BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7112

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP14061.1|  unnamed protein product                                188   2e-51   Coffea canephora [robusta coffee]
ref|XP_009590367.1|  PREDICTED: uncharacterized protein LOC104087...    179   5e-49   
ref|XP_009590364.1|  PREDICTED: uncharacterized protein LOC104087...    179   3e-48   Nicotiana tomentosiformis
ref|XP_009788205.1|  PREDICTED: uncharacterized protein LOC104236057    177   1e-47   Nicotiana sylvestris
ref|XP_002279619.1|  PREDICTED: uncharacterized protein LOC100251255    177   2e-47   Vitis vinifera
ref|XP_011084943.1|  PREDICTED: uncharacterized protein LOC105167077    175   1e-46   Sesamum indicum [beniseed]
ref|XP_006435675.1|  hypothetical protein CICLE_v10030877mg             173   4e-46   Citrus clementina [clementine]
gb|KDO69087.1|  hypothetical protein CISIN_1g035778mg                   172   5e-46   Citrus sinensis [apfelsine]
ref|XP_010256643.1|  PREDICTED: uncharacterized protein LOC104596...    171   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010256644.1|  PREDICTED: uncharacterized protein LOC104596...    171   2e-45   
ref|XP_009791354.1|  PREDICTED: uncharacterized protein LOC104238636    169   6e-45   Nicotiana sylvestris
ref|XP_004307614.1|  PREDICTED: uncharacterized protein LOC101294017    169   1e-44   Fragaria vesca subsp. vesca
ref|XP_007009090.1|  Uncharacterized protein TCM_042601                 168   2e-44   
ref|XP_012087916.1|  PREDICTED: uncharacterized protein LOC105646...    164   6e-44   
ref|XP_010095057.1|  hypothetical protein L484_026364                   165   2e-43   Morus notabilis
ref|XP_006575530.1|  PREDICTED: uncharacterized protein LOC102662196    156   3e-43   
ref|XP_012087908.1|  PREDICTED: uncharacterized protein LOC105646...    165   3e-43   Jatropha curcas
ref|XP_010262776.1|  PREDICTED: uncharacterized protein LOC104601212    164   5e-43   Nelumbo nucifera [Indian lotus]
gb|KJB74221.1|  hypothetical protein B456_011G280200                    161   8e-43   Gossypium raimondii
ref|XP_002315177.1|  hypothetical protein POPTR_0010s20020g             163   2e-42   
ref|XP_007218973.1|  hypothetical protein PRUPE_ppa003885mg             162   2e-42   
gb|KJB74222.1|  hypothetical protein B456_011G280200                    161   4e-42   Gossypium raimondii
gb|KJB74219.1|  hypothetical protein B456_011G280200                    161   6e-42   Gossypium raimondii
gb|KJB74220.1|  hypothetical protein B456_011G280200                    161   7e-42   Gossypium raimondii
gb|KHG10050.1|  hypothetical protein F383_04183                         160   8e-42   Gossypium arboreum [tree cotton]
ref|XP_011040621.1|  PREDICTED: uncharacterized protein LOC105136800    160   9e-42   Populus euphratica
ref|XP_008233719.1|  PREDICTED: uncharacterized protein LOC103332745    160   1e-41   Prunus mume [ume]
ref|XP_011036006.1|  PREDICTED: uncharacterized protein LOC105133628    160   1e-41   Populus euphratica
ref|XP_002526852.1|  conserved hypothetical protein                     159   4e-41   Ricinus communis
ref|XP_003616571.1|  hypothetical protein MTR_5g081880                  155   4e-41   
ref|XP_011076734.1|  PREDICTED: uncharacterized protein LOC105160912    159   5e-41   Sesamum indicum [beniseed]
ref|XP_007141796.1|  hypothetical protein PHAVU_008G2264000g            157   9e-41   Phaseolus vulgaris [French bean]
ref|XP_011656405.1|  PREDICTED: uncharacterized protein LOC101206...    157   1e-40   Cucumis sativus [cucumbers]
gb|KHN13081.1|  hypothetical protein glysoja_037523                     157   1e-40   Glycine soja [wild soybean]
ref|XP_008441436.1|  PREDICTED: flocculation protein FLO11 isofor...    156   2e-40   Cucumis melo [Oriental melon]
gb|AES99528.2|  hypothetical protein MTR_5g081880                       157   2e-40   Medicago truncatula
ref|XP_011656404.1|  PREDICTED: uncharacterized protein LOC101206...    156   2e-40   Cucumis sativus [cucumbers]
ref|XP_003616570.1|  hypothetical protein MTR_5g081880                  157   2e-40   
gb|KJB67593.1|  hypothetical protein B456_010G199100                    157   2e-40   Gossypium raimondii
gb|KJB67592.1|  hypothetical protein B456_010G199100                    157   2e-40   Gossypium raimondii
ref|XP_004138433.1|  PREDICTED: uncharacterized protein LOC101206...    157   2e-40   Cucumis sativus [cucumbers]
ref|XP_008441435.1|  PREDICTED: flocculation protein FLO11 isofor...    157   2e-40   Cucumis melo [Oriental melon]
ref|XP_008392916.1|  PREDICTED: uncharacterized protein LOC103455097    156   3e-40   Malus domestica [apple tree]
gb|KHG07854.1|  Translation initiation factor 2 subunit gamma           156   3e-40   Gossypium arboreum [tree cotton]
gb|KHN20869.1|  hypothetical protein glysoja_009177                     156   4e-40   Glycine soja [wild soybean]
ref|XP_009350971.1|  PREDICTED: uncharacterized protein LOC103942508    155   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_002312141.2|  hypothetical protein POPTR_0008s06470g             155   9e-40   
ref|XP_010690061.1|  PREDICTED: uncharacterized protein LOC104903675    154   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006355657.1|  PREDICTED: uncharacterized protein LOC102584429    153   4e-39   Solanum tuberosum [potatoes]
ref|XP_004239939.1|  PREDICTED: uncharacterized protein LOC101257080    152   7e-39   Solanum lycopersicum
ref|XP_009344495.1|  PREDICTED: uncharacterized protein LOC103936380    152   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_008382018.1|  PREDICTED: uncharacterized protein LOC103444847    150   4e-38   
ref|XP_010067499.1|  PREDICTED: uncharacterized protein LOC104454371    145   3e-36   Eucalyptus grandis [rose gum]
ref|XP_009586908.1|  PREDICTED: uncharacterized protein LOC104084692    138   1e-33   Nicotiana tomentosiformis
ref|XP_010554647.1|  PREDICTED: uncharacterized protein LOC104824...    136   2e-33   
ref|XP_010554646.1|  PREDICTED: uncharacterized protein LOC104824...    136   3e-33   
ref|XP_010554644.1|  PREDICTED: uncharacterized protein LOC104824...    136   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_008812873.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   6e-32   
ref|XP_010909151.1|  PREDICTED: uncharacterized protein LOC105035318    132   2e-31   Elaeis guineensis
ref|XP_009398858.1|  PREDICTED: uncharacterized protein LOC103983358    128   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775390.1|  PREDICTED: uncharacterized protein LOC103695761    127   9e-30   
gb|ERN09697.1|  hypothetical protein AMTR_s00029p00218490               119   4e-29   Amborella trichopoda
ref|XP_009414415.1|  PREDICTED: uncharacterized protein LOC103995537    125   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU41259.1|  hypothetical protein MIMGU_mgv1a025524mg                122   7e-28   Erythranthe guttata [common monkey flower]
ref|XP_006848117.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   7e-27   Amborella trichopoda
ref|XP_006657379.1|  PREDICTED: uncharacterized protein LOC102710797    102   2e-21   Oryza brachyantha
gb|EAZ02457.1|  hypothetical protein OsI_24562                          101   1e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001058671.1|  Os07g0100500                                     98.6    5e-20   
gb|EMS63062.1|  hypothetical protein TRIUR3_19294                     98.6    9e-20   Triticum urartu
gb|EAZ38385.1|  hypothetical protein OsJ_22762                        98.2    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EMT16986.1|  hypothetical protein F775_32915                       98.6    1e-19   
dbj|BAJ88962.1|  predicted protein                                    95.9    7e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010228491.1|  PREDICTED: uncharacterized protein LOC104581...  94.4    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_010228490.1|  PREDICTED: uncharacterized protein LOC104581...  94.4    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_010517377.1|  PREDICTED: uncharacterized protein LOC104792...  93.2    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010517376.1|  PREDICTED: uncharacterized protein LOC104792...  93.6    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010505694.1|  PREDICTED: uncharacterized protein LOC104782456  93.2    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010508941.1|  PREDICTED: uncharacterized protein LOC104785...  92.4    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010508942.1|  PREDICTED: uncharacterized protein LOC104785...  92.0    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002459191.1|  hypothetical protein SORBIDRAFT_02g000250        88.2    3e-16   Sorghum bicolor [broomcorn]
ref|XP_006293799.1|  hypothetical protein CARUB_v10022781mg           87.8    4e-16   
emb|CDY20502.1|  BnaC04g05420D                                        87.4    5e-16   Brassica napus [oilseed rape]
gb|KFK36887.1|  hypothetical protein AALP_AA4G184700                  87.4    5e-16   Arabis alpina [alpine rockcress]
ref|XP_002881685.1|  hypothetical protein ARALYDRAFT_483032           85.9    2e-15   
ref|XP_006411239.1|  hypothetical protein EUTSA_v10017559mg           85.5    2e-15   
ref|XP_009143266.1|  PREDICTED: uncharacterized protein LOC103866995  84.7    4e-15   Brassica rapa
ref|XP_004987291.1|  PREDICTED: uncharacterized protein LOC101765564  84.7    4e-15   Setaria italica
tpg|DAA59311.1|  TPA: hypothetical protein ZEAMMB73_271962            81.3    3e-14   
dbj|BAE98503.1|  hypothetical protein                                 80.5    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008651903.1|  PREDICTED: uncharacterized protein LOC103631857  81.3    6e-14   Zea mays [maize]
ref|NP_001078026.1|  uncharacterized protein                          80.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181524.1|  uncharacterized protein                             80.5    9e-14   Arabidopsis thaliana [mouse-ear cress]



>emb|CDP14061.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 112/158 (71%), Gaps = 10/158 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP +ST IPP+ PNL SPL+PEA+S+
Sbjct  520  SQQIPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPAISTAIPPMCPNLASPLVPEADSM  579

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEKSARETLR+L+NSSNQPN  LM VLPS L    +  ++L  GSRGLYSGT DID  T 
Sbjct  580  VEKSARETLRLLINSSNQPNPSLMGVLPSVLTDGNQMENILSVGSRGLYSGTRDIDAITS  639

Query  230  SVAKIS----------KRDIGEKHFVEATEMPSNSDGT  147
            SVA I           KR I   +  E  E    S G+
Sbjct  640  SVAAIGFVSSSDRFVLKRCIDRDNLEEEMEKADGSCGS  677



>ref|XP_009590367.1| PREDICTED: uncharacterized protein LOC104087557 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009590373.1| PREDICTED: uncharacterized protein LOC104087557 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009590381.1| PREDICTED: uncharacterized protein LOC104087557 isoform X2 [Nicotiana 
tomentosiformis]
Length=477

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  734  PPFSSLSTAKPSVLLAPKQPFNladvspldlppllpdplvrlpltlpVSQQIPTFTPLIC  555
            P  SS++TA+ S +L PK P  + +VS LDLPPLLPDPL+RLPL+LP SQQIP+FTPL+C
Sbjct  258  PQLSSMATARSSSILTPKLPLTVTNVSTLDLPPLLPDPLIRLPLSLPASQQIPSFTPLMC  317

Query  554  DPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARETLRML  375
            DPIVHIP IDVCSS QGYLVSAGP +S  +PPLHP++V+PLIP+ ESV+EK+ARETLR+L
Sbjct  318  DPIVHIPVIDVCSSVQGYLVSAGPSISGTLPPLHPSIVNPLIPQTESVLEKNARETLRLL  377

Query  374  MNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDV-----TTVSVAKISK  210
            +N SNQP+  L+ VLPS L S+E+  ++LG GSRGLYSG+ID+        T  +  +S+
Sbjct  378  INGSNQPSTQLIDVLPSVLSSNEQTQNMLGTGSRGLYSGSIDVGTIANGFATRGLMSLSE  437

Query  209  RDIGE  195
            R +G 
Sbjct  438  RPLGR  442



>ref|XP_009590364.1| PREDICTED: uncharacterized protein LOC104087557 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  734  PPFSSLSTAKPSVLLAPKQPFNladvspldlppllpdplvrlpltlpVSQQIPTFTPLIC  555
            P  SS++TA+ S +L PK P  + +VS LDLPPLLPDPL+RLPL+LP SQQIP+FTPL+C
Sbjct  457  PQLSSMATARSSSILTPKLPLTVTNVSTLDLPPLLPDPLIRLPLSLPASQQIPSFTPLMC  516

Query  554  DPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARETLRML  375
            DPIVHIP IDVCSS QGYLVSAGP +S  +PPLHP++V+PLIP+ ESV+EK+ARETLR+L
Sbjct  517  DPIVHIPVIDVCSSVQGYLVSAGPSISGTLPPLHPSIVNPLIPQTESVLEKNARETLRLL  576

Query  374  MNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDV-----TTVSVAKISK  210
            +N SNQP+  L+ VLPS L S+E+  ++LG GSRGLYSG+ID+        T  +  +S+
Sbjct  577  INGSNQPSTQLIDVLPSVLSSNEQTQNMLGTGSRGLYSGSIDVGTIANGFATRGLMSLSE  636

Query  209  RDIGE  195
            R +G 
Sbjct  637  RPLGR  641



>ref|XP_009788205.1| PREDICTED: uncharacterized protein LOC104236057 [Nicotiana sylvestris]
Length=676

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 5/137 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIP+FTPL+CDPIVHIP IDVCSSGQGYLVS GP +S  +PPLHPN+V+PLIP+ ESV
Sbjct  505  SQQIPSFTPLMCDPIVHIPVIDVCSSGQGYLVSTGPAISGTLPPLHPNIVNPLIPQTESV  564

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDV---  240
            +EK+ARETLR+L+N SNQP+  L+ VLPS L SSE+  ++LG GSRGLYSG+ID+     
Sbjct  565  LEKNARETLRLLINGSNQPSTQLIDVLPSVLSSSEQTQNMLGAGSRGLYSGSIDVGTIAN  624

Query  239  --TTVSVAKISKRDIGE  195
               T  +  +S+R +G 
Sbjct  625  GFATRGLMSLSERPLGR  641



>ref|XP_002279619.1| PREDICTED: uncharacterized protein LOC100251255 [Vitis vinifera]
Length=708

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQI TFTPL+CDPIVHIP IDVCSSGQGYLVSAGP +ST IPPLHP LV+PLIPE ES 
Sbjct  533  SQQIATFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPTISTTIPPLHPKLVNPLIPETESA  592

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID----  243
            VEK ARETLR+L+NSS+Q N  LM VLP+ L +++EK S+L  GSRGLY+GT D+D    
Sbjct  593  VEKGARETLRLLINSSSQNNPQLMDVLPAVLTNADEKHSLLVVGSRGLYNGTRDVDAIAN  652

Query  242  -VTTVSVAKISKRDIG  198
             +  +S+  +S R IG
Sbjct  653  SIVGMSLVSLSGRSIG  668



>ref|XP_011084943.1| PREDICTED: uncharacterized protein LOC105167077 [Sesamum indicum]
Length=684

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSG-QGYLVSAGPGMSTGIPPLHPNLVSPLIPEAES  414
            SQQIPTFTPLICDPIVHIP IDVCSSG QGYLVSAGP +ST IPPL+ + V PL+P AES
Sbjct  515  SQQIPTFTPLICDPIVHIPVIDVCSSGGQGYLVSAGPAISTSIPPLNQDFVDPLLPNAES  574

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VVEK ARETLRML++SSNQ    L+ VLPS L SS +K +VL  GSRGLYSGTID+D   
Sbjct  575  VVEKGARETLRMLISSSNQSTPQLLEVLPSVLSSSNDKQNVLAAGSRGLYSGTIDVDAIN  634

Query  233  VSVAKISKRDIGEKHFV  183
             S++ +    + EK  +
Sbjct  635  NSLSTMGLVFLSEKSIM  651



>ref|XP_006435675.1| hypothetical protein CICLE_v10030877mg [Citrus clementina]
 ref|XP_006486368.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like [Citrus 
sinensis]
 gb|ESR48915.1| hypothetical protein CICLE_v10030877mg [Citrus clementina]
Length=685

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVH+P IDVCSSGQGYLVSAGP +ST IPPLH  LV+PLIPE +SV
Sbjct  517  SQQIPTFTPLICDPIVHVPVIDVCSSGQGYLVSAGPAISTTIPPLHAKLVNPLIPEGDSV  576

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VE  ARETLR+L++SS+Q N  LM VLP+ L S+ E  S+   GSRGLY GT D+D    
Sbjct  577  VENGARETLRLLISSSSQTNPQLMGVLPAVLTSANETQSMFVTGSRGLYCGTRDVDAIGK  636

Query  230  SVAKIS  213
            S+A +S
Sbjct  637  SIALVS  642



>gb|KDO69087.1| hypothetical protein CISIN_1g035778mg, partial [Citrus sinensis]
Length=672

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVH+P IDVCSSGQGYLVSAGP +ST IPPLH  LV+PLIPE +SV
Sbjct  517  SQQIPTFTPLICDPIVHVPVIDVCSSGQGYLVSAGPAISTTIPPLHAKLVNPLIPEGDSV  576

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VE  ARETLR+L++SS+Q N  LM VLP+ L S+ E  S+   GSRGLY GT D+D    
Sbjct  577  VENGARETLRLLISSSSQTNPQLMGVLPAVLTSANETQSMFVTGSRGLYCGTRDVDAIGK  636

Query  230  SVAKIS  213
            S+A +S
Sbjct  637  SIALVS  642



>ref|XP_010256643.1| PREDICTED: uncharacterized protein LOC104596991 isoform X1 [Nelumbo 
nucifera]
Length=717

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQ+PTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP +ST IPPLHP LV+PLIPE ESV
Sbjct  553  SQQVPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPAISTTIPPLHPKLVNPLIPETESV  612

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI---DV  240
            VEK ARETLR+L+ SS Q N  LM+VLP+ L S+++K ++L  GSRGLYSG +D+    +
Sbjct  613  VEKGARETLRLLI-SSTQTNPQLMNVLPAALTSADDKCTMLVAGSRGLYSGDVDVVAKGI  671

Query  239  TTVSVAKISKRDIGEKHF  186
              V +  +  R  G K +
Sbjct  672  AAVGLVPLPGRGNGAKRY  689



>ref|XP_010256644.1| PREDICTED: uncharacterized protein LOC104596991 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010256647.1| PREDICTED: uncharacterized protein LOC104596991 isoform X2 [Nelumbo 
nucifera]
Length=690

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQ+PTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP +ST IPPLHP LV+PLIPE ESV
Sbjct  526  SQQVPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPAISTTIPPLHPKLVNPLIPETESV  585

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI---DV  240
            VEK ARETLR+L+ SS Q N  LM+VLP+ L S+++K ++L  GSRGLYSG +D+    +
Sbjct  586  VEKGARETLRLLI-SSTQTNPQLMNVLPAALTSADDKCTMLVAGSRGLYSGDVDVVAKGI  644

Query  239  TTVSVAKISKRDIGEKHF  186
              V +  +  R  G K +
Sbjct  645  AAVGLVPLPGRGNGAKRY  662



>ref|XP_009791354.1| PREDICTED: uncharacterized protein LOC104238636 [Nicotiana sylvestris]
Length=644

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQI +FTP +CDPIVHIP IDVCSSGQGYLVSAGP +S  IP LHPNLV+PL+PE +SV
Sbjct  469  SQQISSFTPFVCDPIVHIPVIDVCSSGQGYLVSAGPAISGTIPQLHPNLVNPLLPETDSV  528

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID  243
             EKSARETLR+L+N+SNQP+  L+ +LP  L  SEE  ++L  GSRGLYSGTIDID
Sbjct  529  AEKSARETLRLLINNSNQPSPQLIDLLPPVLSRSEETQNMLVSGSRGLYSGTIDID  584



>ref|XP_004307614.1| PREDICTED: uncharacterized protein LOC101294017 [Fragaria vesca 
subsp. vesca]
Length=734

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTF PLICDPIVHIP ID+CSSGQGYLVSAGP +STGIPPLH NL++PLIP+ +S+
Sbjct  525  SQQIPTFNPLICDPIVHIPVIDICSSGQGYLVSAGPAISTGIPPLHSNLMNPLIPQTDSM  584

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            +E  ARETL R+L++ S Q ++PLM VLP+   + +E  ++L  GSRGLYSGT D+DV  
Sbjct  585  LENGARETLRRLLISGSTQSSSPLMDVLPAMFTNGDENRNMLVAGSRGLYSGTSDVDVIA  644

Query  233  VSVAKIS  213
             S+A +S
Sbjct  645  NSIAAMS  651



>ref|XP_007009090.1| Uncharacterized protein TCM_042601 [Theobroma cacao]
 gb|EOY17900.1| Uncharacterized protein TCM_042601 [Theobroma cacao]
Length=737

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +ST I PLHP LV+PL+P+ +S+
Sbjct  556  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTISTTISPLHPKLVNPLLPDTDSM  615

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++ S Q N PL+ V P+ L +++E   +L  GSRGLYSGT DI   T 
Sbjct  616  VEKGARETLRLLISGSTQNNPPLIDVFPAVLTNADENKGILVAGSRGLYSGTRDISAITD  675

Query  230  SVAKIS  213
             +A ++
Sbjct  676  GIAAMT  681



>ref|XP_012087916.1| PREDICTED: uncharacterized protein LOC105646630 isoform X2 [Jatropha 
curcas]
 gb|KDP44827.1| hypothetical protein JCGZ_01327 [Jatropha curcas]
Length=453

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHP LV+PLIPE +S+
Sbjct  275  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPAISSSIPPLHPQLVNPLIPETDSM  334

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            +EK ARETLR+L++SS Q N  LM VLP+ L ++++K  +   GSRGLY+G+ D++    
Sbjct  335  LEKGARETLRLLISSSAQGNPQLMDVLPAVL-TNDDKKGLHATGSRGLYAGSSDVNAIAS  393

Query  230  SVAKIS  213
            S+A  S
Sbjct  394  SMAAFS  399



>ref|XP_010095057.1| hypothetical protein L484_026364 [Morus notabilis]
 gb|EXB58163.1| hypothetical protein L484_026364 [Morus notabilis]
Length=698

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            +QQIPTFTPLICD IVHIP I VCSSG GYLVSAGP M T IPPLHPNLV+PLIPE ES+
Sbjct  519  AQQIPTFTPLICDSIVHIPVIGVCSSGPGYLVSAGPTMPTTIPPLHPNLVNPLIPETESM  578

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++ S+  N PLM  LP+ L  ++E  S++  GSRGLY GT D+DV   
Sbjct  579  VEKGARETLRLLISGSSPTNPPLMDALPAVLTKADENPSMIVAGSRGLYGGTRDVDVIAS  638

Query  230  SVAKI  216
            S+A I
Sbjct  639  SIAAI  643



>ref|XP_006575530.1| PREDICTED: uncharacterized protein LOC102662196 [Glycine max]
Length=194

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MS  IPPLHPNLV PLIPE+++V
Sbjct  18   SQQIPTFTPLMCDPIVHVPVIDVCSSGQGYLVSAGPAMSPSIPPLHPNLVKPLIPESDAV  77

Query  410  VEKSARETLRMLMNSSNQPNAPLM-SVLPSFLPSSEEKL-SVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N  +M   LP+ L + +EK  ++L  GSRGLY+GT DI+  
Sbjct  78   V-KGARETLRLLLSGSSQGNQQMMRDTLPAILTNPDEKQNNILVAGSRGLYTGTRDINAI  136

Query  236  TVSVAKI  216
              S+A +
Sbjct  137  ANSIAAM  143



>ref|XP_012087908.1| PREDICTED: uncharacterized protein LOC105646630 isoform X1 [Jatropha 
curcas]
Length=689

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHP LV+PLIPE +S+
Sbjct  511  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPAISSSIPPLHPQLVNPLIPETDSM  570

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            +EK ARETLR+L++SS Q N  LM VLP+ L ++++K  +   GSRGLY+G+ D++    
Sbjct  571  LEKGARETLRLLISSSAQGNPQLMDVLPAVL-TNDDKKGLHATGSRGLYAGSSDVNAIAS  629

Query  230  SVAKIS  213
            S+A  S
Sbjct  630  SMAAFS  635



>ref|XP_010262776.1| PREDICTED: uncharacterized protein LOC104601212 [Nelumbo nucifera]
Length=705

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAG  +ST IPPLHP  V+PLIPE ES 
Sbjct  541  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGAAISTTIPPLHPKFVNPLIPETESA  600

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L+ SS Q N  LM VLP+ L S+++  ++L  GS  LYSGT D+D    
Sbjct  601  VEKGARETLRLLI-SSTQTNPQLMDVLPAVLNSTDKMHTMLVAGS-CLYSGTRDVDAVAN  658

Query  230  SVAKI------SKRDIGEKH  189
            S+A +       +RD  EKH
Sbjct  659  SIAAMGLVPPSDRRDNEEKH  678



>gb|KJB74221.1| hypothetical protein B456_011G280200 [Gossypium raimondii]
Length=436

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 14/143 (10%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHPNLV+PL+P+  +S
Sbjct  271  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTISSSIPPLHPNLVNPLLPDTTDS  330

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID---  243
            VVEK ARETLR+L++ S   N PL+ VLP+      +K S+L  GSRGLYSGT DI    
Sbjct  331  VVEKGARETLRLLISGSTHSNPPLIDVLPAV-----DKKSILVTGSRGLYSGTRDISALA  385

Query  242  --VTTVSVAKISKRDIGE---KH  189
              + TVS A +S   + +   KH
Sbjct  386  SGIATVSFATLSSTSMSDSFTKH  408



>ref|XP_002315177.1| hypothetical protein POPTR_0010s20020g [Populus trichocarpa]
 gb|EEF01348.1| hypothetical protein POPTR_0010s20020g [Populus trichocarpa]
Length=692

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 7/137 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP ++  IPPLHP LV+PLIPE AES
Sbjct  510  SQQIPTFTPLMCDPIVHIPLIDVCSSGQGYLVSAGPTIAGPIPPLHPRLVNPLIPETAES  569

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID---  243
            VVEK ARETLR+L++S++Q N+  M+VLP  L ++++  S+L GGS  LY+GT D+D   
Sbjct  570  VVEKGARETLRLLISSTSQTNSQFMNVLPVVLTNTDQT-SILAGGSWSLYTGTRDVDAIA  628

Query  242  --VTTVSVAKISKRDIG  198
              + T+ +  +S+  IG
Sbjct  629  NRIATMGLVSLSESSIG  645



>ref|XP_007218973.1| hypothetical protein PRUPE_ppa003885mg [Prunus persica]
 gb|EMJ20172.1| hypothetical protein PRUPE_ppa003885mg [Prunus persica]
Length=542

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP ID+CSSGQGYLVSAGP +ST I PLHP LVS  IPE +S+
Sbjct  363  SQQIPTFTPLMCDPIVHIPVIDICSSGQGYLVSAGPAISTAISPLHPKLVS--IPETDSM  420

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VEK ARETL R+LM+ S Q  + L+ VLP+ L ++ E  ++L GGSRGLYSGT D+DV  
Sbjct  421  VEKGARETLRRLLMSGSTQSGSQLIDVLPAMLSNAHENRNLLVGGSRGLYSGTRDVDVIA  480

Query  233  VSVAKI  216
             S+A +
Sbjct  481  NSIAAM  486



>gb|KJB74222.1| hypothetical protein B456_011G280200 [Gossypium raimondii]
Length=548

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 6/127 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHPNLV+PL+P+  +S
Sbjct  383  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTISSSIPPLHPNLVNPLLPDTTDS  442

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VVEK ARETLR+L++ S   N PL+ VLP+      +K S+L  GSRGLYSGT DI    
Sbjct  443  VVEKGARETLRLLISGSTHSNPPLIDVLPAV-----DKKSILVTGSRGLYSGTRDISALA  497

Query  233  VSVAKIS  213
              +A +S
Sbjct  498  SGIATVS  504



>gb|KJB74219.1| hypothetical protein B456_011G280200 [Gossypium raimondii]
Length=655

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 6/127 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHPNLV+PL+P+  +S
Sbjct  490  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTISSSIPPLHPNLVNPLLPDTTDS  549

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VVEK ARETLR+L++ S   N PL+ VLP+      +K S+L  GSRGLYSGT DI    
Sbjct  550  VVEKGARETLRLLISGSTHSNPPLIDVLPAV-----DKKSILVTGSRGLYSGTRDISALA  604

Query  233  VSVAKIS  213
              +A +S
Sbjct  605  SGIATVS  611



>gb|KJB74220.1| hypothetical protein B456_011G280200 [Gossypium raimondii]
Length=685

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 6/127 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +S+ IPPLHPNLV+PL+P+  +S
Sbjct  520  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTISSSIPPLHPNLVNPLLPDTTDS  579

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VVEK ARETLR+L++ S   N PL+ VLP+      +K S+L  GSRGLYSGT DI    
Sbjct  580  VVEKGARETLRLLISGSTHSNPPLIDVLPAV-----DKKSILVTGSRGLYSGTRDISALA  634

Query  233  VSVAKIS  213
              +A +S
Sbjct  635  SGIATVS  641



>gb|KHG10050.1| hypothetical protein F383_04183 [Gossypium arboreum]
Length=685

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 97/127 (76%), Gaps = 6/127 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAG  +ST IPPLHPNLV+PL+P+  +S
Sbjct  520  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGATISTSIPPLHPNLVNPLLPDTTDS  579

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VVEK ARETLR+L++ S Q N PL+ VLP+      +K  +L  GSRGLYSGT DI    
Sbjct  580  VVEKGARETLRLLISGSTQSNPPLIDVLPAV-----DKKGILVAGSRGLYSGTRDISAIA  634

Query  233  VSVAKIS  213
              +A +S
Sbjct  635  GGIATVS  641



>ref|XP_011040621.1| PREDICTED: uncharacterized protein LOC105136800 [Populus euphratica]
Length=687

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 11/154 (7%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP ++T IPPLH  LV+PLIP  A+S
Sbjct  506  SQQIPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPTIATTIPPLHTKLVNPLIPNTADS  565

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID---  243
            VVEK ARETLR+L++S++Q N   M VLP+ L +S++K S+L  GS  LYSGT D+D   
Sbjct  566  VVEKGARETLRLLISSTSQTNPQFMDVLPAVLTNSDKK-SMLTTGSWSLYSGTRDVDAIA  624

Query  242  --VTTVSVAKISKRDIGEKHFVEATEMPSNSDGT  147
              + T+ +   S+  IG+       EM  + D T
Sbjct  625  NRIATMGLVSFSEYSIGDS----VAEMSGSCDNT  654



>ref|XP_008233719.1| PREDICTED: uncharacterized protein LOC103332745 [Prunus mume]
Length=702

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP ID+CSSGQGYLVSAGP +ST I PLHP LV+  IPE +S+
Sbjct  523  SQQIPTFTPLMCDPIVHIPVIDICSSGQGYLVSAGPAISTAISPLHPKLVN--IPETDSM  580

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            VEK ARETL R+LM+ S Q  + L+ VLP+ L ++ E  + L GGSRGLYSGT D+DV  
Sbjct  581  VEKGARETLRRLLMSGSTQSGSQLIDVLPAMLSNAHENRNTLVGGSRGLYSGTRDVDVIA  640

Query  233  VSVAKI  216
             S+A +
Sbjct  641  NSIAAM  646



>ref|XP_011036006.1| PREDICTED: uncharacterized protein LOC105133628 [Populus euphratica]
Length=692

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPL+CD IVHIP IDVCSSGQGYLVSAGP +++ IPPLHP LV+PLIPE A+S
Sbjct  510  SQQIPTFTPLMCDSIVHIPLIDVCSSGQGYLVSAGPTIASAIPPLHPRLVNPLIPETADS  569

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID---  243
            VVEK ARETLR+L++S++Q N+  M+VLP  L ++++  S+L  GS  LYSGT D+D   
Sbjct  570  VVEKGARETLRLLISSTSQTNSQFMNVLPVVLTNTDQT-SILASGSWSLYSGTRDVDAIA  628

Query  242  --VTTVSVAKISKRDIG  198
              + T+ +  +S+  IG
Sbjct  629  NRIATMGLVSLSESSIG  645



>ref|XP_002526852.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35483.1| conserved hypothetical protein [Ricinus communis]
Length=679

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            +QQ+PTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP +S  IPPLHP  V+PLI E +++
Sbjct  498  AQQVPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPAISGTIPPLHPKFVNPLITETDTM  557

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID----  243
            +EK ARETLR+L++SS Q N  L++VLP+ L ++++K  +   GSRGLYSG+ D++    
Sbjct  558  LEKGARETLRLLISSSTQGNPQLLNVLPAVLTNTQDKQGMHAVGSRGLYSGSSDVNAIVN  617

Query  242  -VTTVSVAKISKRDIGE  195
             + T+ +  +S+  IG+
Sbjct  618  SMATIGLVSLSQSSIGD  634



>ref|XP_003616571.1| hypothetical protein MTR_5g081880 [Medicago truncatula]
Length=380

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MST IPPLHPNLV+PLI E+++V
Sbjct  179  SQQIPTFTPLMCDPIVHVPIIDVCSSGQGYLVSAGPAMSTSIPPLHPNLVNPLISESDAV  238

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPS-SEEKLSVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N   +M+ LP+ L +  E + +VL  GSRGLY+GT DI+V 
Sbjct  239  V-KGARETLRLLISGSSQGNQQVMMNPLPAILTNLDENQNNVLVAGSRGLYTGTRDINVI  297

Query  236  TVSVAKI  216
              S+A +
Sbjct  298  ANSIAAM  304



>ref|XP_011076734.1| PREDICTED: uncharacterized protein LOC105160912 [Sesamum indicum]
Length=675

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSG GYLVSAGP     IPP++ NLV   +P+AE  
Sbjct  509  SQQIPTFTPLICDPIVHIPVIDVCSSGPGYLVSAGPAR---IPPVNSNLVDRRLPKAECT  565

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            +E+SARETLRML+ SSNQP++ L+ VLPS L SS +K ++L  GSRGLYSG  DID T+ 
Sbjct  566  LEQSARETLRMLIGSSNQPSSQLLEVLPSVLSSSNDKQNILVTGSRGLYSGIRDIDATSS  625

Query  230  SVAKI  216
            S+  +
Sbjct  626  SLTTM  630



>ref|XP_007141796.1| hypothetical protein PHAVU_008G2264000g, partial [Phaseolus vulgaris]
 gb|ESW13790.1| hypothetical protein PHAVU_008G2264000g, partial [Phaseolus vulgaris]
Length=525

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 109/166 (66%), Gaps = 20/166 (12%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP IDVCSSGQGY VSAGP MST IPPLHPNLV PLIPE+++V
Sbjct  352  SQQIPTFTPLMCDPIVHIPVIDVCSSGQGYFVSAGPAMSTSIPPLHPNLVKPLIPESDAV  411

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKL-SVLGGGSRGLYSGTIDIDVTT  234
            V K ARETLR+LM+ S+Q        LP+ L +  EK  ++L  GSRGLY+GT DI+V  
Sbjct  412  V-KGARETLRLLMSGSSQNQ---QMTLPAILTNPNEKQNNILVAGSRGLYTGTRDINVFA  467

Query  233  --------VSVAKISKRDIGEKHFV-------EATEMPSNSDGTMF  141
                    VS++ +SK D G    V       E +   SN  G  F
Sbjct  468  NSIAAMGLVSLSAVSKEDSGSYSEVSDNYGIMEESGTKSNDSGGAF  513



>ref|XP_011656405.1| PREDICTED: uncharacterized protein LOC101206438 isoform X3 [Cucumis 
sativus]
Length=525

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL CDPIVH+P IDVCSSG GYLVSAGP +ST IPPLHP LV+P+IP  +  
Sbjct  347  SQQIPTFTPLFCDPIVHVPVIDVCSSGPGYLVSAGPTISTSIPPLHPKLVNPMIPTTD--  404

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++SS+Q N+ LM+VLP  L  SE   S+   GSRGLYS   DID    
Sbjct  405  VEKDARETLRLLISSSSQGNSQLMNVLPVVLTDSEANQSLFLTGSRGLYSSARDIDAIAS  464

Query  230  SVAKISKRDIGEKHFVEATEMPSNSDG  150
            S+A +    +  +   E      N DG
Sbjct  465  SIASLGIVSLSGQSTSEHVGKRFNVDG  491



>gb|KHN13081.1| hypothetical protein glysoja_037523 [Glycine soja]
Length=683

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MS  IPPLHPNLV PLIPE+++V
Sbjct  507  SQQIPTFTPLMCDPIVHVPVIDVCSSGQGYLVSAGPAMSPSIPPLHPNLVKPLIPESDAV  566

Query  410  VEKSARETLRMLMNSSNQPNAPLM-SVLPSFLPSSEEKL-SVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N  +M   LP+ L + +EK  ++L  GSRGLY+GT DI+  
Sbjct  567  V-KGARETLRLLLSGSSQGNQQMMRDTLPAILTNPDEKQNNILVAGSRGLYTGTRDINAI  625

Query  236  TVSVAKI  216
              S+A +
Sbjct  626  ANSIAAM  632



>ref|XP_008441436.1| PREDICTED: flocculation protein FLO11 isoform X2 [Cucumis melo]
 ref|XP_008441437.1| PREDICTED: flocculation protein FLO11 isoform X2 [Cucumis melo]
Length=573

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL CDPIVH+P IDVCSSG GYLVSAGP +ST IPPLHP LV+P+IP  +  
Sbjct  397  SQQIPTFTPLFCDPIVHVPVIDVCSSGPGYLVSAGPTISTSIPPLHPKLVNPMIPATD--  454

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++SS+Q N+ LM+VLP  L  SE   S+   GSRGLYS   DID    
Sbjct  455  VEKDARETLRLLISSSSQGNSQLMNVLPVVLTDSEANQSLFLTGSRGLYSSARDIDAIAS  514

Query  230  SVAKISKRDIGEKHFVEATEMPSNSDG  150
            S+A +    +  +   E      N DG
Sbjct  515  SIASLGIVSLSGQSTSEHVGKRFNVDG  541



>gb|AES99528.2| hypothetical protein MTR_5g081880 [Medicago truncatula]
Length=693

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MST IPPLHPNLV+PLI E+++V
Sbjct  518  SQQIPTFTPLMCDPIVHVPIIDVCSSGQGYLVSAGPAMSTSIPPLHPNLVNPLISESDAV  577

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPS-SEEKLSVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N   +M+ LP+ L +  E + +VL  GSRGLY+GT DI+V 
Sbjct  578  V-KGARETLRLLISGSSQGNQQVMMNPLPAILTNLDENQNNVLVAGSRGLYTGTRDINVI  636

Query  236  TVSVAKI  216
              S+A +
Sbjct  637  ANSIAAM  643



>ref|XP_011656404.1| PREDICTED: uncharacterized protein LOC101206438 isoform X2 [Cucumis 
sativus]
Length=575

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL CDPIVH+P IDVCSSG GYLVSAGP +ST IPPLHP LV+P+IP  +  
Sbjct  397  SQQIPTFTPLFCDPIVHVPVIDVCSSGPGYLVSAGPTISTSIPPLHPKLVNPMIPTTD--  454

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++SS+Q N+ LM+VLP  L  SE   S+   GSRGLYS   DID    
Sbjct  455  VEKDARETLRLLISSSSQGNSQLMNVLPVVLTDSEANQSLFLTGSRGLYSSARDIDAIAS  514

Query  230  SVAKISKRDIGEKHFVEATEMPSNSDG  150
            S+A +    +  +   E      N DG
Sbjct  515  SIASLGIVSLSGQSTSEHVGKRFNVDG  541



>ref|XP_003616570.1| hypothetical protein MTR_5g081880 [Medicago truncatula]
Length=719

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MST IPPLHPNLV+PLI E+++V
Sbjct  518  SQQIPTFTPLMCDPIVHVPIIDVCSSGQGYLVSAGPAMSTSIPPLHPNLVNPLISESDAV  577

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPS-SEEKLSVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N   +M+ LP+ L +  E + +VL  GSRGLY+GT DI+V 
Sbjct  578  V-KGARETLRLLISGSSQGNQQVMMNPLPAILTNLDENQNNVLVAGSRGLYTGTRDINVI  636

Query  236  TVSVAKI  216
              S+A +
Sbjct  637  ANSIAAM  643



>gb|KJB67593.1| hypothetical protein B456_010G199100 [Gossypium raimondii]
Length=656

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICD IVHIP IDVCSSGQGYLVSAGP +ST IPPLHPNLV+      E++
Sbjct  481  SQQIPTFTPLICDSIVHIPVIDVCSSGQGYLVSAGPTLSTAIPPLHPNLVN-----TETM  535

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            VEK ARETLR+L++ S Q N PL+ VLP+ L +++EK  +   GSRGLYSGT D+
Sbjct  536  VEKGARETLRLLISGSTQSNPPLIDVLPAVLTNADEKKGIFVAGSRGLYSGTRDV  590



>gb|KJB67592.1| hypothetical protein B456_010G199100 [Gossypium raimondii]
Length=691

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICD IVHIP IDVCSSGQGYLVSAGP +ST IPPLHPNLV+      E++
Sbjct  516  SQQIPTFTPLICDSIVHIPVIDVCSSGQGYLVSAGPTLSTAIPPLHPNLVN-----TETM  570

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            VEK ARETLR+L++ S Q N PL+ VLP+ L +++EK  +   GSRGLYSGT D+
Sbjct  571  VEKGARETLRLLISGSTQSNPPLIDVLPAVLTNADEKKGIFVAGSRGLYSGTRDV  625



>ref|XP_004138433.1| PREDICTED: uncharacterized protein LOC101206438 isoform X1 [Cucumis 
sativus]
 gb|KGN45771.1| hypothetical protein Csa_6G009500 [Cucumis sativus]
Length=695

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL CDPIVH+P IDVCSSG GYLVSAGP +ST IPPLHP LV+P+IP  +  
Sbjct  517  SQQIPTFTPLFCDPIVHVPVIDVCSSGPGYLVSAGPTISTSIPPLHPKLVNPMIPTTD--  574

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++SS+Q N+ LM+VLP  L  SE   S+   GSRGLYS   DID    
Sbjct  575  VEKDARETLRLLISSSSQGNSQLMNVLPVVLTDSEANQSLFLTGSRGLYSSARDIDAIAS  634

Query  230  SVAKI  216
            S+A +
Sbjct  635  SIASL  639



>ref|XP_008441435.1| PREDICTED: flocculation protein FLO11 isoform X1 [Cucumis melo]
Length=693

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL CDPIVH+P IDVCSSG GYLVSAGP +ST IPPLHP LV+P+IP  +  
Sbjct  517  SQQIPTFTPLFCDPIVHVPVIDVCSSGPGYLVSAGPTISTSIPPLHPKLVNPMIPATD--  574

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            VEK ARETLR+L++SS+Q N+ LM+VLP  L  SE   S+   GSRGLYS   DID    
Sbjct  575  VEKDARETLRLLISSSSQGNSQLMNVLPVVLTDSEANQSLFLTGSRGLYSSARDIDAIAS  634

Query  230  SVAKI  216
            S+A +
Sbjct  635  SIASL  639



>ref|XP_008392916.1| PREDICTED: uncharacterized protein LOC103455097 [Malus domestica]
Length=698

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP ID+CSSGQGYLVSAGP +STGI PLH  L +  IPE +S+
Sbjct  519  SQQIPTFTPLMCDPIVHIPVIDICSSGQGYLVSAGPTISTGISPLHSKLAN--IPETDSM  576

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            +EK ARETLR+L++ S Q ++ L+ VLP+ L ++ E  ++L  GSRGLYSGT D+DV   
Sbjct  577  LEKGARETLRLLISGSTQNSSQLIDVLPAMLSNAHENRNMLVTGSRGLYSGTRDVDVIAN  636

Query  230  SVAKI  216
            S+A +
Sbjct  637  SIAAM  641



>gb|KHG07854.1| Translation initiation factor 2 subunit gamma [Gossypium arboreum]
Length=691

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPLICDPIVHIP IDVCSSGQGYLVSAGP +ST IPPLH NLV+      E++
Sbjct  516  SQQIPTFTPLICDPIVHIPVIDVCSSGQGYLVSAGPTLSTTIPPLHANLVN-----TETM  570

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            VEK ARETLR+L++ S Q N PL+ VLP+ L +++EK  +   GSRGLYSGT D+
Sbjct  571  VEKGARETLRLLISGSTQSNPPLIDVLPAVLTNADEKKGIFVAGSRGLYSGTRDV  625



>gb|KHN20869.1| hypothetical protein glysoja_009177 [Glycine soja]
Length=685

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVH+P IDVCSSGQGYLVSAGP MS  IPPLHPNLV PLIPE+++V
Sbjct  507  SQQIPTFTPLMCDPIVHVPVIDVCSSGQGYLVSAGPAMSPSIPPLHPNLVKPLIPESDAV  566

Query  410  VEKSARETLRMLMNSSNQPNAPLM-SVLPSFLPS-SEEKLSVLGGGSRGLYSGTIDIDVT  237
            V K ARETLR+L++ S+Q N  +M   LP+ L +  E + ++L  GSRGLY+GT DI+  
Sbjct  567  V-KGARETLRLLLSGSSQGNQQMMRDTLPAILTNPDENQNNILVAGSRGLYTGTRDINAI  625

Query  236  TVSVAKI  216
              S+A +
Sbjct  626  ANSIAAM  632



>ref|XP_009350971.1| PREDICTED: uncharacterized protein LOC103942508 [Pyrus x bretschneideri]
Length=698

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CDPIVHIP ID+CSSGQGYLVSAGP +ST I PLH  L +  IPE +S+
Sbjct  519  SQQIPTFTPLMCDPIVHIPVIDICSSGQGYLVSAGPTISTAISPLHSKLAN--IPETDSM  576

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            +EK ARETLR+L++ S Q ++ L+ VLP+ L ++ E  ++L  GSRGLYSGT D+DV   
Sbjct  577  LEKGARETLRLLISGSTQNSSQLIDVLPAMLSNAHENRNMLVAGSRGLYSGTRDVDVIAK  636

Query  230  SVAKI  216
            S+A +
Sbjct  637  SIAAM  641



>ref|XP_002312141.2| hypothetical protein POPTR_0008s06470g [Populus trichocarpa]
 gb|EEE89508.2| hypothetical protein POPTR_0008s06470g [Populus trichocarpa]
Length=688

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (71%), Gaps = 11/154 (7%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPE-AES  414
            SQQIPTFTPL+CDPIVHIP IDVCSSGQGYLVSAGP ++T IPPLH  LV+PLIP  A+S
Sbjct  506  SQQIPTFTPLMCDPIVHIPVIDVCSSGQGYLVSAGPTIATTIPPLHTKLVNPLIPNTADS  565

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDID---  243
             VEK ARETLR+L++S++Q N   M VLP+ L ++++K S+L  GS  LYSGT  +D   
Sbjct  566  AVEKGARETLRLLISSTSQTNPQFMDVLPAVLTNTDKK-SMLTTGSWSLYSGTRGVDAIA  624

Query  242  --VTTVSVAKISKRDIGEKHFVEATEMPSNSDGT  147
              + T+ +  +S+  IG+       EM  + D T
Sbjct  625  NRIATMGLVSLSEYSIGD----SVAEMSGSCDNT  654



>ref|XP_010690061.1| PREDICTED: uncharacterized protein LOC104903675 [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            S Q+PTFTPL+CDPIVHIP +D CSSGQGYLVSAGPG+++ IPPL+PNLV P++ E ES+
Sbjct  519  STQLPTFTPLMCDPIVHIPVVDFCSSGQGYLVSAGPGIASSIPPLYPNLVGPIMTENESM  578

Query  410  VEKSARETLRMLM-NSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            +EK ARETLR+L+  SS+QP+A LMSV PS L + +E   V+  GSRGLYSG  D++   
Sbjct  579  LEKGARETLRLLIGGSSSQPSASLMSVFPSVL-NDKENQGVVVTGSRGLYSGISDVNAMV  637

Query  233  VSVAKI  216
             S A +
Sbjct  638  NSFAAV  643



>ref|XP_006355657.1| PREDICTED: uncharacterized protein LOC102584429 [Solanum tuberosum]
Length=665

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 8/139 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIP-EAES  414
            SQQIPTFTPL+ D IVHIP IDVCSSGQGY VSAGP +S  IP LHPNLV+PLIP E ES
Sbjct  483  SQQIPTFTPLVGDSIVHIPVIDVCSSGQGYFVSAGPAISGSIPQLHPNLVNPLIPAETES  542

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLP-SSEEKLSVLGGGSRGLYSGTIDIDVT  237
            + EKSARETLR+L+N+SNQP+  L+ +LP  L  S EE  ++L  GSRGLYS TI +D T
Sbjct  543  MAEKSARETLRLLINNSNQPSPQLIDLLPPVLSRSGEETRNMLVTGSRGLYSRTIGVDTT  602

Query  236  TVS------VAKISKRDIG  198
              +      +A +S++ +G
Sbjct  603  IANDFAFKGLASLSEKPVG  621



>ref|XP_004239939.1| PREDICTED: uncharacterized protein LOC101257080 [Solanum lycopersicum]
Length=664

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 108/152 (71%), Gaps = 11/152 (7%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLI-PEAES  414
            SQQIPTFTPL+ D IVHIP IDVCSSGQGY VSAGP +S  IP LHPNLV+PLI PE ES
Sbjct  483  SQQIPTFTPLVGDSIVHIPVIDVCSSGQGYFVSAGPAISGSIPQLHPNLVNPLIPPETES  542

Query  413  VVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSS-EEKLSVLGGGSRGLYSGTIDIDVT  237
            + EKSARETLR+L+N+SNQP+  L+ +LP  L  S EE  +++  GSRGLYS TI +D T
Sbjct  543  MAEKSARETLRLLINNSNQPSPQLIDLLPPVLSRSGEETRNMVVTGSRGLYSRTIGVDTT  602

Query  236  TVS------VAKISKRDIG---EKHFVEATEM  168
              +      +A +S++ +G   +K  +   EM
Sbjct  603  IANDFAFKGLASLSEKPVGGWLDKKKLRIQEM  634



>ref|XP_009344495.1| PREDICTED: uncharacterized protein LOC103936380 [Pyrus x bretschneideri]
Length=697

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTF PL+CDPIVHIP ID+CSSGQGYLVSAGP +ST I PLH  LV+  IPE +S+
Sbjct  517  SQQIPTFIPLMCDPIVHIPVIDICSSGQGYLVSAGPAISTAISPLHSKLVN--IPETDSM  574

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            +EK ARETL R+L++ S Q ++ LM VLP+ + S+ E  ++L  GSRGLYSGT D+DV  
Sbjct  575  LEKGARETLRRLLISGSTQNSSQLMDVLPAMITSAHENRNMLVTGSRGLYSGTRDVDVIA  634

Query  233  VSVAKI  216
             S+A +
Sbjct  635  NSIAAM  640



>ref|XP_008382018.1| PREDICTED: uncharacterized protein LOC103444847 [Malus domestica]
Length=699

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTF PL+CDPIVHIP ID+CSSGQGYLVSAGP +ST I PLH  LV+  IPE +S+
Sbjct  519  SQQIPTFIPLMCDPIVHIPVIDICSSGQGYLVSAGPAISTAISPLHSKLVN--IPETDSM  576

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTT  234
            +EK ARETL R+L++ S Q ++ LM VLP+ + ++ E  ++L  GSRGLYSGT D+DV  
Sbjct  577  LEKGARETLRRLLISGSTQNSSQLMDVLPAMITTAHENRNMLVTGSRGLYSGTRDVDVIA  636

Query  233  VSVAKI  216
             S+A +
Sbjct  637  NSIAAM  642



>ref|XP_010067499.1| PREDICTED: uncharacterized protein LOC104454371 [Eucalyptus grandis]
 gb|KCW65642.1| hypothetical protein EUGRSUZ_G03032 [Eucalyptus grandis]
Length=695

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTPL+CD IVH+P ID CS+GQGYLVSAGP ++T I PL+P LVSPLIPE  SV
Sbjct  517  SQQIPTFTPLMCDSIVHVPVIDFCSAGQGYLVSAGPTVTTAIGPLNPKLVSPLIPETSSV  576

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDV  240
            VE+ ARETLR+L++ S+      +S+LP  L  ++EK S +  GSRGLYSG  D+D 
Sbjct  577  VEEGARETLRLLISGSSPTVTQSISMLPVVLSGADEKQSAVVAGSRGLYSGIRDVDA  633



>ref|XP_009586908.1| PREDICTED: uncharacterized protein LOC104084692 [Nicotiana tomentosiformis]
Length=644

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQI +F+PL+CDPIVHIP IDVCSSGQ YLVSAGP +S  IP LHPNL++PL+PE +SV
Sbjct  469  SQQISSFSPLVCDPIVHIPVIDVCSSGQSYLVSAGPSISGTIPHLHPNLLNPLLPETDSV  528

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
             EKSARETLR+L+N+SNQP   L+ +LP  L  SEE  ++L  GSRGLYSGTID+D    
Sbjct  529  AEKSARETLRLLINNSNQPTPQLIDLLPPVLSHSEETRNMLVSGSRGLYSGTIDVDTIAN  588

Query  230  SVA-----KISKRDIG  198
              A      +S+R +G
Sbjct  589  GFAIKGLVSLSERPVG  604



>ref|XP_010554647.1| PREDICTED: uncharacterized protein LOC104824306 isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010554649.1| PREDICTED: uncharacterized protein LOC104824306 isoform X4 [Tarenaya 
hassleriana]
Length=510

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIP F+PL+C+PIVHIP IDVCSSGQGYLVSAGPGM T IPPLHPN +  + P+ ES+
Sbjct  344  SQQIPMFSPLMCEPIVHIPVIDVCSSGQGYLVSAGPGMPTSIPPLHPNHL--VNPQKESL  401

Query  410  VEKSARETLRMLMNSSN--QPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            +EK ARETLR+L++ SN     APL++V   F  S + +  +L  GSRGLYSGT D+
Sbjct  402  LEKGARETLRLLISGSNTATAGAPLINV---FAKSEDRQPGLLVAGSRGLYSGTHDV  455



>ref|XP_010554646.1| PREDICTED: uncharacterized protein LOC104824306 isoform X3 [Tarenaya 
hassleriana]
Length=527

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIP F+PL+C+PIVHIP IDVCSSGQGYLVSAGPGM T IPPLHPN +  + P+ ES+
Sbjct  361  SQQIPMFSPLMCEPIVHIPVIDVCSSGQGYLVSAGPGMPTSIPPLHPNHL--VNPQKESL  418

Query  410  VEKSARETLRMLMNSSN--QPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            +EK ARETLR+L++ SN     APL++V   F  S + +  +L  GSRGLYSGT D+
Sbjct  419  LEKGARETLRLLISGSNTATAGAPLINV---FAKSEDRQPGLLVAGSRGLYSGTHDV  472



>ref|XP_010554644.1| PREDICTED: uncharacterized protein LOC104824306 isoform X1 [Tarenaya 
hassleriana]
Length=673

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 7/117 (6%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIP F+PL+C+PIVHIP IDVCSSGQGYLVSAGPGM T IPPLHPN +  + P+ ES+
Sbjct  507  SQQIPMFSPLMCEPIVHIPVIDVCSSGQGYLVSAGPGMPTSIPPLHPNHL--VNPQKESL  564

Query  410  VEKSARETLRMLMNSSN--QPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            +EK ARETLR+L++ SN     APL++V   F  S + +  +L  GSRGLYSGT D+
Sbjct  565  LEKGARETLRLLISGSNTATAGAPLINV---FAKSEDRQPGLLVAGSRGLYSGTHDV  618



>ref|XP_008812873.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103723670 
[Phoenix dactylifera]
Length=704

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTP I DPIVHIP IDVCSSGQGYLVSAGP +S+ IPPL P+LV+PLI ++ES+
Sbjct  531  SQQIPTFTPFISDPIVHIPVIDVCSSGQGYLVSAGPAISSAIPPLCPSLVNPLIRDSESL  590

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPS  312
             EKSARETLRMLM S+  P  P LM+VLP+ LP+
Sbjct  591  AEKSARETLRMLMASAPTPTTPQLMNVLPAVLPA  624



>ref|XP_010909151.1| PREDICTED: uncharacterized protein LOC105035318 [Elaeis guineensis]
Length=722

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTP + DPIVHIP IDVCSSGQGYLVSA P +S+ IPPL P+L +PL+PE ES+
Sbjct  536  SQQIPTFTPFMSDPIVHIPVIDVCSSGQGYLVSAAPAISSTIPPLLPSLANPLMPETESL  595

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPSSEEKLSVLGGGSRGLYSGT  255
            VEKSARETLRMLM S+  P  P LM+VLP+   S  E  S       G+ + T
Sbjct  596  VEKSARETLRMLMASAPTPTTPQLMNVLPAVFSSVNENFSCTSVNKLGVVAAT  648



>ref|XP_009398858.1| PREDICTED: uncharacterized protein LOC103983358 [Musa acuminata 
subsp. malaccensis]
Length=688

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 93/142 (65%), Gaps = 10/142 (7%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIP FTP I DPIVHIP ID CSSG GYLVSAGP +S+ + PL P LVSPLIP+ ES 
Sbjct  518  SQQIPMFTPFISDPIVHIPVIDFCSSGPGYLVSAGPAISSVLSPLLPGLVSPLIPKVESA  577

Query  410  VEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLS----------VLGGGSRGLYS  261
            +EK+ARETL+MLM SS   ++P ++VLP+   + +E  S          V+   S+ L  
Sbjct  578  IEKNARETLKMLMASSPTASSPQLNVLPAVFNNLDESFSCAKMVNNHSAVVATSSQLLCG  637

Query  260  GTIDIDVTTVSVAKISKRDIGE  195
            GT+D+D  +  ++ I    +GE
Sbjct  638  GTVDVDNVSSDLSCIGLCSLGE  659



>ref|XP_008775390.1| PREDICTED: uncharacterized protein LOC103695761 [Phoenix dactylifera]
 ref|XP_008775391.1| PREDICTED: uncharacterized protein LOC103695761 [Phoenix dactylifera]
Length=720

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 88/135 (65%), Gaps = 11/135 (8%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQIPTFTP + DPIVHIP IDVCSSGQGYLVSA P + + IPPL P +V+PL+PE ES+
Sbjct  535  SQQIPTFTPFMSDPIVHIPVIDVCSSGQGYLVSAAPAIPSAIPPLLP-IVNPLMPETESL  593

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPSSEEKLS---------VLGGGSRGLYS  261
            VEKSARETLRMLM S+  P  P LMSVLP    S  E  S         V       L +
Sbjct  594  VEKSARETLRMLMASAPTPATPQLMSVLPVVFSSVNENFSCNHVNKLGAVAASSGSCLCN  653

Query  260  GTIDIDVTTVSVAKI  216
            GT DID    S++ I
Sbjct  654  GTPDIDSIASSMSLI  668



>gb|ERN09697.1| hypothetical protein AMTR_s00029p00218490 [Amborella trichopoda]
Length=186

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 87/143 (61%), Gaps = 16/143 (11%)
 Frame = -3

Query  587  QQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPL---HPNLVSPLIPEAE  417
            QQIPTFTP I DPIVHIP ID+CSSGQ Y VSAGP +ST I PL   + NLV  LIP++E
Sbjct  12   QQIPTFTPFIADPIVHIPVIDICSSGQAYFVSAGPAISTSISPLQLPNLNLVGGLIPKSE  71

Query  416  SVVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVT  237
            S+VEK ARETLR+L+ S+      +   L           + L GGSRGL+ G+  +D+ 
Sbjct  72   SLVEKGARETLRLLIGSTQNETQFIEDSL----------CTALVGGSRGLFYGSRGMDIA  121

Query  236  TVSVAKISKRDIGEKHFVEATEM  168
            T S+   S    G  H +  + M
Sbjct  122  T-SIGCFSAN--GSTHLISDSSM  141



>ref|XP_009414415.1| PREDICTED: uncharacterized protein LOC103995537 [Musa acuminata 
subsp. malaccensis]
Length=697

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 93/144 (65%), Gaps = 7/144 (5%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            SQQ+P FTP + DPIVHIP IDVCSSGQGYLVSAGP +ST I PL PNLV+PLIP+ ESV
Sbjct  529  SQQLPIFTPFMSDPIVHIPLIDVCSSGQGYLVSAGPAISTAISPLLPNLVNPLIPKTESV  588

Query  410  VEKSARETLRMLMNSSNQPNAP-LMSVLPSFLPSSEEKLS----VLGGGSRGLYSGTIDI  246
            VEK+ARETL ML+ S+   + P LM+VLP+   +  E  +    V    +    S   D+
Sbjct  589  VEKNARETLEMLLASAPIASGPRLMNVLPAVFNNLSENFTCDSKVNNHSAIAATSSQFDV  648

Query  245  D--VTTVSVAKISKRDIGEKHFVE  180
            D  +T +S   +   + G  H V+
Sbjct  649  DTILTDLSCKGLCSLEKGAVHEVD  672



>gb|EYU41259.1| hypothetical protein MIMGU_mgv1a025524mg [Erythranthe guttata]
Length=619

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 92/157 (59%), Gaps = 31/157 (20%)
 Frame = -3

Query  587  QQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVV  408
            Q IPTFTP ICD IVHIP I++CSSGQGYLVSA P M+T IPPL+PN        AESV+
Sbjct  481  QLIPTFTPFICDSIVHIPVIEMCSSGQGYLVSASPAMTTSIPPLNPN--------AESVL  532

Query  407  EKSARETLRMLMNSSN-QPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTV  231
            EK ARETL ML+NSSN QPN   + V PS               S  +Y+G  D+D  T 
Sbjct  533  EKGARETLHMLINSSNQQPNPQFLEVFPS---------------SSSIYNGDRDMDAITN  577

Query  230  SVAK-----ISKRDI--GEKHFVEATEMPSNSDGTMF  141
            S++      +S + +  G    +E  E PS+S  + F
Sbjct  578  SMSTMGLILLSDKSMGGGRDDLIEHNEKPSHSGSSGF  614



>ref|XP_006848117.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC18437855 
[Amborella trichopoda]
Length=609

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 87/143 (61%), Gaps = 16/143 (11%)
 Frame = -3

Query  587  QQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPL---HPNLVSPLIPEAE  417
            QQIPTFTP I DPIVHIP ID+CSSGQ Y VSAGP +ST I PL   + NLV  LIP++E
Sbjct  435  QQIPTFTPFIADPIVHIPVIDICSSGQAYFVSAGPAISTSISPLQLPNLNLVGGLIPKSE  494

Query  416  SVVEKSARETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVT  237
            S+VEK ARETLR+L+ S+      +   L           + L GGSRGL+ G+  +D+ 
Sbjct  495  SLVEKGARETLRLLIGSTQNETQFIEDSL----------CTALVGGSRGLFYGSRGMDIA  544

Query  236  TVSVAKISKRDIGEKHFVEATEM  168
            T S+   S    G  H +  + M
Sbjct  545  T-SIGCFSAN--GSTHLISDSSM  564



>ref|XP_006657379.1| PREDICTED: uncharacterized protein LOC102710797 [Oryza brachyantha]
 ref|XP_006665128.1| PREDICTED: uncharacterized protein LOC102716375 [Oryza brachyantha]
Length=499

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCSSGQ YLVS G  MS+ + PL P+L  PLIPE ES+VE
Sbjct  350  QVPTFTPLMSDPIVHVPVIDVCSSGQAYLVSCGASMSSTV-PLLPSL-KPLIPETESLVE  407

Query  404  KSARETLRMLMNSS-NQPNAPLMSVLPSFLPSSEEK  300
            +SARETL  LM S+ +  N+ L+++LP+ L    +K
Sbjct  408  RSARETLMRLMASTPSASNSQLVNILPAVLTDVSKK  443



>gb|EAZ02457.1| hypothetical protein OsI_24562 [Oryza sativa Indica Group]
Length=632

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 3/90 (3%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCSSGQ YLVS GP MS  + PL P+L  PLIPE ES+VE
Sbjct  480  QVPTFTPLMSDPIVHVPVIDVCSSGQAYLVSCGPSMSATV-PLLPSL-KPLIPETESLVE  537

Query  404  KSARETL-RMLMNSSNQPNAPLMSVLPSFL  318
            +SARETL R++ ++ +  N  L+++LP+ L
Sbjct  538  RSARETLMRLIASTPSASNPQLVNILPAVL  567



>ref|NP_001058671.1| Os07g0100500 [Oryza sativa Japonica Group]
 dbj|BAD31818.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20585.1| Os07g0100500 [Oryza sativa Japonica Group]
 dbj|BAG90669.1| unnamed protein product [Oryza sativa Japonica Group]
Length=503

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCSSGQ YLVS GP MS  +  L P+L  PLIPE ES+VE
Sbjct  351  QVPTFTPLMSDPIVHVPVIDVCSSGQAYLVSCGPSMSATV-TLLPSL-KPLIPETESLVE  408

Query  404  KSARETL-RMLMNSSNQPNAPLMSVLPSFL  318
            +SARETL R++ ++ +  N  L+++LP+ L
Sbjct  409  RSARETLMRLIASTPSASNPQLVNILPAVL  438



>gb|EMS63062.1| hypothetical protein TRIUR3_19294 [Triticum urartu]
Length=663

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            S Q+PTFTPL+ DPIVH+P ID+CSSGQ YLVS GP +++ + PL P+L  PLIPE ES+
Sbjct  494  SSQVPTFTPLMSDPIVHVPVIDMCSSGQAYLVSCGPSITSPV-PLLPSL-KPLIPETESL  551

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLS  294
            VE+SARETL R+L ++    N  L+++LP+ L    E +S
Sbjct  552  VERSARETLMRLLASTPPSSNPQLVNILPAVLTDVPENIS  591



>gb|EAZ38385.1| hypothetical protein OsJ_22762 [Oryza sativa Japonica Group]
Length=632

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCSSGQ YLVS GP MS  +  L P+L  PLIPE ES+VE
Sbjct  480  QVPTFTPLMSDPIVHVPVIDVCSSGQAYLVSCGPSMSATV-TLLPSL-KPLIPETESLVE  537

Query  404  KSARETL-RMLMNSSNQPNAPLMSVLPSFL  318
            +SARETL R++ ++ +  N  L+++LP+ L
Sbjct  538  RSARETLMRLIASTPSASNPQLVNILPAVL  567



>gb|EMT16986.1| hypothetical protein F775_32915 [Aegilops tauschii]
Length=819

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 3/100 (3%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            S Q+PTFTPL+ DPIVH+P ID+CSSGQ YLVS GP +++ + PL P+L  PLIPE ES+
Sbjct  650  SSQVPTFTPLMSDPIVHVPVIDMCSSGQAYLVSCGPSITSPV-PLLPSL-KPLIPETESL  707

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLS  294
            VE+SARETL R+L ++    N  L+++LP+ L    E +S
Sbjct  708  VERSARETLMRLLASTPPSSNPQLVNILPAVLTDVPENIS  747



>dbj|BAJ88962.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%), Gaps = 3/100 (3%)
 Frame = -3

Query  590  SQQIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESV  411
            S Q+ TFTPL+ DPIVH+P ID+CSSGQ YLVS GP +++ + PL P+L  PLIPE ES+
Sbjct  526  SSQVSTFTPLMSDPIVHVPVIDMCSSGQAYLVSCGPSITSAV-PLLPSL-KPLIPETESL  583

Query  410  VEKSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLS  294
            VE+SARETL R++ ++    N  L+++LP+ L    E +S
Sbjct  584  VERSARETLMRLIASTPPSSNPQLVNILPAVLTDVPENIS  623



>ref|XP_010228491.1| PREDICTED: uncharacterized protein LOC104581759 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228492.1| PREDICTED: uncharacterized protein LOC104581759 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228493.1| PREDICTED: uncharacterized protein LOC104581759 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010228494.1| PREDICTED: uncharacterized protein LOC104581759 isoform X2 [Brachypodium 
distachyon]
Length=562

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 7/100 (7%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P  D+CSSGQ YLVS GP +S+ + PL P+L +PLIPE E +VE
Sbjct  395  QVPTFTPLMSDPIVHVPAFDMCSSGQAYLVSCGPSISSAV-PLLPSL-NPLIPEPELLVE  452

Query  404  KSARETLRMLMNS---SNQPNAPLMSVLPSFLPSSEEKLS  294
            +SARETL  L+ S   S+ PN  L+++LP+ L    E +S
Sbjct  453  RSARETLMRLIASTPPSSNPN--LVNILPAVLTDVPESIS  490



>ref|XP_010228490.1| PREDICTED: uncharacterized protein LOC104581759 isoform X1 [Brachypodium 
distachyon]
Length=686

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 7/100 (7%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P  D+CSSGQ YLVS GP +S+ + PL P+L +PLIPE E +VE
Sbjct  519  QVPTFTPLMSDPIVHVPAFDMCSSGQAYLVSCGPSISSAV-PLLPSL-NPLIPEPELLVE  576

Query  404  KSARETLRMLMNS---SNQPNAPLMSVLPSFLPSSEEKLS  294
            +SARETL  L+ S   S+ PN  L+++LP+ L    E +S
Sbjct  577  RSARETLMRLIASTPPSSNPN--LVNILPAVLTDVPESIS  614



>ref|XP_010517377.1| PREDICTED: uncharacterized protein LOC104792836 isoform X2 [Camelina 
sativa]
Length=479

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SPL  E +S+VEK ARET
Sbjct  352  PMMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPLPVENDSLVEKGARET  405

Query  386  LRMLMNSSNQP-NAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L+N +N   +APL                    GSRGLYSG  D+
Sbjct  406  LRLLINGANAATSAPLNH-----------------HGSRGLYSGNRDV  436



>ref|XP_010517376.1| PREDICTED: uncharacterized protein LOC104792836 isoform X1 [Camelina 
sativa]
Length=637

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SPL  E +S+VEK ARET
Sbjct  510  PMMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPLPVENDSLVEKGARET  563

Query  386  LRMLMNSSNQP-NAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L+N +N   +APL                    GSRGLYSG  D+
Sbjct  564  LRLLINGANAATSAPLNH-----------------HGSRGLYSGNRDV  594



>ref|XP_010505694.1| PREDICTED: uncharacterized protein LOC104782456 [Camelina sativa]
Length=637

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SPL  E +S+VEK ARET
Sbjct  510  PMMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPLPVENDSLVEKGARET  563

Query  386  LRMLMNSSNQ-PNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L+N +N   +APL                    GSRGLYSG  D+
Sbjct  564  LRLLINGANATTSAPLNH-----------------HGSRGLYSGNRDV  594



>ref|XP_010508941.1| PREDICTED: uncharacterized protein LOC104785428 isoform X1 [Camelina 
sativa]
Length=642

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 68/108 (63%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SPL  E +S+VEK ARET
Sbjct  515  PMMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPLPVENDSLVEKGARET  568

Query  386  LRMLMNSSNQ-PNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L+N +N   +APL                    G+RGLYSG  D+
Sbjct  569  LRLLINGANATTSAPLNH-----------------HGTRGLYSGNRDV  599



>ref|XP_010508942.1| PREDICTED: uncharacterized protein LOC104785428 isoform X2 [Camelina 
sativa]
Length=560

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 68/108 (63%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SPL  E +S+VEK ARET
Sbjct  433  PMMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPLPVENDSLVEKGARET  486

Query  386  LRMLMNSSNQ-PNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L+N +N   +APL                    G+RGLYSG  D+
Sbjct  487  LRLLINGANATTSAPLNH-----------------HGTRGLYSGNRDV  517



>ref|XP_002459191.1| hypothetical protein SORBIDRAFT_02g000250 [Sorghum bicolor]
 gb|EER95712.1| hypothetical protein SORBIDRAFT_02g000250 [Sorghum bicolor]
Length=640

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 84/145 (58%), Gaps = 7/145 (5%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVHIP IDVCS+GQ YLVS GP +++ +       + PL+PEAES+VE
Sbjct  479  QVPTFTPLMSDPIVHIPVIDVCSAGQAYLVSCGPSITSAV--PLLPSLKPLLPEAESLVE  536

Query  404  KSARETL-RMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTVS  228
            +SARETL R++ ++    N  L +VLP  +P   E +      ++ +  G  D    T  
Sbjct  537  RSARETLMRLIASTPPASNPQLANVLPVVIPDMPESIYRANNVNKHVDVGPNDKAFGTSC  596

Query  227  VAKISKRDIGEKHFVEATEMPSNSD  153
            VA +    I +       E+PS  D
Sbjct  597  VAAVFGSGIAQAE----DEVPSGDD  617



>ref|XP_006293799.1| hypothetical protein CARUB_v10022781mg, partial [Capsella rubella]
 gb|EOA26697.1| hypothetical protein CARUB_v10022781mg, partial [Capsella rubella]
Length=672

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 24/108 (22%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVEKSARET  387
            P++CDPIVHIP ID+CSSGQGYLVSAGP   TG   + P  +SP+  E +S+VEK ARET
Sbjct  546  PIMCDPIVHIPVIDICSSGQGYLVSAGP---TG---MIPTGISPIPVENDSLVEKGARET  599

Query  386  LRMLMN-SSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            LR+L++ +S    APL                    GSRGLYSG  D+
Sbjct  600  LRLLISGASATTTAPLNH-----------------HGSRGLYSGNRDV  630



>emb|CDY20502.1| BnaC04g05420D [Brassica napus]
Length=619

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 28/110 (25%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGP-GMS-TGIPPLHPNLVSPLIPEAESVVEKSAR  393
            PL+CDPIVHIP +D+CSSGQ YLVSAGP GM  TG+PPL      P+  E ES+VEK AR
Sbjct  493  PLMCDPIVHIPVMDICSSGQAYLVSAGPTGMIPTGMPPL------PV--ENESLVEKGAR  544

Query  392  ETLRMLMN-SSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            ETLR+L++ +S   +APL                    GSRGLY+GT D+
Sbjct  545  ETLRLLISGASATTSAPLNH-----------------HGSRGLYNGTRDV  577



>gb|KFK36887.1| hypothetical protein AALP_AA4G184700 [Arabis alpina]
Length=633

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 28/110 (25%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPG--MSTGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP +D+CSSGQ YLVSAGP   +ST IPPL      P+  E +S+VEK AR
Sbjct  503  PIMCDPIVHIPVMDICSSGQSYLVSAGPTSMISTSIPPL------PV--ENDSLVEKGAR  554

Query  392  ETLRMLMNSSNQPN-APLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            ETLR+L++ +N  N APL                    GSRG+YSG+ D+
Sbjct  555  ETLRLLISGANATNPAPLNH-----------------HGSRGIYSGSRDM  587



>ref|XP_002881685.1| hypothetical protein ARALYDRAFT_483032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57944.1| hypothetical protein ARALYDRAFT_483032 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 69/110 (63%), Gaps = 28/110 (25%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGP-GM-STGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP ID+ SSGQGYLVS GP GM STGIPPL      P+  E +S+VEK AR
Sbjct  507  PIMCDPIVHIPVIDIYSSGQGYLVSTGPTGMISTGIPPL------PV--ENDSLVEKGAR  558

Query  392  ETLRMLMNSSNQPNA-PLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            ETLR+L++ +N   + PL                    GSRGLYSG+ D+
Sbjct  559  ETLRLLISGANATTSTPLNH-----------------HGSRGLYSGSRDV  591



>ref|XP_006411239.1| hypothetical protein EUTSA_v10017559mg [Eutrema salsugineum]
 gb|ESQ52692.1| hypothetical protein EUTSA_v10017559mg [Eutrema salsugineum]
Length=616

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 72/118 (61%), Gaps = 27/118 (23%)
 Frame = -3

Query  590  SQQIPTFTPLICD-PIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAES  414
            SQQ+    P++CD PIVHIP ID+CSSGQ YLVSAGP   TG   + P  ++PL  E +S
Sbjct  481  SQQM--MIPIMCDHPIVHIPVIDICSSGQAYLVSAGP---TG---MIPTSITPLPVENDS  532

Query  413  VVEKSARETLRMLMNSSNQ--PNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            +VEK ARETLR+L++ +N    +APL                    GSRGLYSGT D+
Sbjct  533  LVEKGARETLRLLISGANATTSSAPLNH----------------HHGSRGLYSGTRDV  574



>ref|XP_009143266.1| PREDICTED: uncharacterized protein LOC103866995 [Brassica rapa]
Length=610

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 27/110 (25%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGP-GM-STGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP +D+CSSGQ YLVSAGP GM  TG+PPL          E ES++EK AR
Sbjct  483  PIMCDPIVHIPVMDICSSGQAYLVSAGPTGMIPTGMPPLS--------VENESLMEKGAR  534

Query  392  ETLRMLMN-SSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDI  246
            ETLR+L++ +S   +APL                    GSRGLY+GT D+
Sbjct  535  ETLRLLISGASGTTSAPLNH----------------HHGSRGLYNGTRDV  568



>ref|XP_004987291.1| PREDICTED: uncharacterized protein LOC101765564 [Setaria italica]
Length=650

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCS+GQ YLVS GP +S+ +       + PL+PEA+S+VE
Sbjct  489  QVPTFTPLMSDPIVHVPVIDVCSAGQAYLVSCGPSISSAV--PLLPSLKPLLPEADSLVE  546

Query  404  KSARETL-RMLMNSSNQPNAPLMSVLPSFLPSS  309
            +SARETL R++ ++    N  L+++LP  +P S
Sbjct  547  RSARETLMRLIASTPPASNPQLVNILPVVVPES  579



>tpg|DAA59311.1| TPA: hypothetical protein ZEAMMB73_271962 [Zea mays]
Length=487

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCS+GQ YLVS GP +++ +P L    + PL+PEAES+VE
Sbjct  337  QVPTFTPLMSDPIVHVPVIDVCSAGQAYLVSCGPSITSAVPLL--PSLKPLLPEAESLVE  394

Query  404  KSARETLRMLMNSSNQPNAPL  342
            +SARETL  L+ S+   + PL
Sbjct  395  RSARETLMRLIASTPPASNPL  415



>dbj|BAE98503.1| hypothetical protein [Arabidopsis thaliana]
Length=399

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 28/116 (24%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPG--MSTGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP ID+ SSGQ YLVSAGP   +STGIPPL      P+  E +S+VEK AR
Sbjct  273  PIMCDPIVHIPVIDIFSSGQSYLVSAGPTGIISTGIPPL------PV--ENDSLVEKGAR  324

Query  392  ETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTVSV  225
            ETLR+L++ +N   +  ++                  GSRGLYS  +  DV+ VS+
Sbjct  325  ETLRLLISGANATTSTPLN----------------HHGSRGLYS--VSRDVSGVSL  362



>ref|XP_008651903.1| PREDICTED: uncharacterized protein LOC103631857 [Zea mays]
 tpg|DAA59312.1| TPA: hypothetical protein ZEAMMB73_271962 [Zea mays]
Length=621

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 2/81 (2%)
 Frame = -3

Query  584  QIPTFTPLICDPIVHIPFIDVCSSGQGYLVSAGPGMSTGIPPLHPNLVSPLIPEAESVVE  405
            Q+PTFTPL+ DPIVH+P IDVCS+GQ YLVS GP +++ +P L    + PL+PEAES+VE
Sbjct  471  QVPTFTPLMSDPIVHVPVIDVCSAGQAYLVSCGPSITSAVPLL--PSLKPLLPEAESLVE  528

Query  404  KSARETLRMLMNSSNQPNAPL  342
            +SARETL  L+ S+   + PL
Sbjct  529  RSARETLMRLIASTPPASNPL  549



>ref|NP_001078026.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09755.1| uncharacterized protein AT2G39950 [Arabidopsis thaliana]
Length=555

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 28/116 (24%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPG--MSTGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP ID+ SSGQ YLVSAGP   +STGIPPL      P+  E +S+VEK AR
Sbjct  429  PIMCDPIVHIPVIDIFSSGQSYLVSAGPTGIISTGIPPL------PV--ENDSLVEKGAR  480

Query  392  ETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTVSV  225
            ETLR+L++ +N   +  ++                  GSRGLYS  +  DV+ VS+
Sbjct  481  ETLRLLISGANATTSTPLN----------------HHGSRGLYS--VSRDVSGVSL  518



>ref|NP_181524.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAB95280.1| hypothetical protein [Arabidopsis thaliana]
 gb|ACI49778.1| At2g39950 [Arabidopsis thaliana]
 gb|AEC09754.1| uncharacterized protein AT2G39950 [Arabidopsis thaliana]
Length=636

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 28/116 (24%)
 Frame = -3

Query  566  PLICDPIVHIPFIDVCSSGQGYLVSAGPG--MSTGIPPLHPNLVSPLIPEAESVVEKSAR  393
            P++CDPIVHIP ID+ SSGQ YLVSAGP   +STGIPPL      P+  E +S+VEK AR
Sbjct  510  PIMCDPIVHIPVIDIFSSGQSYLVSAGPTGIISTGIPPL------PV--ENDSLVEKGAR  561

Query  392  ETLRMLMNSSNQPNAPLMSVLPSFLPSSEEKLSVLGGGSRGLYSGTIDIDVTTVSV  225
            ETLR+L++ +N   +  ++                  GSRGLYS  +  DV+ VS+
Sbjct  562  ETLRLLISGANATTSTPLN----------------HHGSRGLYS--VSRDVSGVSL  599



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1372351877325