAM20445.1| mitochondrial chaperonin hsp60 [Arabidopsis thaliana]
 gb|AAQ56841.1| At3g23990 [Arabidopsis thaliana]
 gb|AEE76842.1| heat shock protein 60 [Arabidopsis thaliana]
Length=577

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>emb|CAA77646.1| chaperonin hsp60 [Arabidopsis thaliana]
Length=577

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/165 (94%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVV+LPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES  562



>ref|XP_010918836.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Elaeis guineensis]
Length=575

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGE+KDRVTDALNATKAAVEEGIV GGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGERKDRVTDALNATKAAVEEGIVTGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVV+GKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVVIGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPK+EK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKEEKDVPA  565



>ref|XP_011091383.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Sesamum indicum]
Length=575

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLE DN DLGYDAAKGEYV
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVE PKDEK  P
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVEQPKDEKPAP  564



>ref|XP_010023772.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Eucalyptus grandis]
 gb|KCW60142.1| hypothetical protein EUGRSUZ_H02866 [Eucalyptus grandis]
Length=575

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKG+YV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGDYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKD+KE
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDDKE  562



>ref|XP_010933209.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Elaeis guineensis]
Length=575

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEGI+PGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVNDALNATKAAVEEGILPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAV+VGKLLEQDN DLGYDAAK EYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVIVGKLLEQDNPDLGYDAAKDEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  565



>emb|CDY59050.1| BnaC07g48200D [Brassica napus]
Length=338

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL KLSGGVAVLKIGGASEAEV EKKDRVTDALNATKA VEEGI+PGGGVALLYA++ELE
Sbjct  163  RLTKLSGGVAVLKIGGASEAEVCEKKDRVTDALNATKATVEEGILPGGGVALLYAARELE  222

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKL+EQDN DLGYDAAKGEYV
Sbjct  223  KLATANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLMEQDNTDLGYDAAKGEYV  282

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE E
Sbjct  283  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDESE  326



>gb|ABK92479.1| unknown [Populus trichocarpa]
Length=422

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  247  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  306

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  307  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  366

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV +LPKD K+ PA
Sbjct  367  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  413



>ref|XP_008812917.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Phoenix dactylifera]
Length=621

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEG +PGGGVALLYASKELE
Sbjct  445  RLAKLSGGVAVLKIGGASEAEVGEKKDRVNDALNATKAAVEEGTLPGGGVALLYASKELE  504

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  505  KLQTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  564

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEK+ PA
Sbjct  565  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKDVPA  611



>ref|XP_009599981.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=573

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKVGGASELEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             LPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD+ DLGYDAAKGEYV
Sbjct  459  NLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE  +PA
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDETPSPA  565



>ref|XP_004239874.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLA+LSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYASKEL+
Sbjct  399  RLARLSGGVAVLKVGGASEVEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             LPTANFDQKIGVQIIQNALKTPV+TIASNAGVEG+VVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  SLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGSVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAV+VELPKDEK  PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKAAPA  565



>ref|XP_006355738.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Solanum tuberosum]
Length=573

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLA+LSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYASKEL+
Sbjct  399  RLARLSGGVAVLKVGGASEIEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             LPTANFDQKIGVQIIQNALKTPV+TIASNAGVEG+VVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  SLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGSVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAV+VELPKDEK +PA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVIVELPKDEKASPA  565



>ref|XP_006410460.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
 gb|ESQ51913.1| hypothetical protein EUTSA_v10016425mg [Eutrema salsugineum]
Length=583

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASVSSLLTTTEAVV E+P  E+ +PA
Sbjct  519  DMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASPA  565



>ref|XP_009362047.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=578

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL T NFDQK+GVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV
Sbjct  459  KLRTVNFDQKVGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAgmgggmggmggMD  295
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELP  EKETPA  G   GGMGGMD
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SEKETPAMGGSMGGGMGGMD  577

Query  294  Y  292
            Y
Sbjct  578  Y  578



>ref|XP_006297236.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
 gb|EOA30134.1| hypothetical protein CARUB_v10013241mg, partial [Capsella rubella]
Length=617

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/165 (93%), Positives = 163/165 (99%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGVALLYA++ELE
Sbjct  438  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELE  497

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQ+N DLGYDAAKGEYV
Sbjct  498  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQENTDLGYDAAKGEYV  557

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKD+ E+
Sbjct  558  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDDSES  602



>ref|XP_009371099.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Pyrus x bretschneideri]
Length=575

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKD+KETPA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDDKETPA  565



>gb|ACN31425.1| unknown [Zea mays]
Length=352

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  176  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  235

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  236  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  295

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  296  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  337



>gb|EMT21164.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=626

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 164/167 (98%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  449  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLD  508

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAV+VGKLLEQ+N DLGYDAAKGEYV
Sbjct  509  KLPTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVIVGKLLEQENTDLGYDAAKGEYV  568

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA++VE+PK++K  PA
Sbjct  569  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEDKAAPA  615



>ref|XP_009758421.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Nicotiana 
sylvestris]
Length=573

 Score =   304 bits (779),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLK+GGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKVGGASELEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             LPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD+ DLGYDAAKGEYV
Sbjct  459  NLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE  +P
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDETPSP  564



>ref|XP_007201704.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
 gb|EMJ02903.1| hypothetical protein PRUPE_ppa004110mg [Prunus persica]
Length=529

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+SGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  353  RLAKISGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  412

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  413  KLATANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  472

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETP
Sbjct  473  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETP  518



>ref|XP_006410461.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
 gb|ESQ51914.1| hypothetical protein EUTSA_v10016427mg [Eutrema salsugineum]
Length=582

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGG+SEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGSSEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E+ +PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPAKEEASPA  565



>ref|XP_012077667.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Jatropha curcas]
 gb|KDP33373.1| hypothetical protein JCGZ_12922 [Jatropha curcas]
Length=574

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIV GGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVAGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNNDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKDEK+  A
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDEKDAAA  565



>ref|XP_012085173.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Jatropha curcas]
 gb|KDP26429.1| hypothetical protein JCGZ_17587 [Jatropha curcas]
Length=574

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKMPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVI+TAL+DAASVSSL+TTTEAVV ELPKDE E PA
Sbjct  519  DMVKAGIIDPLKVIKTALMDAASVSSLMTTTEAVVSELPKDESEAPA  565



>gb|AAN63805.1| heat shock protein 60 [Prunus dulcis]
Length=545

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+SGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  369  RLAKISGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  428

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  429  KLATANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  488

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETP
Sbjct  489  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETP  534



>ref|XP_006841664.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Amborella trichopoda]
 gb|ERN03339.1| hypothetical protein AMTR_s00003p00241820 [Amborella trichopoda]
Length=575

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/167 (94%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLHTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE-TP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA VVELPKDEKE TP
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEATVVELPKDEKEMTP  564



>ref|XP_003536270.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN30688.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=577

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASSELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ++ DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPKD+K+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSELPKDDKDVPA  565



>ref|XP_004496080.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL 
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELS  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPK++  +PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKEDNSSPA  565



>ref|XP_010522438.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Tarenaya hassleriana]
Length=580

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             LPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV++GKLLEQDN DLGYDAAKGEYV
Sbjct  459  TLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIIGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+PK+EKE
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVSEIPKEEKE  562



>gb|KJB42389.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=521

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKELE
Sbjct  345  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELE  404

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  405  NLETANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  464

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPKD+KE
Sbjct  465  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDDKE  508



>ref|XP_002299295.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
 gb|EEE84100.2| Chaperonin CPN60-2 family protein [Populus trichocarpa]
Length=574

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV +LPKD K+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  565



>ref|XP_008346198.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=575

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIV GGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVAGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETPA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPA  565



>ref|XP_008372428.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-2, mitochondrial-like 
[Malus domestica]
Length=576

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIV GGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVAGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLVTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETPA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPA  565



>ref|XP_009377449.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Pyrus x bretschneideri]
Length=578

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL T NFDQK+GVQIIQNALK PVHTIASNAGVEGAVVVGKLLE DNADLGYDAAKGEYV
Sbjct  459  KLRTVNFDQKVGVQIIQNALKAPVHTIASNAGVEGAVVVGKLLEHDNADLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAgmgggmggmggMD  295
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELP  EKETPA  GG  GGMGGMD
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELP-SEKETPAMGGGMGGGMGGMD  577

Query  294  Y  292
            Y
Sbjct  578  Y  578



>gb|KFK31072.1| hypothetical protein AALP_AA6G064600 [Arabis alpina]
Length=583

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/167 (93%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVIVGKLLEQDNYDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E E PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPSKEPEAPA  565



>ref|XP_003556325.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
Length=575

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASSELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ++ DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKD+K+ PA
Sbjct  519  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPA  565



>gb|KJB42386.1| hypothetical protein B456_007G151700 [Gossypium raimondii]
Length=575

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNALK PVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  NLETANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPKD+KE
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDDKE  562



>ref|XP_010550847.1| PREDICTED: chaperonin CPN60, mitochondrial-like [Tarenaya hassleriana]
Length=574

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGI+PGGGVALLYASKEL+
Sbjct  398  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGILPGGGVALLYASKELD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGK+LEQDN D GYDAAK EYV
Sbjct  458  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKILEQDNPDFGYDAAKDEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE E+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDENES  562



>gb|KHN00995.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASSELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ++ DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQNDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKD+K+ PA
Sbjct  519  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPA  565



>ref|XP_004299212.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=577

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/167 (93%), Positives = 162/167 (97%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAV+VGKLLEQD+ DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAAS+SSLLTTTEAVVVELP D KETPA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASISSLLTTTEAVVVELPSD-KETPA  564



>ref|XP_009420744.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/165 (93%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEIEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK+P HTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKSPAHTIASNAGVEGAVVVGKLLEQENPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            D+VK+GIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKET
Sbjct  519  DLVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKET  563



>ref|XP_011002149.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Populus euphratica]
Length=574

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAA+GEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAEGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV +LPKD K+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVTDLPKDVKDAPA  565



>ref|XP_004982955.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Setaria italica]
Length=576

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E   PA
Sbjct  521  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>gb|AFK46346.1| unknown [Medicago truncatula]
Length=353

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGV VLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL 
Sbjct  176  RLAKLSGGVVVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELS  235

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  236  KLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  295

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V +LP ++K+
Sbjct  296  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSDLPSEDKD  339



>dbj|BAK05600.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASK L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKALD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLETANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTEA++VE+PK+EKE P
Sbjct  519  DMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEIPKEEKEAP  564



>ref|XP_009405691.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD  DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDELDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+V+VELPK+E
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESVIVELPKNE  560



>ref|XP_002467123.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
 gb|EER94121.1| hypothetical protein SORBIDRAFT_01g020010 [Sorghum bicolor]
Length=577

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  521  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  562



>ref|XP_004496079.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cicer arietinum]
Length=575

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL 
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELS  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVQTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPK++  +PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVYELPKEDNSSPA  565



>ref|XP_003574012.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=574

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGG+AVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASK L+
Sbjct  399  RLAKLSGGIAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKALD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+EKE PA
Sbjct  519  DMVKVGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEKEAPA  565



>ref|XP_003558831.1| PREDICTED: chaperonin CPN60-1, mitochondrial [Brachypodium distachyon]
Length=575

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGG+AVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS++L+
Sbjct  399  RLAKLSGGIAVLKIGGASEPEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRDLD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVIVGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEA++VE P +EK  PA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAIIVETPTEEKSAPA  565



>ref|XP_002521151.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF41302.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=575

 Score =   300 bits (768),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLHTANFDQKIGVQIIQNALKMPVHTIAANAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEA+V ELPKDEKE
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPKDEKE  562



>ref|XP_007145430.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
 gb|ESW17424.1| hypothetical protein PHAVU_007G238500g [Phaseolus vulgaris]
Length=575

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV TIASNAGVEGAVVVGKLLEQD+ DLGYDAA GEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQDDLDLGYDAANGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKD+K+ PA
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDIPA  565



>ref|XP_006651029.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Oryza brachyantha]
Length=577

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEG+V+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGSVIVGKLLEQDNIDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E   PA
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEVAAPA  565



>ref|XP_003535967.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform 1 [Glycine 
max]
 gb|KHN10297.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   300 bits (767),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIV GGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVSGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV TIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQENHDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV ELP D+K+TP
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPNDDKDTP  564



>ref|XP_010109672.1| Chaperonin CPN60-2 [Morus notabilis]
 gb|EXC24142.1| Chaperonin CPN60-2 [Morus notabilis]
Length=574

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV+TIASNAGVEG+VVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLETANFDQKIGVQIIQNALKMPVYTIASNAGVEGSVVVGKLLEQDNHDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            D++K+GIIDP+KVIRTALVDAASVSSLLTTTEAVVVELPKDE+
Sbjct  519  DLIKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVVELPKDEE  561



>ref|XP_007144180.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
 gb|ESW16174.1| hypothetical protein PHAVU_007G135100g [Phaseolus vulgaris]
Length=575

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANF QKIGVQIIQNALK  VHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLHTANFGQKIGVQIIQNALKASVHTIASNAGVEGAVVVGKLLEQNNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV ELPKD+K+ PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPKDDKDVPA  565



>emb|CAA77645.1| chaperonin hsp60 [Zea mays]
Length=577

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  521  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  562



>ref|XP_008644293.1| PREDICTED: chaperonin CPN60-1, mitochondrial isoform X1 [Zea 
mays]
Length=579

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  403  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  462

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  463  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  522

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  523  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  564



>ref|NP_001105690.1| chaperonin CPN60-2, mitochondrial precursor [Zea mays]
 sp|Q43298.1|CH62_MAIZE RecName: Full=Chaperonin CPN60-2, mitochondrial; AltName: Full=HSP60-2; 
Flags: Precursor [Zea mays]
 gb|AAA33451.1| chaperonin 60 [Zea mays]
 gb|AAA33452.1| mitochondrial chaperonin 60 [Zea mays]
 tpg|DAA49764.1| TPA: putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=576

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ N DLGYDAAK EYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAAKDEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E   PA
Sbjct  521  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>sp|P29185.2|CH61_MAIZE RecName: Full=Chaperonin CPN60-1, mitochondrial; AltName: Full=HSP60-1; 
Flags: Precursor [Zea mays]
Length=577

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  521  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  562



>emb|CAA78101.1| mitochondrial chaperonin-60 [Zea mays]
Length=576

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ N DLGYDAAK EYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAAKDEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E   PA
Sbjct  521  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAPA  567



>ref|NP_001105716.1| chaperonin CPN60-1, mitochondrial precursor [Zea mays]
 emb|CAA78100.1| mitochondrial chaperonin-60 [Zea mays]
Length=577

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  521  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  562



>emb|CDX84697.1| BnaA03g15330D [Brassica napus]
Length=563

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  381  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  440

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLE DN DLGYDAAKGEYV
Sbjct  441  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAAKGEYV  500

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASVSSLLTTTEAVV E+P  E  +PA
Sbjct  501  DMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  547



>ref|XP_010413901.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=583

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E+ +P
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>ref|XP_010469503.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E+ +P
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>gb|EMT05673.1| Chaperonin CPN60-2, mitochondrial [Aegilops tauschii]
Length=574

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASK L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKALD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIA NAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVYTIACNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTEA++VE+PK+EKE PA
Sbjct  519  DMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEVPKEEKEAPA  565



>ref|XP_003555721.1| PREDICTED: chaperonin CPN60-2, mitochondrial isoform 1 [Glycine 
max]
 gb|KHN31621.1| Chaperonin CPN60-2, mitochondrial [Glycine soja]
Length=575

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+EL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANF QKIGVQIIQNALKTPV TIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLQTANFGQKIGVQIIQNALKTPVLTIASNAGVEGAVVVGKLLEQENHDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEAVV ELP D K+TP
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVSELPNDNKDTP  564



>ref|XP_010509916.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Camelina sativa]
Length=585

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E+ +P
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEEASP  564



>ref|XP_003591642.1| Chaperonin CPN60-2 [Medicago truncatula]
 gb|ABE86687.1| GroEL-like chaperone, ATPase [Medicago truncatula]
 gb|AES61893.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS EL 
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASNELS  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V +LP ++K+
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVSDLPSEDKD  562



>gb|AAC04902.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
Length=524

 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  338  RLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  397

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  398  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  457

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E  +P
Sbjct  458  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  503



>ref|XP_007049890.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
 gb|EOX94047.1| Heat shock protein 60 isoform 1 [Theobroma cacao]
Length=575

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNAL  PVH IASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  NLHTANFDQKIGVQIIQNALMMPVHAIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+V ELP DEK
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVTELPNDEK  561



>ref|XP_009132917.1| PREDICTED: chaperonin CPN60, mitochondrial [Brassica rapa]
Length=584

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKL+GGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLAGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLE DN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASVSSLLTTTEAVV E+P  E  +PA
Sbjct  519  DMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  565



>gb|AAA33450.1| chaperonin 60 [Zea mays]
Length=577

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL KLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  401  RLPKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  460

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  461  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  520

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK+E
Sbjct  521  DMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEE  562



>ref|NP_001189665.1| heat shock protein 60-2 [Arabidopsis thaliana]
 gb|AEC08800.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=580

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  394  RLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  453

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  454  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  513

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E  +P
Sbjct  514  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  559



>sp|P35480.1|CH60_BRANA RecName: Full=Chaperonin CPN60, mitochondrial; Flags: Precursor 
[Brassica napus]
 emb|CAA81689.1| mitochondrial chaperonin [Brassica napus]
Length=587

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  402  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  461

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFD KIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLE DN DLGYDAAKGEYV
Sbjct  462  KLSTANFDHKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAAKGEYV  521

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASVSSLLTTTEAVV E+P  E  +PA
Sbjct  522  DMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASPA  568



>ref|NP_850203.1| heat shock protein 60-2 [Arabidopsis thaliana]
 sp|Q8L7B5.1|CH60B_ARATH RecName: Full=Chaperonin CPN60-like 1, mitochondrial; AltName: 
Full=HSP60-like 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM97026.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 gb|AAN15422.1| mitochondrial chaperonin HSP60 [Arabidopsis thaliana]
 dbj|BAD43178.1| mitochondrial chaperonin (HSP60) [Arabidopsis thaliana]
 gb|AEC08799.1| heat shock protein 60-2 [Arabidopsis thaliana]
Length=585

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DM+KAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E  +P
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP  564



>ref|XP_008358471.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Malus domestica]
Length=576

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -3

Query  834  RLAKLSGGV-AVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL  658
            RLAK+   V AVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL
Sbjct  399  RLAKIFWVVFAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKEL  458

Query  657  EKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEY  478
            EKL TANFDQKIGVQIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEY
Sbjct  459  EKLXTANFDQKIGVQIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEY  518

Query  477  VDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            VDM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVELPKDEKETPA
Sbjct  519  VDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVELPKDEKETPA  566



>ref|NP_001048938.1| Os03g0143400 [Oryza sativa Japonica Group]
 gb|ABF93929.1| Chaperonin CPN60-1, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10852.1| Os03g0143400 [Oryza sativa Japonica Group]
 dbj|BAG93753.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74496.1| hypothetical protein OsI_09970 [Oryza sativa Indica Group]
 gb|EEE58306.1| hypothetical protein OsJ_09368 [Oryza sativa Japonica Group]
 gb|ADB84620.1| chaperonin [Oryza sativa Japonica Group]
Length=577

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKDLD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIASNAGVEG+V++GKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGSVIIGKLLEQDNTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPK  355
            DMVK+GIIDP+KVIRTALVDAASVSSL+TTTE+++VE+PK
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPK  558



>ref|XP_004290029.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=576

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 158/167 (95%), Gaps = 2/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASETEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKMPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVV LP  EKE PA
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVSLP--EKEAPA  563



>gb|ERN04382.1| hypothetical protein AMTR_s00147p00091670 [Amborella trichopoda]
Length=560

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  383  RLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYATKELE  442

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTP  TIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  443  KLQTANFDQKIGVQIIQNALKTPALTIAANAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  502

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+T TEAVV E PK+E  +PA
Sbjct  503  DMVKAGIIDPLKVIRTALVDAASVSSLMTMTEAVVAEFPKNESASPA  549



>ref|XP_011622760.1| PREDICTED: chaperonin CPN60, mitochondrial [Amborella trichopoda]
Length=575

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KELE
Sbjct  398  RLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYATKELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTP  TIA+NAGVEGAVVVGKLLEQDN DLGYDAAKGEYV
Sbjct  458  KLQTANFDQKIGVQIIQNALKTPALTIAANAGVEGAVVVGKLLEQDNPDLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+T TEAVV E PK+E  +PA
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSSLMTMTEAVVAEFPKNESASPA  564



>gb|EMS53265.1| Chaperonin CPN60-2, mitochondrial [Triticum urartu]
Length=640

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASK L+
Sbjct  465  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKALD  524

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIA NAGVEGAVVVGKLLEQ+N DLGYDAAKGEYV
Sbjct  525  KLQTANFDQKIGVQIIQNALKTPVYTIACNAGVEGAVVVGKLLEQENTDLGYDAAKGEYV  584

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK GIIDP+KVIRTALVDAASVSSL+TTTEA++VE+PK+EKE PA
Sbjct  585  DMVKVGIIDPLKVIRTALVDAASVSSLMTTTEAIIVEVPKEEKEAPA  631



>emb|CDY17152.1| BnaA05g10360D [Brassica napus]
Length=574

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  387  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  446

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLE D+ DLGYDAAKGEYV
Sbjct  447  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAAKGEYV  506

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASV+SLLTTTEAVV ++P  E  +PA
Sbjct  507  DMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  553



>emb|CDY19471.1| BnaC04g11280D [Brassica napus]
Length=593

 Score =   295 bits (755),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  406  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  465

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLE D+ DLGYDAAKGEYV
Sbjct  466  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAAKGEYV  525

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASV+SLLTTTEAVV ++P  E  +PA
Sbjct  526  DMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  572



>ref|XP_009143882.1| PREDICTED: chaperonin CPN60-like 1, mitochondrial [Brassica rapa]
Length=586

 Score =   295 bits (754),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLE D+ DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLESDDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVK+GIIDPVKVIRTALVDAASV+SLLTTTEAVV ++P  E  +PA
Sbjct  519  DMVKSGIIDPVKVIRTALVDAASVASLLTTTEAVVTDIPTKEDASPA  565



>ref|XP_004139642.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Cucumis sativus]
 gb|KGN44557.1| hypothetical protein Csa_7G332900 [Cucumis sativus]
Length=572

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 161/168 (96%), Gaps = 1/168 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDA+NAT+AAVEEGIV GGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDAVNATRAAVEEGIVAGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK P++TIASNAGVEGA+V+GKLL+QDN +LGYDAAKGEYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKMPIYTIASNAGVEGAIVIGKLLQQDNHELGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE-TPA  334
            DM+KAGIIDP+KVIRTALVDAASVSSL+TTTEAVVVE P DEKE TP+
Sbjct  519  DMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAVVVEQPNDEKEATPS  566



>ref|XP_002881268.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57527.1| hypothetical protein ARALYDRAFT_902390 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  E  +P
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVVSP  564



>gb|KFK31073.1| hypothetical protein AALP_AA6G064700 [Arabis alpina]
Length=580

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV E KDRVTDALNAT+AAVEEGIVPGGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASETEVSETKDRVTDALNATRAAVEEGIVPGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  KLSTANFDQKIGVQIIQNALKMPVHTIASNAGVEGAVIVGKLLEQDNYDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDP+KVIRTALVDAASVSSLLTTTEA+V E+P  E E
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAIVTEIPSKETE  562



>ref|XP_006293894.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
 gb|EOA26792.1| hypothetical protein CARUB_v10022887mg [Capsella rubella]
Length=583

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL 
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELG  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAV+VGKLLEQDN DLGYDAAKGEYV
Sbjct  459  NLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVK+GIIDP+KVIRTALVDAASVSSLLTTTEAVV E+P  EK+
Sbjct  519  DMVKSGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEKD  562



>ref|XP_004985740.1| PREDICTED: chaperonin CPN60-1, mitochondrial-like [Setaria italica]
Length=570

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRV DALNATKAAVEEGIVPGGGVALLYASK+L+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVIDALNATKAAVEEGIVPGGGVALLYASKDLD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL +AN DQKIGVQIIQNALKTPV TIASNAGVEGAV+VGKLLEQ+N DLGYDAAKGEYV
Sbjct  459  KLQSANLDQKIGVQIIQNALKTPVQTIASNAGVEGAVIVGKLLEQENTDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTAL+DAASVSSL+TTTE+++VE PK+E   PA
Sbjct  519  DMVKAGIIDPLKVIRTALMDAASVSSLMTTTESIIVESPKEESSAPA  565



>emb|CDP03832.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EK DRVTDALNATKAAVEEGIV GGGVALLYASKELE
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKMDRVTDALNATKAAVEEGIVQGGGVALLYASKELE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T+NFDQKIGVQIIQNALK PV TIASNAG EGAVVVGKL+EQDN DLGYDAA GEYV
Sbjct  459  NLQTSNFDQKIGVQIIQNALKAPVQTIASNAGAEGAVVVGKLMEQDNPDLGYDAANGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DM+KAGI+DP+KVIRTALVDAASVSSLLTTTEAVVVE PKDEKE+
Sbjct  519  DMIKAGIMDPLKVIRTALVDAASVSSLLTTTEAVVVEHPKDEKES  563



>ref|XP_011020718.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020719.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X1 
[Populus euphratica]
 ref|XP_011020720.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like isoform X2 
[Populus euphratica]
Length=574

 Score =   287 bits (735),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKTPVHTIA+NAGVEGAVVVGKLLEQDN DLGYDAAK EYV
Sbjct  459  KLQTANFDQKIGVQIIQNALKTPVHTIATNAGVEGAVVVGKLLEQDNPDLGYDAAKDEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTE VV ELPKDE + PA
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTETVVTELPKDENDAPA  565



>ref|XP_010666478.1| PREDICTED: chaperonin CPN60-2, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAV EGIVPGGGVALLYASKEL+
Sbjct  396  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVAEGIVPGGGVALLYASKELD  455

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TAN+DQKIGV+IIQ ALKT VHTIASNAGVEGA+VVGKLLEQ++ DLGYDAAKGEYV
Sbjct  456  KLQTANYDQKIGVRIIQAALKTSVHTIASNAGVEGALVVGKLLEQEDHDLGYDAAKGEYV  515

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET-PA  334
            DMVK+GIIDP+KVIRTAL DAASVSSL+ TTEAVVVE PKDEK++ PA
Sbjct  516  DMVKSGIIDPLKVIRTALSDAASVSSLMITTEAVVVEAPKDEKDSAPA  563



>gb|EYU43803.1| hypothetical protein MIMGU_mgv1a003536mg [Erythranthe guttata]
Length=579

 Score =   283 bits (724),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYA+KEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PV+TIA+NAGVEGAVVVGKLLE  + DLGYDAAKGEYV
Sbjct  459  KLATANFDQKIGVQIIQNALKMPVYTIAANAGVEGAVVVGKLLESVDPDLGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDP+KVIRTALVDAASVSSL+TTTEA+VVE P  +K
Sbjct  519  DMVKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVEQPSSDK  561



>ref|XP_008235753.1| PREDICTED: chaperonin CPN60-2, mitochondrial-like [Prunus mume]
Length=555

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = -3

Query  795  IGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELEKLPTANFDQKIGV  616
            IGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGG ALLYASKEL+KL TANFDQKIGV
Sbjct  392  IGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGAALLYASKELDKLATANFDQKIGV  451

Query  615  QIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYVDMVKAGIIDPVKV  436
            QIIQNALK PV TIASNAGVEGAVVVGKLLEQDN DLGYDAAKGEYVDM+KAGIIDP+KV
Sbjct  452  QIIQNALKMPVSTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYVDMIKAGIIDPLKV  511

Query  435  IRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            IRTALVDAASVSSL+TTTEAVVVELPKDEKETP
Sbjct  512  IRTALVDAASVSSLMTTTEAVVVELPKDEKETP  544



>ref|XP_001772410.1| predicted protein [Physcomitrella patens]
 gb|EDQ62881.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+ELE
Sbjct  398  RLAKLSGGVAVLKIGGASEVEVNEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TANFDQKIGVQIIQNAL+ P +TIA NAGVEGAVVVGKL+EQ N  +GYDAAK EYV
Sbjct  458  KVQTANFDQKIGVQIIQNALRMPAYTIARNAGVEGAVVVGKLMEQTNMSIGYDAAKAEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDPVKVIRTALVDAASV+SL+TTTEAV+ + PKD+KE
Sbjct  518  DMVKAGIIDPVKVIRTALVDAASVASLMTTTEAVIADFPKDDKE  561



>ref|XP_002966324.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
 gb|EFJ32351.1| hypothetical protein SELMODRAFT_85251, partial [Selaginella moellendorffii]
Length=557

 Score =   276 bits (706),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGG SEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAS++L+
Sbjct  381  RLAKLSGGVAVLKIGGGSEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRDLD  440

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL T NFDQK+GVQIIQ+ALK P +TIA+NAGVEGAVVVGKL EQ++ +LGYDAAKGEYV
Sbjct  441  KLETPNFDQKVGVQIIQSALKMPTYTIAANAGVEGAVVVGKLWEQNDYNLGYDAAKGEYV  500

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDPVKV+RTAL DAASVSSLLTTTEAVV +LPK+EK
Sbjct  501  DMVKAGIIDPVKVLRTALGDAASVSSLLTTTEAVVYDLPKEEK  543



>gb|KFK24236.1| hypothetical protein AALP_AAs53933U000100, partial [Arabis alpina]
Length=182

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 146/165 (88%), Gaps = 10/165 (6%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDR TDALNATK  VEEGI+PGGGVAL        
Sbjct  13   RLAKLSGGVAVLKIGGASEAEVGEKKDRETDALNATKVVVEEGILPGGGVAL--------  64

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
              PTANFD+KIGVQIIQNA KTPV+TIASNAGVEGAV+VGKLLEQDN DL YDAAK E+V
Sbjct  65   --PTANFDKKIGVQIIQNAFKTPVYTIASNAGVEGAVIVGKLLEQDNPDLSYDAAKCEFV  122

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDP+KVIRTALV AASVSSLLTTTEAVVVELPKDE E+
Sbjct  123  DMVKAGIIDPLKVIRTALVGAASVSSLLTTTEAVVVELPKDESES  167



>ref|XP_001783814.1| predicted protein [Physcomitrella patens]
 gb|EDQ51354.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+EL+
Sbjct  398  RLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+NFDQK+GVQIIQNALK P +TIA NAGVEGAVVVGKLLE+ N ++GYDAAK EYV
Sbjct  458  NVQTSNFDQKVGVQIIQNALKMPAYTIARNAGVEGAVVVGKLLEEANLNIGYDAAKAEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVIRTALVDAASV+SLLTTTEA+V + PKD++  P
Sbjct  518  DMVKAGIIDPVKVIRTALVDAASVASLLTTTEAIVADFPKDDEAMP  563



>ref|XP_002978237.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
 gb|EFJ20894.1| hypothetical protein SELMODRAFT_108429, partial [Selaginella 
moellendorffii]
Length=557

 Score =   274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGG SEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYAS++L+
Sbjct  381  RLAKLSGGVAVLKIGGGSEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRDLD  440

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL T NFDQK+GVQIIQ+ALK P +TIA+NAGVEGAVVVGKL EQ++ +LGYDAAKGEYV
Sbjct  441  KLETPNFDQKVGVQIIQSALKMPTYTIAANAGVEGAVVVGKLWEQNDYNLGYDAAKGEYV  500

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDPVKV+RTAL DAASVSSLLTTTEAVV +LPK+EK
Sbjct  501  DMVKAGIIDPVKVLRTALGDAASVSSLLTTTEAVVYDLPKEEK  543



>ref|XP_001760735.1| predicted protein [Physcomitrella patens]
 gb|EDQ74474.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGG SE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL 
Sbjct  397  RLAKLSGGVAVLKIGGTSEVEVNEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELY  456

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+PT NFDQ+IGVQIIQNALK P +TIA NAG+EGAVVVGKLL+Q N ++GYDAAKGEYV
Sbjct  457  KIPTNNFDQRIGVQIIQNALKMPAYTIAHNAGLEGAVVVGKLLDQSNLNIGYDAAKGEYV  516

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVKAGIIDPVKVIRTA VDAASV+SL+TTTEAVV E  K+EK+
Sbjct  517  DMVKAGIIDPVKVIRTAFVDAASVASLMTTTEAVVAESNKEEKD  560



>ref|XP_001762115.1| predicted protein [Physcomitrella patens]
 gb|EDQ73219.1| predicted protein [Physcomitrella patens]
Length=575

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGVALLYAS+EL+
Sbjct  395  RLAKLSGGVAVLKIGGASEVEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASRELD  454

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TANFDQK+GVQIIQNALK P +TIA NAGVEGAVVVGKLLEQ N  +GYDAAK EYV
Sbjct  455  KIQTANFDQKVGVQIIQNALKMPAYTIAQNAGVEGAVVVGKLLEQTNMSIGYDAAKAEYV  514

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            DMVKAGIIDPVKVIRT+LVDAASV+SL+TTTE+VV +  K E
Sbjct  515  DMVKAGIIDPVKVIRTSLVDAASVASLMTTTESVVADFNKAE  556



>gb|AEZ00902.1| putative mitochondrial chaperonin HSP60 protein, partial [Elaeis 
guineensis]
Length=178

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA++EL+
Sbjct  2    RLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYAARELD  61

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N D+KIGVQII+NALK P  TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEYV
Sbjct  62   SIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEYV  121

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            DMVKAGI+DP+KVIRTALVDAASVS LLTTTEA VVEL
Sbjct  122  DMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVEL  159



>ref|XP_008808005.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGE+KD+VTDALNA++AAVEEGIVPGGGVALLYA++EL+
Sbjct  255  RLSKLSGGVAVLKIGGASEAEVGERKDKVTDALNASRAAVEEGIVPGGGVALLYATRELD  314

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            ++ T+N ++KIGVQII+NALK P  TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEYV
Sbjct  315  RIQTSNGNEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEYV  374

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            DMVK+GIIDP+KVIRTALVDAASVS LLTTTEA VVEL
Sbjct  375  DMVKSGIIDPLKVIRTALVDAASVSVLLTTTEAAVVEL  412



>ref|XP_010106240.1| hypothetical protein L484_005105 [Morus notabilis]
 gb|EXC09149.1| hypothetical protein L484_005105 [Morus notabilis]
Length=528

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYASK LE
Sbjct  353  RLAKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYASKALE  412

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQKIGVQIIQNA+K P  TIA+NAG +GA+V+GKLLEQD+ +LGYDAAKGEYV
Sbjct  413  NLQTQNGDQKIGVQIIQNAIKAPTFTIATNAGFDGALVLGKLLEQDDYNLGYDAAKGEYV  472

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAAS+S LLTTTEA V+E P D K+ P+
Sbjct  473  DMVKAGIIDPLKVVRTALVDAASISLLLTTTEAAVLENP-DVKKPPS  518



>ref|XP_009410784.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGI+PGGGV+LLYA+KEL+
Sbjct  406  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGILPGGGVSLLYATKELD  465

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ T+N D+ IGVQII+NALK P  TIA NAGV+GAVVVGKLLEQ+N +LGYDAAKGEYV
Sbjct  466  KIQTSNSDENIGVQIIKNALKAPTLTIAGNAGVDGAVVVGKLLEQENLNLGYDAAKGEYV  525

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMV+AGIIDP+KV+RTALVDAASVS LLTTTEA VVELP D K  P
Sbjct  526  DMVEAGIIDPLKVVRTALVDAASVSVLLTTTEAAVVELP-DAKSGP  570



>gb|EMT28156.1| Chaperonin CPN60-like 2, mitochondrial [Aegilops tauschii]
Length=592

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVA+LKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  416  RLSKLSGGVAILKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  475

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T++ D+KIGVQII+NALK P+ TIA+NAGV+GA+V+GKLLEQDN  LGYDAAKGEYV
Sbjct  476  NISTSHEDEKIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNLSLGYDAAKGEYV  535

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+TTTEA V ELP
Sbjct  536  DMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  574



>dbj|BAJ88210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=582

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  406  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYAAKELD  465

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            ++ T++ D++IGVQII+NALK P+ TIA+NAGV+GA+V+GKLLEQDN  LGYDAAKGEYV
Sbjct  466  QISTSHEDERIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNLSLGYDAAKGEYV  525

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+TTTEA V ELP
Sbjct  526  DMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  564



>ref|NP_001140224.1| uncharacterized protein LOC100272259 [Zea mays]
 gb|ACF83366.1| unknown [Zea mays]
Length=441

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  265  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  324

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAAKGEYV
Sbjct  325  KISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAAKGEYV  384

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+ TTEA V ELP
Sbjct  385  DMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  423



>ref|XP_010925015.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Elaeis guineensis]
Length=431

 Score =   254 bits (649),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA++EL+
Sbjct  255  RLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYAARELD  314

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N D+KIGVQII+NALK P  TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEYV
Sbjct  315  SIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEYV  374

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            DMVKAGI+DP+KVIRTALVDAASVS LLTTTEA VVEL
Sbjct  375  DMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVEL  412



>ref|XP_008807997.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Phoenix dactylifera]
Length=576

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGE+KD+VTDALNA++AAVEEGIVPGGGVALLYA++EL+
Sbjct  400  RLSKLSGGVAVLKIGGASEAEVGERKDKVTDALNASRAAVEEGIVPGGGVALLYATRELD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            ++ T+N ++KIGVQII+NALK P  TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEYV
Sbjct  460  RIQTSNGNEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            DMVK+GIIDP+KVIRTALVDAASVS LLTTTEA VVEL
Sbjct  520  DMVKSGIIDPLKVIRTALVDAASVSVLLTTTEAAVVEL  557



>ref|XP_004961365.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Setaria 
italica]
Length=579

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA KAAVEEGIVPGGGVALLYA+KEL+
Sbjct  403  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAAKAAVEEGIVPGGGVALLYATKELD  462

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+NALK P+ TIA+NAG++GA+V+GKL EQD+  LGYDA++GEYV
Sbjct  463  KISTANEDEKIGVQIIKNALKAPLMTIAANAGIDGAIVIGKLSEQDDLSLGYDASRGEYV  522

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+TTTEA V ELP
Sbjct  523  DMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVSELP  561



>ref|XP_002441451.1| hypothetical protein SORBIDRAFT_09g026970 [Sorghum bicolor]
 gb|EES19881.1| hypothetical protein SORBIDRAFT_09g026970 [Sorghum bicolor]
Length=581

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  405  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  464

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ T+N D+KIGVQII+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAAKGEYV
Sbjct  465  KISTSNEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAAKGEYV  524

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+TTTEA V ELP
Sbjct  525  DMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVSELP  563



>ref|XP_008647482.1| PREDICTED: uncharacterized protein LOC100272259 isoform X2 [Zea 
mays]
 gb|AFW78923.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=565

 Score =   255 bits (651),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  389  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  448

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAAKGEYV
Sbjct  449  KISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAAKGEYV  508

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+ TTEA V ELP
Sbjct  509  DMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  547



>ref|XP_008647480.1| PREDICTED: uncharacterized protein LOC100272259 isoform X1 [Zea 
mays]
 gb|ACN25829.1| unknown [Zea mays]
 gb|AFW78924.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=580

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  404  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  463

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAAKGEYV
Sbjct  464  KISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAAKGEYV  523

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+ TTEA V ELP
Sbjct  524  DMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  562



>ref|XP_010242227.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nelumbo nucifera]
Length=574

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYASK LE
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYASKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T+N DQK G+QIIQ+A+K P  TIASNAGV+G+VV+GKLLEQ++ +LGYDAA+GEYV
Sbjct  458  NLETSNSDQKRGIQIIQDAVKAPTFTIASNAGVDGSVVLGKLLEQEDFNLGYDAARGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDP+KV+RTALVDAASVS LLTT+EA VV+ P      P
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASVSLLLTTSEAAVVDHPDASSSVP  563



>ref|XP_010925013.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Elaeis guineensis]
Length=576

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLK+GGASEAEV E+KDRVTD+LNA +AAVEEGIVPGGGVALLYA++EL+
Sbjct  400  RLSKLSGGVAVLKVGGASEAEVSERKDRVTDSLNAARAAVEEGIVPGGGVALLYAARELD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N D+KIGVQII+NALK P  TIA+NAGV+GAV++GKLLEQ+N +LGYDAAKGEYV
Sbjct  460  SIQTSNGDEKIGVQIIKNALKAPTFTIATNAGVDGAVIIGKLLEQENLNLGYDAAKGEYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGI+DP+KVIRTALVDAASVS LLTTTEA VVEL   E ++P
Sbjct  520  DMVKAGILDPLKVIRTALVDAASVSVLLTTTEAAVVELA--EAKSP  563



>gb|KDO65217.1| hypothetical protein CISIN_1g0081811mg, partial [Citrus sinensis]
Length=194

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  18   RLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALE  77

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ G+ IIQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAAKGEYV
Sbjct  78   NLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYV  137

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTAL DAASVS L TTTEA V+    D+ + P+
Sbjct  138  DMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  184



>gb|AFW78925.1| putative TCP-1/cpn60 chaperonin family protein [Zea mays]
Length=648

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  472  RLSKLSGGVAVLKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKELD  531

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+N+LK P+ TIA+NAG++GA+V+GKL+EQ++  LGYDAAKGEYV
Sbjct  532  KISTANEDEKIGVQIIKNSLKAPLMTIAANAGIDGAIVIGKLIEQEDLSLGYDAAKGEYV  591

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DM+KAGIIDPVKVIRTAL DAASVS L+ TTEA V ELP
Sbjct  592  DMIKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  630



>ref|XP_008391328.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Malus domestica]
Length=574

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKSLE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQ+ GVQIIQNALK P  TI SNAG +GA+V+GKLLEQD+  +GYDAAKGEYV
Sbjct  458  NLHMQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGALVIGKLLEQDDLKMGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA VV+ P D+K+ P+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDNP-DQKKPPS  563



>ref|XP_010654528.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Vitis vinifera]
Length=574

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYATKVLE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N DQK GVQIIQN LK P  TI SNAG +GA+V+GKLLEQD+ +LGYDAAKG YV
Sbjct  458  NIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAAKGVYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VV+ P ++   P+
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  564



>gb|KJB56921.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=429

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY++K L+
Sbjct  255  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYSTKALQ  314

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQK GVQIIQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+KG Y+
Sbjct  315  NLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDASKGAYI  374

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA V+E P DEK+ P+
Sbjct  375  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENP-DEKKPPS  420



>ref|XP_003567994.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brachypodium 
distachyon]
Length=576

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL++LSGGVA+LKIGGASEAEVGEKKDRVTDALNA +AAVEEGIVPGGGVALLYA+K L+
Sbjct  400  RLSRLSGGVAILKIGGASEAEVGEKKDRVTDALNAARAAVEEGIVPGGGVALLYATKVLD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ T++ D+KIGVQII+NALK P+ TIA+NAGV+GA+V+GKLLEQDN  LGYDAAK EYV
Sbjct  460  KISTSHEDEKIGVQIIKNALKAPLMTIAANAGVDGAIVIGKLLEQDNPSLGYDAAKEEYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            DMVKAGIIDPVKVIRTAL DAASVS L+ TTEA V ELP
Sbjct  520  DMVKAGIIDPVKVIRTALQDAASVSLLMATTEAAVSELP  558



>emb|CAN78641.1| hypothetical protein VITISV_031740 [Vitis vinifera]
Length=579

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA+K LE
Sbjct  403  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYATKVLE  462

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N DQK GVQIIQN LK P  TI SNAG +GA+V+GKLLEQD+ +LGYDAAKG YV
Sbjct  463  NIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAAKGVYV  522

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VV+ P ++   P+
Sbjct  523  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  569



>emb|CBI35954.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA+K LE
Sbjct  389  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYATKVLE  448

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T+N DQK GVQIIQN LK P  TI SNAG +GA+V+GKLLEQD+ +LGYDAAKG YV
Sbjct  449  NIQTSNEDQKRGVQIIQNGLKAPTFTIVSNAGGDGALVLGKLLEQDDLNLGYDAAKGVYV  508

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VV+ P ++   P+
Sbjct  509  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVDHPDEKNSAPS  555



>ref|XP_009341038.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Pyrus x bretschneideri]
Length=570

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA K LE
Sbjct  394  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYAIKSLE  453

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQ+ GVQIIQNALK P  TI SNAG +GA+V+GKLLEQD+  +GYDAAKGEYV
Sbjct  454  NLHMQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGALVLGKLLEQDDLKMGYDAAKGEYV  513

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA VV+ P D+K+ P+
Sbjct  514  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDNP-DQKKPPS  559



>gb|KHN11282.1| Chaperonin CPN60-like 2, mitochondrial [Glycine soja]
Length=559

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  383  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  442

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG YV
Sbjct  443  NLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAAKGVYV  502

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA V++ P D+ ++P+
Sbjct  503  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKSPS  549



>ref|XP_006655538.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Oryza 
brachyantha]
Length=578

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV+KIGGASEAEVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  401  RLSKLSGGVAVVKIGGASEAEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYATKELD  460

Query  654  KLPTA-NFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEY  478
            K+ TA N D+KIGVQII+NALK P+ TIA+NAG++G VV+GKL+EQDN +LG+DAA+GEY
Sbjct  461  KIITATNEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNLGFDAARGEY  520

Query  477  VDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELP  358
            VDM+KAGIIDPVKVIRTAL DAASVS L+TTTEA V ELP
Sbjct  521  VDMIKAGIIDPVKVIRTALQDAASVSLLMTTTEAAVAELP  560



>ref|XP_006585518.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=506

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  330  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  389

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG YV
Sbjct  390  NLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAAKGVYV  449

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA V++ P D+ + P+
Sbjct  450  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKPPS  496



>ref|XP_002967038.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
 gb|EFJ31637.1| hypothetical protein SELMODRAFT_87823, partial [Selaginella moellendorffii]
Length=548

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL KLSGGVA+LK+GG SEAEV EKKDRV DALNAT AA+EEGIVPGGGVALLYA+ EL+
Sbjct  366  RLGKLSGGVAMLKVGGGSEAEVMEKKDRVMDALNATNAAIEEGIVPGGGVALLYAANELK  425

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   +FDQKIGVQ+IQNALK P HTIA+NAGVEGA+VV KLLEQ + + GYDAA GEYV
Sbjct  426  NLSVPSFDQKIGVQVIQNALKIPTHTIAANAGVEGALVVSKLLEQSSPNFGYDAATGEYV  485

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DM+KAGIIDPVKVIR AL+DAAS+SSLLTTTE V+ E+ ++E+E
Sbjct  486  DMIKAGIIDPVKVIRIALMDAASISSLLTTTEVVITEVFREERE  529



>ref|XP_007215308.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
 gb|EMJ16507.1| hypothetical protein PRUPE_ppa003440mg [Prunus persica]
Length=574

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 148/193 (77%), Gaps = 24/193 (12%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQ+ GVQIIQNALK P  TI SNAG +G +V+GKLLEQD+  LGYDAAKGEYV
Sbjct  458  NLQVQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGPLVLGKLLEQDDPKLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPAgmgggmggmggMD  295
            DMVKAGIIDP+KVIRTAL+DAASVS LLTTTEA VV+ P ++K                 
Sbjct  518  DMVKAGIIDPLKVIRTALIDAASVSLLLTTTEAAVVDKPNEKK-----------------  560

Query  294  Y**DP*SPPSHLP  256
                   PPSH+P
Sbjct  561  -------PPSHVP  566



>ref|XP_003627097.1| Chaperonin CPN60-like protein [Medicago truncatula]
 gb|AET01573.1| TCP-1/cpn60 chaperonin family protein [Medicago truncatula]
Length=576

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYASK LE
Sbjct  400  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYASKVLE  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D++ GVQIIQNALK P +TIASNAG +G +V  KLLEQD+ +LG+DAAKG YV
Sbjct  460  NLQTKNEDERRGVQIIQNALKAPTYTIASNAGFDGTLVHSKLLEQDDFNLGFDAAKGTYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKV+RTALVDAASVS LLTTTEA +VE   D+ + P
Sbjct  520  DMVKAGIIDPVKVVRTALVDAASVSLLLTTTEASIVENMSDKNKPP  565



>gb|KJB56920.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=527

 Score =   248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY++K L+
Sbjct  353  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYSTKALQ  412

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQK GVQIIQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+KG Y+
Sbjct  413  NLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDASKGAYI  472

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA V+E P DEK+ P+
Sbjct  473  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENP-DEKKPPS  518



>ref|XP_003531614.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=574

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG YV
Sbjct  458  NLQTQNEDEKRGVQIIQNALKAPTSTIASNAGFDGALVHSKLLEQDDHNLGFDAAKGVYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA V++ P D+ + P+
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVLDNPHDKNKPPS  564



>ref|XP_012068975.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X2 
[Jatropha curcas]
Length=573

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYANKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQK G+QIIQNALK P +TI SNAG +  VV+GKLLEQD+ + GYDAAKGEYV
Sbjct  458  DLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MVKAGIIDP+KVIRTALVDAASVS LLTTTEA +V+ P +EK+ P+
Sbjct  518  NMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVDSP-NEKKPPS  563



>ref|XP_012068973.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial isoform X1 
[Jatropha curcas]
Length=574

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  399  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYANKALE  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQK G+QIIQNALK P +TI SNAG +  VV+GKLLEQD+ + GYDAAKGEYV
Sbjct  459  DLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAAKGEYV  518

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MVKAGIIDP+KVIRTALVDAASVS LLTTTEA +V+ P +EK+ P+
Sbjct  519  NMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVDSP-NEKKPPS  564



>gb|KJB56919.1| hypothetical protein B456_009G141700 [Gossypium raimondii]
Length=572

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLY++K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYSTKALQ  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQK GVQIIQ+ALK P  TIASNAG +G++V+GKLLEQD+ +LG+DA+KG Y+
Sbjct  458  NLQTENEDQKRGVQIIQDALKAPTLTIASNAGYDGSLVLGKLLEQDDDNLGFDASKGAYI  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA V+E P DEK+ P+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEASVLENP-DEKKPPS  563



>ref|XP_008228292.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Prunus mume]
Length=574

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQ+ GVQIIQNALK P  TI SNAG +G +V+GKLLEQD+  LGYDAAKGE+V
Sbjct  458  NLQVQNEDQRRGVQIIQNALKAPTFTIVSNAGFDGPLVLGKLLEQDDPKLGYDAAKGEFV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KVIRTALVDAASVS LLTTTEA VV+ P +EK+ P+
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAVVDKP-NEKKPPS  563



>gb|AFK48092.1| unknown [Lotus japonicus]
Length=352

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  176  RLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLE  235

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TI +NAG +G++V  KLLEQD+ +LG+DAA G YV
Sbjct  236  NLETKNEDEKRGVQIIQNALKAPTVTIVANAGFDGSLVQNKLLEQDDHNLGFDAATGTYV  295

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTT EA VVE P ++ ++P+
Sbjct  296  DMVKAGIIDPLKVVRTALVDAASVSLLLTTMEAAVVENPNNKNKSPS  342



>ref|XP_002960969.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
 gb|EFJ38508.1| hypothetical protein SELMODRAFT_74977, partial [Selaginella moellendorffii]
Length=548

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL KLSGGVA+LK+GG SEAEV EKKDRV DALNAT AA+EEGIVPGGGVALLYA+  L+
Sbjct  366  RLGKLSGGVAMLKVGGGSEAEVMEKKDRVMDALNATNAAIEEGIVPGGGVALLYAANALK  425

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   +FDQKIGVQ+IQNALK P HTIA+NAGVEGA+VV KLLEQ + + GYDAA GEYV
Sbjct  426  NLNVPSFDQKIGVQVIQNALKIPTHTIAANAGVEGALVVSKLLEQSSPNFGYDAATGEYV  485

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DM+KAGIIDPVKVIR AL+DAAS+SSLLTTTE V+ E+ ++E+E
Sbjct  486  DMIKAGIIDPVKVIRIALMDAASISSLLTTTEVVITEVFREERE  529



>ref|XP_006385442.1| hypothetical protein POPTR_0003s04540g [Populus trichocarpa]
 gb|ERP63239.1| hypothetical protein POPTR_0003s04540g [Populus trichocarpa]
Length=382

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE++DRV DALNA++AAVEEGIVPGGGVALLY++K LE
Sbjct  207  RLSKLSGGVAVFKVGGASEAEVGERRDRVADALNASRAAVEEGIVPGGGVALLYSTKALE  266

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL   N D+K G+QIIQNALK P HTI SNAG + A V GKL EQD+ +LGYDAAKGEYV
Sbjct  267  KLQAQNEDEKRGIQIIQNALKAPAHTIVSNAGFDSATVPGKLSEQDDYNLGYDAAKGEYV  326

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MVKAGIID  KVIRTA+VDAASVS LLTTTEA V+E P+ EK+ P+
Sbjct  327  EMVKAGIIDSFKVIRTAMVDAASVSLLLTTTEATVLENPQ-EKKPPS  372



>ref|XP_004510380.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Cicer 
arietinum]
Length=576

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYASK L+
Sbjct  400  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYASKVLD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D++ GVQIIQNALK P  TIASNAG +G +V  KLLEQD+ +LG+DAAKG YV
Sbjct  460  NLQTKNEDERRGVQIIQNALKAPTFTIASNAGFDGTLVHSKLLEQDDLNLGFDAAKGTYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKV+RTALVDAAS+S LLTTTEA +VE   D+ + P
Sbjct  520  DMVKAGIIDPVKVVRTALVDAASISLLLTTTEASIVESLSDKNKPP  565



>gb|EYU21369.1| hypothetical protein MIMGU_mgv1a003594mg [Erythranthe guttata]
Length=575

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA++ L 
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATRVLR  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN DQK GV+II+NALK P  TIASNAG +GA+++GKLLEQD+ +LGYDAAKGEYV
Sbjct  458  DLQTANEDQKRGVEIIENALKAPTFTIASNAGADGALILGKLLEQDDLNLGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
            +MVKAGI+DPVKVIRTAL+DAASVS LLTTTEA++ +
Sbjct  518  NMVKAGIVDPVKVIRTALLDAASVSLLLTTTEAIIAD  554



>emb|CDO97909.1| unnamed protein product [Coffea canephora]
Length=574

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AA+EEGIVPGGGVALLYA++ L 
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAIEEGIVPGGGVALLYAARSLR  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L  AN DQ+ G+QII+NALK P  TI SNAG +GA+V+GKLLEQD+ +LGYDAAKG+YV
Sbjct  458  HLQAANEDQRRGIQIIENALKAPTLTIVSNAGSDGALVIGKLLEQDDLNLGYDAAKGQYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            DMVKAGIIDP+KVIRTALVDAASVS LLTT EA VV+L
Sbjct  518  DMVKAGIIDPLKVIRTALVDAASVSLLLTTAEATVVDL  555



>ref|XP_007024507.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
 gb|EOY27129.1| Heat shock protein 60-3A isoform 3 [Theobroma cacao]
Length=546

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLY  K L+
Sbjct  372  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYGIKVLQ  431

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQK G+QIIQ+ALK+P  TI SNAG +G++V+G+LLEQD+ +LG+DA+KG YV
Sbjct  432  NLQTQNEDQKRGIQIIQDALKSPTLTITSNAGYDGSLVLGRLLEQDDDNLGFDASKGTYV  491

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAAS+S LLTTTEA V+E P DEK+ P+
Sbjct  492  DMVKAGIIDPLKVVRTALVDAASISLLLTTTEASVLENP-DEKKPPS  537



>ref|NP_566466.1| heat shock protein 60-3A [Arabidopsis thaliana]
 sp|Q93ZM7.2|CH60C_ARATH RecName: Full=Chaperonin CPN60-like 2, mitochondrial; AltName: 
Full=HSP60-like 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02911.1| chaperonin; similar to GroEL protein [Arabidopsis thaliana]
 gb|AAM19824.1| AT3g13860/MCP4_7 [Arabidopsis thaliana]
 gb|AAU95459.1| At3g13860 [Arabidopsis thaliana]
 gb|AEE75427.1| heat shock protein 60-3A [Arabidopsis thaliana]
Length=572

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 145/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DAAKG+YV
Sbjct  458  NLQTENEDQRRGVQIVQNALKAPAFTIAANAGYDGSLVVGKLLEQDDCNFGFDAAKGKYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVIRTAL DAASVS LLTTTEA V  L K ++ TP
Sbjct  518  DMVKAGIIDPVKVIRTALTDAASVSLLLTTTEASV--LVKADENTP  561



>ref|XP_002946991.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
 gb|EFJ52217.1| hypothetical protein VOLCADRAFT_79395 [Volvox carteri f. nagariensis]
Length=571

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 146/165 (88%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+ASK L+
Sbjct  395  RLAKLSGGVAVLKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGAALLHASKALD  454

Query  654  KLPTA--NFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
             + +   NFDQKIGVQIIQNAL+ P+ TIASNAGVEGAVVVGK+LE ++  +GY+AA G+
Sbjct  455  DVKSKLDNFDQKIGVQIIQNALRVPMKTIASNAGVEGAVVVGKVLELEDPAMGYNAATGQ  514

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            Y DMVK GIIDP+KV+RTALVDAASVSSL+TT+E VVVE P+D+K
Sbjct  515  YQDMVKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  559



>ref|XP_010534892.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Tarenaya hassleriana]
Length=572

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T N DQ+ GVQI+QNALK P  TIA+NAG +G++V+GKLLEQD+ + G+DAAKG YV
Sbjct  458  NVQTQNEDQRRGVQIVQNALKAPTLTIAANAGFDGSLVIGKLLEQDDNNFGFDAAKGSYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDPVKVI+TALVDAASVS LLTTTEA +V + +DEK
Sbjct  518  DMVKAGIIDPVKVIKTALVDAASVSLLLTTTEASIV-VSRDEK  559



>ref|XP_007024505.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
 gb|EOY27127.1| Heat shock protein 60-3A isoform 1 [Theobroma cacao]
Length=572

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLY  K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYGIKVLQ  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQK G+QIIQ+ALK+P  TI SNAG +G++V+G+LLEQD+ +LG+DA+KG YV
Sbjct  458  NLQTQNEDQKRGIQIIQDALKSPTLTITSNAGYDGSLVLGRLLEQDDDNLGFDASKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAAS+S LLTTTEA V+E P DEK+ P+
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASISLLLTTTEASVLENP-DEKKPPS  563



>ref|XP_011072524.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Sesamum indicum]
Length=574

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA + L 
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYAKRVLR  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN DQ+ GV++I+NALK P +TIASNAG +G +V+GKLLEQD+ + GYDAA GEYV
Sbjct  458  NLQTANEDQRRGVEVIENALKAPTYTIASNAGADGTLVLGKLLEQDDLNFGYDAATGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
            DMVKAGIIDPVKVIRTALVDAASVS LLTTTEA +V+
Sbjct  518  DMVKAGIIDPVKVIRTALVDAASVSLLLTTTEAAIVD  554



>ref|XP_004297534.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=574

 Score =   245 bits (625),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGILPGGGVALLYATKALK  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T N DQ+ GV+IIQNALK P  TI  NAG +GA+VVGKLLEQD+  +GYDAA GEYV
Sbjct  458  NIQTQNEDQRRGVEIIQNALKAPTFTIVRNAGFDGALVVGKLLEQDDYRMGYDAANGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDP+KV+RT+LVDAASVS LLTTTEA +V+ P ++K
Sbjct  518  DMVKAGIIDPLKVVRTSLVDAASVSLLLTTTEASIVDSPTEKK  560



>ref|XP_002884993.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61252.1| hypothetical protein ARALYDRAFT_478789 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  NLQTQNEDQRRGVQIVQNALKAPAFTIAENAGYDGSLVVGKLLEQDDCNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDPVKVIRTAL DAASVS LLTTTEA V  L K ++ TP
Sbjct  518  DMVKSGIIDPVKVIRTALTDAASVSLLLTTTEASV--LVKADENTP  561



>ref|NP_001056181.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|AAV67812.1| putative chaperonin [Oryza sativa Japonica Group]
 dbj|BAF18095.1| Os05g0540300 [Oryza sativa Japonica Group]
 gb|EEE64532.1| hypothetical protein OsJ_19383 [Oryza sativa Japonica Group]
Length=581

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGGASE EVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  405  RLSKLSGGVAVLKIGGASEVEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYATKELD  464

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+NALK P+ TIA+NAG++G VV+GKL+EQDN ++GYDAA+GEYV
Sbjct  465  KIITANEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNMGYDAARGEYV  524

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTT  382
            DM+KAGIIDPVKVIRTAL DA+SVS L+TTT
Sbjct  525  DMIKAGIIDPVKVIRTALQDASSVSLLMTTT  555



>ref|XP_006583012.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Glycine 
max]
Length=574

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG Y 
Sbjct  458  NLQTQNEDEKRGVQIIQNALKAPTITIASNAGFDGALVHSKLLEQDDHNLGFDAAKGVYA  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VV+   D+ + P+
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVVDNSHDKNKPPS  564



>ref|XP_010487162.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  NLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDFNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K ++ TP
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADENTP  561



>gb|KFK38736.1| hypothetical protein AALP_AA3G153700 [Arabis alpina]
Length=572

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAE+GE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGQSEAEMGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  NLQTQNEDQRRGVQIVQNALKAPAVTIAANAGYDGSLVVGKLLEQDDFNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVI+TAL DAAS+S LLTTTEA V  L K ++ETP
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASISLLLTTTEATV--LVKADEETP  561



>ref|XP_010465258.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  DLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDCNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K +++TP
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADEDTP  561



>ref|XP_007135549.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
 gb|ESW07543.1| hypothetical protein PHAVU_010G138700g [Phaseolus vulgaris]
Length=569

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  394  RLSKLSGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  453

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG YV
Sbjct  454  NLQTQNEDEKRGVQIIQNALKAPTFTIASNAGFDGALVHSKLLEQDDHNLGFDAAKGIYV  513

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VVE
Sbjct  514  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEATVVE  550



>ref|XP_001691353.1| chaperonin 60C [Chlamydomonas reinhardtii]
 gb|EDP05086.1| chaperonin 60C, partial [Chlamydomonas reinhardtii]
Length=537

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAV+KIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+ASK L+
Sbjct  361  RLAKLSGGVAVIKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGSALLHASKTLD  420

Query  654  KLPTA--NFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
             +     NFDQKIGV IIQNAL+ P+ TIASNAGVEGAV+VGK+LE     +GY+AA GE
Sbjct  421  DVTAKLDNFDQKIGVNIIQNALRVPMKTIASNAGVEGAVIVGKVLEMAEPQMGYNAATGE  480

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            +VDM+K GIIDP+KV+RTALVDAASVSSL+TT+E VVVE P+D+K
Sbjct  481  FVDMIKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  525



>ref|XP_010501368.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Camelina sativa]
Length=572

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK PV TIA NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  DLQTQNEDQRRGVQIVQNALKAPVVTIAENAGYDGSLVVGKLLEQDDCNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K ++ TP
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADENTP  561



>gb|EEC79614.1| hypothetical protein OsI_20809 [Oryza sativa Indica Group]
Length=581

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAVLKIGG SE EVGEKKDRVTDAL+A +AAVEEGIVPGGGVALLYA+KEL+
Sbjct  405  RLSKLSGGVAVLKIGGTSEVEVGEKKDRVTDALHAARAAVEEGIVPGGGVALLYATKELD  464

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+ TAN D+KIGVQII+NALK P+ TIA+NAG++G VV+GKL+EQDN ++GYDAA+GEYV
Sbjct  465  KIITANEDEKIGVQIIKNALKAPLMTIAANAGIDGGVVIGKLIEQDNLNMGYDAARGEYV  524

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTT  382
            DM+KAGIIDPVKVIRTAL DA+SVS L+TTT
Sbjct  525  DMIKAGIIDPVKVIRTALQDASSVSLLMTTT  555



>ref|XP_006466018.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial-like [Citrus 
sinensis]
Length=574

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ G+ IIQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAAKGEYV
Sbjct  458  NLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTAL DAASVS L TTTEA V+    D+ + P+
Sbjct  518  DMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  564



>ref|XP_006426562.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
 gb|ESR39802.1| hypothetical protein CICLE_v10025257mg [Citrus clementina]
Length=574

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KL+GGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLTGGVAVFKVGGASEVEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ G+ IIQNALK P  TIASNAG +G+ ++GKLLEQD+ + G+DAAKGEYV
Sbjct  458  NLKTENEDQRRGIHIIQNALKAPTLTIASNAGFDGSTIIGKLLEQDDVNFGFDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTAL DAASVS L TTTEA V+    D+ + P+
Sbjct  518  DMVKAGIIDPLKVVRTALADAASVSLLFTTTEATVLVNSDDKNKPPS  564



>ref|XP_002527401.1| chaperonin-60kD, ch60, putative [Ricinus communis]
 gb|EEF34967.1| chaperonin-60kD, ch60, putative [Ricinus communis]
Length=573

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQK G++IIQNALK P  TI SNAG    VV+GKLLEQD+ +LGYDAAKGE+V
Sbjct  458  DLQAQNEDQKRGIEIIQNALKAPTSTIVSNAGFNAPVVLGKLLEQDDHNLGYDAAKGEFV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MV+AGIIDP+KVIRTALVDAASVS LLTTTEA V++ P +EK+ P+
Sbjct  518  NMVQAGIIDPLKVIRTALVDAASVSLLLTTTEAAVIDNP-NEKKPPS  563



>emb|CBL93634.1| mitochondrial chaperonin 60 precursor [Chlamydomonas reinhardtii]
Length=571

 Score =   242 bits (618),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 143/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAV+KIGGASE EVGEKKDRV DALNATKAAVEEGIVPGGG ALL+ASK L+
Sbjct  395  RLAKLSGGVAVIKIGGASEVEVGEKKDRVVDALNATKAAVEEGIVPGGGSALLHASKTLD  454

Query  654  KLPTA--NFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
             +     NFDQKIGV IIQNAL+ P+ TIASNAGVEGAV+VGK+LE     +GY+AA GE
Sbjct  455  DVTAKLDNFDQKIGVNIIQNALRVPMKTIASNAGVEGAVIVGKVLEMAEPQMGYNAATGE  514

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            +VDM+K GIIDP+KV+RTALVDAASVSSL+TT+E VVVE P+D+K
Sbjct  515  FVDMIKGGIIDPLKVVRTALVDAASVSSLITTSECVVVEAPEDKK  559



>ref|XP_010685392.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685393.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685394.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=570

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KL+GGVAV K+GGASEAEV E+KDRV DALNAT+AAVEEGIVPGGGVALL+ASK LE
Sbjct  395  RLSKLAGGVAVFKVGGASEAEVSERKDRVIDALNATRAAVEEGIVPGGGVALLHASKALE  454

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T N DQK GV+I+QNALK P  TI SNAG E  +V+GKL+EQD+ ++GYDA+KGEYV
Sbjct  455  NIHTKNEDQKRGVRIVQNALKAPTVTIVSNAGGEAPLVIGKLMEQDDHNIGYDASKGEYV  514

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            +MVKAGIIDPVKVIRTALVDAASVSSLLTT EAV+ E P+  K
Sbjct  515  NMVKAGIIDPVKVIRTALVDAASVSSLLTTNEAVITEHPEQSK  557



>emb|CDX82514.1| BnaA03g33070D [Brassica napus]
Length=572

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+KG YV
Sbjct  458  NLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDASKGSYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K E++T
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>gb|KHN39306.1| Chaperonin CPN60-like 2, mitochondrial [Glycine soja]
Length=574

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGEGKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N D+K GVQIIQNALK P  TIASNAG +GA+V  KLLEQD+ +LG+DAAKG Y 
Sbjct  458  NLQTQNEDEKRGVQIIQNALKAPTITIASNAGFDGALVHSKLLEQDDHNLGFDAAKGVYA  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGIIDP+KV+RTALVDAASVS LLTTTEA VV+   D+ + P+
Sbjct  518  DMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAVVDNSHDKNKPPS  564



>emb|CDX75733.1| BnaC03g38160D [Brassica napus]
Length=572

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+KG YV
Sbjct  458  NLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDASKGSYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K E++T
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>ref|XP_009135334.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Brassica rapa]
Length=572

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 2/165 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DA+KG YV
Sbjct  458  NLETQNEDQRRGVQIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDASKGSYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKET  340
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K E++T
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKAEEKT  560



>ref|XP_006296696.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
 gb|EOA29594.1| hypothetical protein CARUB_v10013333mg [Capsella rubella]
Length=572

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GVQI+QNALK P  TIA NAG +G++VVGKLLEQD+++ G+DAAKG YV
Sbjct  458  NLQTQNEDQRRGVQIVQNALKAPAMTIAENAGYDGSLVVGKLLEQDDSNFGFDAAKGTYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            DMVKAGIIDPVKVI+TAL DAASVS LLTTTEA V  L K +  TP
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASVSLLLTTTEASV--LVKADVNTP  561



>ref|XP_006342978.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-like 2, mitochondrial-like 
[Solanum tuberosum]
Length=573

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKCLK  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN  QK GV+II+NALK P  TIASNAG +GA+VVGKLLEQD+ +LGYDAAKG Y+
Sbjct  458  GLQTANDGQKRGVEIIENALKAPTFTIASNAGADGALVVGKLLEQDDLNLGYDAAKGTYL  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
             MVKAGIIDPVKV+RTALVDAASVS LLTT EA +V+
Sbjct  518  HMVKAGIIDPVKVVRTALVDAASVSLLLTTAEAAIVD  554



>ref|XP_009796310.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
sylvestris]
Length=570

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  395  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKCLK  454

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN  QK GV+II+NALK P  TIASNAGV+GA+V+GKLLEQD+ +LG+DAAKG Y 
Sbjct  455  DLQTANDGQKKGVEIIENALKAPTFTIASNAGVDGALVLGKLLEQDDLNLGFDAAKGTYR  514

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
             MVKAGIIDP+KV+RTALVDAASVS LLTTTEA +V+
Sbjct  515  HMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAIVD  551



>ref|XP_004235594.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Solanum lycopersicum]
Length=573

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKCLK  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN  QK GV+II+NALK P  TIASNAG +GA+VVGKLLEQD+ +LGYDAAKG Y+
Sbjct  458  GLQTANDGQKRGVEIIENALKAPTFTIASNAGADGALVVGKLLEQDDLNLGYDAAKGTYL  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
             MVKAGIIDPVKV+RTAL+DAASVS LLTT EA +V+   +E
Sbjct  518  HMVKAGIIDPVKVVRTALMDAASVSLLLTTAEAAIVDRQGEE  559



>ref|XP_010062630.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Eucalyptus 
grandis]
Length=573

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T N D++ GVQIIQNALK P   I SNAG +G +++GKLLEQDN ++G+DAAKG+YV
Sbjct  458  NVQTQNEDERRGVQIIQNALKAPSLAILSNAGFDGVLILGKLLEQDNFNMGFDAAKGDYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGI+DP+KV+RTALVDAASVS LL TTE  +VE   +EK+ P+
Sbjct  518  DMVKAGILDPLKVVRTALVDAASVSLLLATTEVAIVERA-NEKKPPS  563



>ref|XP_009629888.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Nicotiana 
tomentosiformis]
Length=573

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKCLK  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN  QK GV+II+NALK P  TIASNAG +GA+V+GKLLEQD+ +LG+DAAKG Y 
Sbjct  458  DLQTANDGQKKGVEIIENALKAPTFTIASNAGADGALVLGKLLEQDDLNLGFDAAKGTYR  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVE  364
             MVKAGIIDP+KV+RTALVDAASVS LLTTTEA +V+
Sbjct  518  HMVKAGIIDPLKVVRTALVDAASVSLLLTTTEAAIVD  554



>ref|XP_011659644.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis sativus]
 gb|KGN45525.1| hypothetical protein Csa_7G451310 [Cucumis sativus]
Length=570

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALL+A+K L+
Sbjct  394  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLHATKVLD  453

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            +L   N DQK G++I+Q+AL+ P   I SNAG +GA+VVGKLLEQD+ + G+DAA+GEYV
Sbjct  454  ELQAQNEDQKRGIEIVQHALRAPTSAIVSNAGYDGALVVGKLLEQDDRNFGFDAAQGEYV  513

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGI+DP+KV+RTALVDA+SVS LLTT EA +VE P +  + P+
Sbjct  514  DMVKAGIVDPLKVVRTALVDASSVSLLLTTAEAAIVEHPNNTNKLPS  560



>gb|KDP40768.1| hypothetical protein JCGZ_24767 [Jatropha curcas]
Length=1295

 Score =   245 bits (626),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  398  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYANKALE  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L   N DQK G+QIIQNALK P +TI SNAG +  VV+GKLLEQD+ + GYDAAKGEYV
Sbjct  458  DLQAQNEDQKRGIQIIQNALKAPTYTIVSNAGFDAPVVLGKLLEQDDHNFGYDAAKGEYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVEL  361
            +MVKAGIIDP+KVIRTALVDAASVS LLTTTEA +V +
Sbjct  518  NMVKAGIIDPLKVIRTALVDAASVSLLLTTTEAAIVRV  555



>ref|XP_006407158.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
 gb|ESQ48611.1| hypothetical protein EUTSA_v10020386mg [Eutrema salsugineum]
Length=572

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASE EVGE+KDRVTDALNAT+AAVEEGI+PGGGVALLYA+K L+
Sbjct  398  RLSKLSGGVAVFKVGGASETEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALD  457

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L T N DQ+ GV+I+QNALK P  TIA+NAG +G++VVGKLLEQD+ + G+DAAKG YV
Sbjct  458  NLQTQNEDQRRGVEIVQNALKAPALTIAANAGYDGSLVVGKLLEQDDCNFGFDAAKGSYV  517

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEK  346
            DMVKAGIIDPVKVI+TAL DAAS S LLTTTEA VV +  DEK
Sbjct  518  DMVKAGIIDPVKVIKTALTDAASGSLLLTTTEASVV-VNADEK  559



>gb|KCW69759.1| hypothetical protein EUGRSUZ_F03134 [Eucalyptus grandis]
Length=653

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GGASEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALLYA+K LE
Sbjct  478  RLSKLSGGVAVFKVGGASEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLYATKVLE  537

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + T N D++ GVQIIQNALK P   I SNAG +G +++GKLLEQDN ++G+DAAKG+YV
Sbjct  538  NVQTQNEDERRGVQIIQNALKAPSLAILSNAGFDGVLILGKLLEQDNFNMGFDAAKGDYV  597

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGI+DP+KV+RTALVDAASVS LL TTE  +VE   +EK+ P+
Sbjct  598  DMVKAGILDPLKVVRTALVDAASVSLLLATTEVAIVERA-NEKKPPS  643



>emb|CDY37741.1| BnaA04g19270D [Brassica napus]
Length=611

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 141/178 (79%), Gaps = 12/178 (7%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSG +AV+KIGG SE EV EK DRV +ALNATKAA+EEGIVPGGGVALLYASKELE
Sbjct  423  RLAKLSGSIAVIKIGGTSEREVSEKIDRVNNALNATKAALEEGIVPGGGVALLYASKELE  482

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL T    QK GVQIIQNALK PV+TIAS AGV+G V+V KLLE +N D+GYDAAKGEYV
Sbjct  483  KLSTNYTSQKDGVQIIQNALKIPVYTIASKAGVDGKVIVDKLLESNNPDIGYDAAKGEYV  542

Query  474  DMVKAGIIDPVKVIRTALVDAAS------------VSSLLTTTEAVVVELPKDEKETP  337
            DMVK+GIIDPVK+IRTALVDAA             VS LLTTTEAVV E+P  E  +P
Sbjct  543  DMVKSGIIDPVKMIRTALVDAARDSNGLKIYCHFFVSLLLTTTEAVVTEIPTKEDASP  600



>dbj|GAM29219.1| hypothetical protein SAMD00019534_123950 [Acytostelium subglobosum 
LB1]
Length=524

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKL+GGVAV+++GGASE EVGEKKDR+ DALNAT+AAVEEGIVPGGG ALLY+++ L 
Sbjct  352  RLAKLAGGVAVIRVGGASEVEVGEKKDRIVDALNATRAAVEEGIVPGGGTALLYSTRALR  411

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            ++   NFDQ IGV+I+++AL  P  TIA+NAG +GAVV+GKL+ + N ++G++A KG Y 
Sbjct  412  RIKMENFDQTIGVKIVRDALLVPCKTIANNAGFDGAVVIGKLMARRNVEIGFNAQKGVYT  471

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +M+KAGI+DP KV+RTALVDAASV+SL+TTTEA+VVELPK E   PA
Sbjct  472  NMIKAGIVDPTKVVRTALVDAASVASLMTTTEAMVVELPKKEDPAPA  518



>gb|ABX76300.1| heat shock protein 60 [Ageratina adenophora]
Length=526

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALK PVHTIASNAGVEGAV+VGKLLEQDN DLGYDAAKG+YV
Sbjct  459  KLQTANFDQKIGVQIIQNALKAPVHTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGQYV  518

Query  474  DMVK  463
            DMVK
Sbjct  519  DMVK  522



>ref|XP_008462350.1| PREDICTED: chaperonin CPN60-like 2, mitochondrial [Cucumis melo]
Length=576

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RL+KLSGGVAV K+GG SEAEVGE+KDRVTDALNAT+AAVEEGIVPGGGVALL+A+K L+
Sbjct  400  RLSKLSGGVAVFKVGGVSEAEVGERKDRVTDALNATRAAVEEGIVPGGGVALLHATKVLD  459

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            +L   N DQK G++I+Q+AL+ P   I SNAG +GA+VVGKLLEQD+ +LG+DAAKG YV
Sbjct  460  ELQAQNEDQKRGIEIVQHALRAPTSAIVSNAGYDGALVVGKLLEQDDRNLGFDAAKGVYV  519

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            DMVKAGI+DP+KV+RTALVDA+SVS LL T EA +VE P    + P+
Sbjct  520  DMVKAGIVDPLKVVRTALVDASSVSLLLATAEAAIVEHPNKTNKLPS  566



>gb|EWM24608.1| Chaperonin Cpn60/TCP-1 [Nannochloropsis gaditana]
Length=575

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAV+K+GGASE EV EKKDRV DALNAT+AAVE+GIVPGGG+ALL+ASK+LE
Sbjct  389  RLAKLSGGVAVIKVGGASEVEVNEKKDRVVDALNATRAAVEQGIVPGGGLALLWASKQLE  448

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
              K   +N DQ+IGV+II+ AL  PV +IA+NAGVEGAVVVG+L+++D  +LGY+A  GE
Sbjct  449  DVKAKVSNMDQRIGVEIIEKALIAPVKSIANNAGVEGAVVVGELMKKDKPELGYNAQTGE  508

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            YVDM +AGIIDP KV+RTALVDA SV++L+ TTEA+V +LPKDE + PA
Sbjct  509  YVDMFEAGIIDPTKVVRTALVDAQSVAALMITTEAMVADLPKDEGDAPA  557



>gb|EWM24609.1| Chaperonin Cpn60/TCP-1 [Nannochloropsis gaditana]
Length=574

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAV+K+GGASE EV EKKDRV DALNAT+AAVE+GIVPGGG+ALL+ASK+LE
Sbjct  388  RLAKLSGGVAVIKVGGASEVEVNEKKDRVVDALNATRAAVEQGIVPGGGLALLWASKQLE  447

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
              K   +N DQ+IGV+II+ AL  PV +IA+NAGVEGAVVVG+L+++D  +LGY+A  GE
Sbjct  448  DVKAKVSNMDQRIGVEIIEKALIAPVKSIANNAGVEGAVVVGELMKKDKPELGYNAQTGE  507

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            YVDM +AGIIDP KV+RTALVDA SV++L+ TTEA+V +LPKDE + PA
Sbjct  508  YVDMFEAGIIDPTKVVRTALVDAQSVAALMITTEAMVADLPKDEGDAPA  556



>ref|XP_002881304.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57563.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 132/164 (80%), Gaps = 24/164 (15%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGV VLKIGGA                      VEEGIVPGG VALLYASKELE
Sbjct  20   RLAKLSGGVDVLKIGGA---------------------VVEEGIVPGG-VALLYASKELE  57

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            KL TANFDQKIGVQIIQNALKT V+TIASNAGVEGAV+VGKLLEQDN DLGYDAAK EYV
Sbjct  58   KLSTANFDQKIGVQIIQNALKTHVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAK-EYV  116

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKE  343
            DMVK+GIIDP+KVIRTALVDAA VSSLLTTTEAVV E+P  EKE
Sbjct  117  DMVKSGIIDPLKVIRTALVDAA-VSSLLTTTEAVVTEIPTKEKE  159



>dbj|BAL45644.1| heat shock protein 60 [Ulva pertusa]
Length=573

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAV+EGIVPGGG ALL+AS+ L 
Sbjct  393  RLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVDEGIVPGGGAALLHASRSLS  452

Query  654  KL--PTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
             +    +N DQ++GV+I+  A++ P  T+  NAG EGAV+VGKLLE D+ + G+DAAKG+
Sbjct  453  DVLESMSNLDQRVGVEIVMRAVQMPAKTLCRNAGHEGAVIVGKLLESDDQNWGFDAAKGQ  512

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            + +MV AGIIDP+KV+RTALVDAASVSSL+TT+E +VVE P DE
Sbjct  513  FCNMVDAGIIDPLKVVRTALVDAASVSSLITTSECIVVEAPADE  556



>dbj|BAL45642.1| heat shock protein 60 [Ulva pertusa]
Length=573

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASE EVGEKKDRVTDALNATKAAV+EGIVPGGG ALL+AS+ L 
Sbjct  393  RLAKLSGGVAVLKIGGASEVEVGEKKDRVTDALNATKAAVDEGIVPGGGAALLHASRSLS  452

Query  654  KL--PTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
             +    +N DQ++GV I+  A++ P  T+  NAG EGAV+VGKLLE D+ + G+DAAKG+
Sbjct  453  DVLESMSNLDQRVGVDIVMRAVQMPAKTLCKNAGHEGAVIVGKLLESDDQNWGFDAAKGQ  512

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            + +MV AGIIDP+KV+RTALVDAASVSSL+TT+E +VVE P DE
Sbjct  513  FCNMVDAGIIDPLKVVRTALVDAASVSSLITTSECIVVEAPADE  556



>gb|EPS57724.1| hypothetical protein M569_17093, partial [Genlisea aurea]
Length=188

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEV EKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  70   RLAKLSGGVAVLKIGGASEAEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  129

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEY  478
            KL TANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKL E DN DLGYDAAKG Y
Sbjct  130  KLATANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLWESDNPDLGYDAAKGTY  188



>ref|XP_004359903.1| chaperonin 60 [Dictyostelium fasciculatum]
 gb|EGG22052.1| chaperonin 60 [Dictyostelium fasciculatum]
Length=558

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKL  GV V+++GGASE EVGEKKDR+ DALNAT+AAV EGIVPGGG ALLY+++ L+
Sbjct  386  RLAKLGSGVGVIRVGGASEVEVGEKKDRIVDALNATRAAVAEGIVPGGGTALLYSAQTLK  445

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+   NFDQ IGV+I+++AL  P  TIA+NAGVEG+VVVG+LL + + + GY+AAKG Y 
Sbjct  446  KIKMDNFDQTIGVKIVRDALMVPCKTIANNAGVEGSVVVGRLLARRDNEYGYNAAKGIYE  505

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            +M+KAGIIDP KV+RTALVDAASV+SL+TTTEA+VVELPK E+  P
Sbjct  506  NMIKAGIIDPTKVVRTALVDAASVASLMTTTEAMVVELPKVEQPMP  551



>ref|XP_007034505.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 ref|XP_007034506.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05431.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
 gb|EOY05432.1| Heat shock protein 60 isoform 2 [Theobroma cacao]
Length=516

 Score =   225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL+
Sbjct  399  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELD  458

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
            KLPTANFDQKIGVQIIQNALKTPV+TIASNAGVEGAVVVGKLLEQDN DLGYDAAKG+
Sbjct  459  KLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGQ  516



>ref|XP_008299606.1| PREDICTED: 60 kDa heat shock protein, mitochondrial isoform X2 
[Stegastes partitus]
Length=490

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLS GVAVLK+GG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL     L+
Sbjct  308  RLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPSLD  367

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN DQKIGV II+ AL+ P  TIA NAGVEG++VV K+L Q +A+LGYDA +GEYV
Sbjct  368  ALKTANSDQKIGVDIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAMQGEYV  426

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MV+ GIIDP KV+RTAL+DAA V+SLL+T EAVV E+PK+EKE PA
Sbjct  427  NMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMPA  473



>ref|XP_005848352.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
 gb|EFN56250.1| hypothetical protein CHLNCDRAFT_51922 [Chlorella variabilis]
Length=496

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLK+GGASE EV EKKDR+TDALNATKAAVEEGIVPGGG AL+YAS+ LE
Sbjct  316  RLAKLSGGVAVLKVGGASEVEVSEKKDRITDALNATKAAVEEGIVPGGGTALVYASRTLE  375

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD-NADLGYDAAKG  484
              K    NFDQK+GV+IIQ A++ P  TIA+NAG+EG V+VGKLLE++ + ++G++AA G
Sbjct  376  AVKDKCENFDQKVGVEIIQRAIRRPAKTIANNAGLEGDVIVGKLLEREGDENVGFNAAAG  435

Query  483  EYVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
             + DMV+AG+IDP+KV+RTAL+D+ASV+SLLTT E ++ E PK+E
Sbjct  436  RFEDMVRAGVIDPMKVVRTALLDSASVASLLTTAECIITEAPKNE  480



>ref|XP_011401079.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28067.1| Chaperonin CPN60, mitochondrial [Auxenochlorella protothecoides]
Length=580

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 4/171 (2%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLK+GG SE EVGE+KDR+ DALNATKAAV EGIVPGGG AL+YAS+ LE
Sbjct  395  RLAKLSGGVAVLKVGGHSEFEVGERKDRIVDALNATKAAVAEGIVPGGGTALVYASRSLE  454

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQD--NADLGYDAAK  487
              K   ANFDQ+ GV IIQ A++ P  TIA+NAG EGAV+VGKLLE+   +AD+GY+AA 
Sbjct  455  SVKDACANFDQRTGVSIIQRAIRQPAATIAANAGQEGAVIVGKLLERPEADADVGYNAAT  514

Query  486  GEYVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            GE+ D+VKAG+IDP+KV+R AL DAASV+SLLTT EAV+ E PK E  +PA
Sbjct  515  GEFEDLVKAGVIDPIKVVRVALTDAASVASLLTTAEAVIAEAPKPEGASPA  565



>gb|KDD77186.1| TCP-1/cpn60 chaperonin [Helicosporidium sp. ATCC 50920]
Length=574

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 4/166 (2%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLSGGVAVLK+GG +E EVGEKKDR+ DALNATKAAVEEGIVPGGG AL+YASK LE
Sbjct  394  RLAKLSGGVAVLKVGGHTEVEVGEKKDRIVDALNATKAAVEEGIVPGGGTALVYASKALE  453

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNAD--LGYDAAK  487
              K   ANFDQ++GVQI+Q A++ P  TIASNAG EGAV+VGKLLE++  D  +GYDAA 
Sbjct  454  AVKEAAANFDQRMGVQIVQRAIRVPTATIASNAGQEGAVIVGKLLEREEGDGNVGYDAAT  513

Query  486  GEYVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDE  349
            GE+VD+V  G+IDP+KV+R AL DAASV+SLLTT E  +V+ PK E
Sbjct  514  GEFVDLVARGVIDPIKVVRVALRDAASVASLLTTAEVCIVDAPKTE  559



>emb|CBJ29791.1| conserved unknown protein [Ectocarpus siliculosus]
Length=578

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKL  GVAV+K+GG+SE EVGEKKDR  DALNAT+AAV EGIVPGGG ALL+AS++LE
Sbjct  390  RLAKLHSGVAVIKVGGSSEVEVGEKKDRFVDALNATRAAVSEGIVPGGGSALLWASRQLE  449

Query  654  --KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGE  481
              K   AN DQKIGV+II+ AL+ PVHTIA NAGVEGAVVVG+LL+ ++   G++AA GE
Sbjct  450  ATKASCANMDQKIGVEIIEKALRMPVHTIAMNAGVEGAVVVGELLKTEDPQWGHNAATGE  509

Query  480  YVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            Y DM++AGIIDP KV+RTALVDA SV++LL T EA+V +LP  E+E PA
Sbjct  510  YCDMIQAGIIDPTKVVRTALVDAQSVAALLMTAEAMVTDLP--EEEAPA  556



>ref|XP_008299605.1| PREDICTED: 60 kDa heat shock protein, mitochondrial isoform X1 
[Stegastes partitus]
Length=575

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLS GVAVLK+GG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL     L+
Sbjct  393  RLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPSLD  452

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN DQKIGV II+ AL+ P  TIA NAGVEG++VV K+L Q +A+LGYDA +GEYV
Sbjct  453  ALKTANSDQKIGVDIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAMQGEYV  511

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            +MV+ GIIDP KV+RTAL+DAA V+SLL+T EAVV E+PK+EKE PA
Sbjct  512  NMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMPA  558



>ref|XP_003286221.1| chaperonin 60 [Dictyostelium purpureum]
 gb|EGC37251.1| chaperonin 60 [Dictyostelium purpureum]
Length=557

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLA++ GGVAV+++GGASE EVGEK+DR+TDALNAT+AAVEEGIVPGGG ALLY++  L+
Sbjct  384  RLARIGGGVAVIRVGGASEVEVGEKRDRITDALNATRAAVEEGIVPGGGTALLYSTLALK  443

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+  ANFDQ IGV+II++AL  P  TIA+NAGVEG+VV+G+LL + + + GY+A KG Y 
Sbjct  444  KVKMANFDQNIGVKIIRDALLVPCKTIANNAGVEGSVVIGRLLSKRDFEYGYNAQKGSYE  503

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            +M++AGIIDP KV+RTAL+DA+SV+SL+TTTEA+VVE  K++   P
Sbjct  504  NMIQAGIIDPTKVVRTALIDASSVASLMTTTEAMVVENKKEQSNGP  549



>ref|XP_636839.1| chaperonin 60 [Dictyostelium discoideum AX4]
 sp|Q54J97.1|CH60_DICDI RecName: Full=60 kDa heat shock protein, mitochondrial; AltName: 
Full=60 kDa chaperonin; AltName: Full=Chaperonin 60; Short=CPN60; 
AltName: Full=Heat shock protein 60; Short=HSP-60; 
Short=Hsp60; Flags: Precursor [Dictyostelium discoideum]
 gb|EAL63321.1| chaperonin 60 [Dictyostelium discoideum AX4]
Length=556

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+ GGVAV+++GGASE EVGEKKDR+TDALNATKAAVEEGIVPGGG ALLY++  L+
Sbjct  384  RLAKIGGGVAVIRVGGASEVEVGEKKDRITDALNATKAAVEEGIVPGGGTALLYSTLALK  443

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+   NFDQ IGV+I+++AL  P  TIA+NAGVEG+VV+G+LL + + + GY+A KG Y 
Sbjct  444  KIKMDNFDQTIGVKIVRDALLIPCKTIANNAGVEGSVVIGRLLSKRDFEYGYNAQKGVYE  503

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKD  352
            +M++AGIIDP KV+RTAL+DAASV+SL+TTTEA+VVE+ KD
Sbjct  504  NMIQAGIIDPTKVVRTALIDAASVASLMTTTEAMVVEIKKD  544



>gb|AAK49534.1|AF359268_1 chaperonin 60 [Dictyostelium discoideum]
 gb|AAB17277.1| chaperonin 60 [Dictyostelium discoideum]
Length=556

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAK+ GGVAV+++GGASE EVGEKKDR+TDALNATKAAVEEGIVPGGG ALLY++  L+
Sbjct  384  RLAKIGGGVAVIRVGGASEVEVGEKKDRITDALNATKAAVEEGIVPGGGTALLYSTLALK  443

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
            K+   NFDQ IGV+I+++AL  P  TIA+NAGVEG+VV+G+LL + + + GY+A KG Y 
Sbjct  444  KIKMDNFDQTIGVKIVRDALLIPCKTIANNAGVEGSVVIGRLLSKRDFEYGYNAQKGVYE  503

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKD  352
            +M++AGIIDP KV+RTAL+DAASV+SL+TTTEA+VVE+ KD
Sbjct  504  NMIQAGIIDPTKVVRTALIDAASVASLMTTTEAMVVEIKKD  544



>gb|ADM73510.1| heat shock protein [Epinephelus akaara]
Length=578

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLS GVAVLKIGG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL     L+
Sbjct  393  RLAKLSDGVAVLKIGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPSLD  452

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + TAN DQKIGV+II+ AL+ P  TIA NAGVEG++VV K+L Q +A+LGYDA +GEYV
Sbjct  453  AIQTANADQKIGVEIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAMQGEYV  511

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            +MV+ GIIDP KV+RTAL+DAA V+SLL+T EAVV E+PK+EKE P
Sbjct  512  NMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMP  557



>gb|EUC55864.1| TCP-1/cpn60 chaperonin family protein, partial [Rhizoctonia solani 
AG-3 Rhs1AP]
Length=210

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 135/171 (79%), Gaps = 6/171 (4%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKEL-  658
            RLAKLSGGVAV+K+G +SE EVGEKKDR  DALNAT+AAVEEGIVPGGGVALL AS  L 
Sbjct  25   RLAKLSGGVAVIKVGESSEVEVGEKKDRYDDALNATRAAVEEGIVPGGGVALLKASLALT  84

Query  657  -EKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQ--DNADLGYDAAK  487
             E  PTANFDQ +GV  I+NAL+ P  TI  NAG EG+VVVG++LE+  D    GYDAA+
Sbjct  85   PESAPTANFDQSLGVSAIRNALQCPARTIVENAGEEGSVVVGQILERYGDKFTWGYDAAQ  144

Query  486  GEYVDMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETPA  334
            GE+ DM+  GI+DP+KV+RTALVD + V+SLLTT+EA +VE P  E++ PA
Sbjct  145  GEFTDMIARGIVDPLKVVRTALVDTSGVASLLTTSEACIVEAP--EEKAPA  193



>ref|XP_010746058.1| PREDICTED: 60 kDa heat shock protein, mitochondrial isoform X1 
[Larimichthys crocea]
Length=544

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLS GVAVLKIGG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL     L+
Sbjct  358  RLAKLSDGVAVLKIGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPSLD  417

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             L TAN DQKIGV II+ AL+ P  TIA NAGVEG++VV K+L Q  A+LGYDA +GEYV
Sbjct  418  TLKTANADQKIGVDIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGAAELGYDAMQGEYV  476

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            +MV+ GIIDP KV+RTAL+DAA V+SLL+T EAVV E+PK+EKE P
Sbjct  477  NMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMP  522



>gb|AIS72878.1| heat shock protein 60 [Epinephelus coioides]
Length=578

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = -3

Query  834  RLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELE  655
            RLAKLS GVAVLK+GG S+ EV EKKDRVTDALNAT+AAVEEGIVPGGG ALL     L+
Sbjct  393  RLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVPGGGCALLRCIPSLD  452

Query  654  KLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNADLGYDAAKGEYV  475
             + TAN DQKIGV+II+ AL+ P  TIA NAGVEG++VV K+L Q +A+LGYDA +GEYV
Sbjct  453  AIQTANADQKIGVEIIRRALRIPAMTIAKNAGVEGSLVVEKIL-QGSAELGYDAMQGEYV  511

Query  474  DMVKAGIIDPVKVIRTALVDAASVSSLLTTTEAVVVELPKDEKETP  337
            +MV+ GIIDP KV+RTAL+DAA V+SLL+T EAVV E+PK+EKE P
Sbjct  512  NMVEKGIIDPTKVVRTALLDAAGVASLLSTAEAVVTEIPKEEKEMP  557



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290