BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7065

Length=975
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009779024.1|  PREDICTED: CCR4-NOT transcription complex su...    270   2e-79   Nicotiana sylvestris
emb|CAN68892.1|  hypothetical protein VITISV_029859                     266   7e-79   Vitis vinifera
ref|XP_009613357.1|  PREDICTED: CCR4-NOT transcription complex su...    268   9e-79   Nicotiana tomentosiformis
emb|CBI28248.3|  unnamed protein product                                266   2e-78   Vitis vinifera
ref|XP_002282408.1|  PREDICTED: CCR4-NOT transcription complex su...    267   3e-78   Vitis vinifera
ref|XP_004242757.1|  PREDICTED: CCR4-NOT transcription complex su...    265   2e-77   Solanum lycopersicum
ref|XP_012081192.1|  PREDICTED: CCR4-NOT transcription complex su...    259   2e-76   
ref|XP_012081191.1|  PREDICTED: CCR4-NOT transcription complex su...    259   2e-75   Jatropha curcas
ref|XP_012081190.1|  PREDICTED: CCR4-NOT transcription complex su...    259   2e-75   Jatropha curcas
ref|XP_006358305.1|  PREDICTED: CCR4-NOT transcription complex su...    259   3e-75   Solanum tuberosum [potatoes]
ref|XP_007013546.1|  Tetratricopeptide repeat-like superfamily pr...    258   6e-75   
ref|XP_010250204.1|  PREDICTED: CCR4-NOT transcription complex su...    253   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006453084.1|  hypothetical protein CICLE_v10007427mg             252   9e-73   Citrus clementina [clementine]
gb|KHG25873.1|  CCR4-NOT transcription complex subunit 10-B             250   4e-72   Gossypium arboreum [tree cotton]
gb|KJB23622.1|  hypothetical protein B456_004G107500                    249   9e-72   Gossypium raimondii
gb|KDO73490.1|  hypothetical protein CISIN_1g003047mg                   249   1e-71   Citrus sinensis [apfelsine]
ref|XP_011020187.1|  PREDICTED: CCR4-NOT transcription complex su...    249   1e-71   Populus euphratica
ref|XP_002308973.2|  hypothetical protein POPTR_0006s06440g             243   8e-71   
ref|XP_002325199.2|  hypothetical protein POPTR_0018s12640g             242   1e-70   
ref|XP_011017835.1|  PREDICTED: CCR4-NOT transcription complex su...    245   3e-70   Populus euphratica
gb|KJB83205.1|  hypothetical protein B456_013G235300                    243   8e-70   Gossypium raimondii
gb|KJB83204.1|  hypothetical protein B456_013G235300                    243   1e-69   Gossypium raimondii
gb|KHF99103.1|  CCR4-NOT transcription complex subunit 10-B             244   1e-69   Gossypium arboreum [tree cotton]
gb|KJB83203.1|  hypothetical protein B456_013G235300                    243   2e-69   Gossypium raimondii
ref|XP_004508459.1|  PREDICTED: CCR4-NOT transcription complex su...    241   9e-69   Cicer arietinum [garbanzo]
ref|XP_004508458.1|  PREDICTED: CCR4-NOT transcription complex su...    241   1e-68   Cicer arietinum [garbanzo]
gb|KHN15056.1|  CCR4-NOT transcription complex subunit 10               236   1e-68   Glycine soja [wild soybean]
ref|XP_011084121.1|  PREDICTED: CCR4-NOT transcription complex su...    238   8e-68   Sesamum indicum [beniseed]
gb|AES91602.2|  CCR4-NOT transcription complex subunit-like protein     238   1e-67   Medicago truncatula
ref|XP_003549742.1|  PREDICTED: CCR4-NOT transcription complex su...    237   3e-67   Glycine max [soybeans]
ref|XP_003609405.1|  CCR4-NOT transcription complex subunit 10-B        236   5e-67   
gb|KJB64702.1|  hypothetical protein B456_010G061100                    236   7e-67   Gossypium raimondii
ref|XP_003542639.1|  PREDICTED: CCR4-NOT transcription complex su...    234   3e-66   Glycine max [soybeans]
gb|KHN03608.1|  CCR4-NOT transcription complex subunit 10               234   3e-66   Glycine soja [wild soybean]
ref|XP_006594244.1|  PREDICTED: CCR4-NOT transcription complex su...    234   3e-66   Glycine max [soybeans]
gb|KHG02249.1|  CCR4-NOT transcription complex subunit 10               232   1e-65   Gossypium arboreum [tree cotton]
ref|XP_007155052.1|  hypothetical protein PHAVU_003G169000g             229   1e-64   Phaseolus vulgaris [French bean]
gb|KGN65121.1|  hypothetical protein Csa_1G228970                       228   3e-64   Cucumis sativus [cucumbers]
ref|XP_008795858.1|  PREDICTED: CCR4-NOT transcription complex su...    228   5e-64   Phoenix dactylifera
ref|XP_004150203.1|  PREDICTED: CCR4-NOT transcription complex su...    228   5e-64   Cucumis sativus [cucumbers]
ref|XP_008443951.1|  PREDICTED: CCR4-NOT transcription complex su...    228   6e-64   Cucumis melo [Oriental melon]
ref|XP_010241578.1|  PREDICTED: CCR4-NOT transcription complex su...    226   3e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010913323.1|  PREDICTED: CCR4-NOT transcription complex su...    224   3e-63   
ref|XP_009406653.1|  PREDICTED: CCR4-NOT transcription complex su...    224   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913322.1|  PREDICTED: CCR4-NOT transcription complex su...    224   7e-63   
gb|KJB23623.1|  hypothetical protein B456_004G107500                    224   8e-63   Gossypium raimondii
ref|XP_010913321.1|  PREDICTED: CCR4-NOT transcription complex su...    224   1e-62   Elaeis guineensis
ref|XP_008389696.1|  PREDICTED: CCR4-NOT transcription complex su...    221   3e-62   
gb|KJB23621.1|  hypothetical protein B456_004G107500                    223   4e-62   Gossypium raimondii
ref|XP_009363975.1|  PREDICTED: CCR4-NOT transcription complex su...    220   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_008242819.1|  PREDICTED: CCR4-NOT transcription complex su...    218   8e-61   Prunus mume [ume]
ref|XP_010090188.1|  CCR4-NOT transcription complex subunit 10          218   2e-60   
gb|EYU34972.1|  hypothetical protein MIMGU_mgv1a001701mg                216   3e-60   Erythranthe guttata [common monkey flower]
ref|XP_007204657.1|  hypothetical protein PRUPE_ppa001423mg             216   8e-60   
ref|XP_009420726.1|  PREDICTED: CCR4-NOT transcription complex su...    216   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420725.1|  PREDICTED: CCR4-NOT transcription complex su...    216   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007204658.1|  hypothetical protein PRUPE_ppa001423mg             215   1e-59   Prunus persica
ref|XP_002531955.1|  conserved hypothetical protein                     215   1e-59   
ref|XP_009340640.1|  PREDICTED: CCR4-NOT transcription complex su...    215   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_004287280.2|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    213   5e-59   Fragaria vesca subsp. vesca
emb|CDP10451.1|  unnamed protein product                                211   3e-58   Coffea canephora [robusta coffee]
ref|XP_008336988.1|  PREDICTED: CCR4-NOT transcription complex su...    211   5e-58   
ref|XP_010687919.1|  PREDICTED: CCR4-NOT transcription complex su...    209   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047986.1|  PREDICTED: CCR4-NOT transcription complex su...    208   4e-57   
gb|KCW80059.1|  hypothetical protein EUGRSUZ_C01387                     208   5e-57   Eucalyptus grandis [rose gum]
emb|CDY33691.1|  BnaC04g29600D                                          206   1e-56   Brassica napus [oilseed rape]
ref|XP_006306788.1|  hypothetical protein CARUB_v10008327mg             204   4e-56   Capsella rubella
ref|XP_006306789.1|  hypothetical protein CARUB_v10008327mg             205   5e-56   
gb|EYU18247.1|  hypothetical protein MIMGU_mgv1a001551mg                205   5e-56   Erythranthe guttata [common monkey flower]
ref|XP_010910864.1|  PREDICTED: CCR4-NOT transcription complex su...    202   1e-55   
emb|CDX74654.1|  BnaA04g07350D                                          203   2e-55   
ref|XP_010906725.1|  PREDICTED: CCR4-NOT transcription complex su...    203   2e-55   Elaeis guineensis
ref|XP_009124296.1|  PREDICTED: CCR4-NOT transcription complex su...    203   2e-55   Brassica rapa
ref|XP_009124280.1|  PREDICTED: CCR4-NOT transcription complex su...    202   2e-55   Brassica rapa
ref|XP_009124279.1|  PREDICTED: CCR4-NOT transcription complex su...    202   2e-55   Brassica rapa
ref|XP_008793964.1|  PREDICTED: CCR4-NOT transcription complex su...    202   3e-55   
ref|XP_008793962.1|  PREDICTED: CCR4-NOT transcription complex su...    202   5e-55   Phoenix dactylifera
ref|XP_010541904.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    202   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_008793963.1|  PREDICTED: CCR4-NOT transcription complex su...    201   6e-55   Phoenix dactylifera
ref|XP_010557608.1|  PREDICTED: CCR4-NOT transcription complex su...    201   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_008807048.1|  PREDICTED: CCR4-NOT transcription complex su...    200   2e-54   Phoenix dactylifera
ref|XP_010533130.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    199   6e-54   Tarenaya hassleriana [spider flower]
ref|XP_010480606.1|  PREDICTED: CCR4-NOT transcription complex su...    196   4e-53   
gb|EPS65667.1|  hypothetical protein M569_09110                         195   1e-52   Genlisea aurea
gb|EMS67321.1|  CCR4-NOT transcription complex subunit 10               193   6e-52   Triticum urartu
dbj|BAJ97945.1|  predicted protein                                      192   9e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002459892.1|  hypothetical protein SORBIDRAFT_02g013160          192   1e-51   Sorghum bicolor [broomcorn]
ref|XP_006403088.1|  hypothetical protein EUTSA_v10003437mg             191   3e-51   Eutrema salsugineum [saltwater cress]
ref|NP_001169495.1|  hypothetical protein                               190   3e-51   
ref|XP_008651723.1|  PREDICTED: hypothetical protein isoform X1         190   9e-51   
gb|EMT03772.1|  CCR4-NOT transcription complex subunit 10               188   3e-50   
dbj|BAB08702.1|  unnamed protein product                                184   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198393.2|  uncharacterized protein                               185   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282564.1|  hypothetical protein CARUB_v10004173mg             185   4e-49   Capsella rubella
ref|XP_002868420.1|  binding protein                                    185   5e-49   
ref|XP_010237317.1|  PREDICTED: CCR4-NOT transcription complex su...    184   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_003576897.1|  PREDICTED: CCR4-NOT transcription complex su...    184   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_010450377.1|  PREDICTED: CCR4-NOT transcription complex su...    177   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004956331.1|  PREDICTED: CCR4-NOT transcription complex su...    183   3e-48   Setaria italica
ref|XP_003571631.1|  PREDICTED: CCR4-NOT transcription complex su...    182   3e-48   Brachypodium distachyon [annual false brome]
gb|KFK22360.1|  hypothetical protein AALP_AAs57819U000100               182   4e-48   Arabis alpina [alpine rockcress]
ref|XP_006665031.1|  PREDICTED: CCR4-NOT transcription complex su...    182   4e-48   Oryza brachyantha
ref|XP_010928522.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    181   7e-48   
ref|XP_010450378.1|  PREDICTED: CCR4-NOT transcription complex su...    181   2e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001062600.1|  Os09g0123100                                       180   3e-47   
gb|EEC84105.1|  hypothetical protein OsI_30425                          180   3e-47   Oryza sativa Indica Group [Indian rice]
gb|EEE69207.1|  hypothetical protein OsJ_28413                          180   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006856524.1|  PREDICTED: CCR4-NOT transcription complex su...    180   4e-47   Amborella trichopoda
ref|XP_010440719.1|  PREDICTED: CCR4-NOT transcription complex su...    179   7e-47   
ref|XP_010435435.1|  PREDICTED: CCR4-NOT transcription complex su...    179   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008668388.1|  PREDICTED: hypothetical protein isoform X1         175   1e-45   Zea mays [maize]
ref|NP_001169345.1|  hypothetical protein                               175   2e-45   Zea mays [maize]
ref|XP_002984433.1|  hypothetical protein SELMODRAFT_41131              121   1e-26   
ref|XP_002965785.1|  hypothetical protein SELMODRAFT_61158              119   4e-26   
ref|XP_001783331.1|  predicted protein                                  104   4e-21   
ref|XP_001781914.1|  predicted protein                                  104   6e-21   
gb|AEX11688.1|  hypothetical protein 0_16547_01                       85.9    6e-17   Pinus taeda
ref|XP_005827553.1|  hypothetical protein GUITHDRAFT_164635           66.2    1e-08   Guillardia theta CCMP2712
emb|CBJ25843.1|  conserved unknown protein                            64.3    6e-08   Ectocarpus siliculosus
ref|XP_002109023.1|  hypothetical protein TRIADDRAFT_52629            62.8    2e-07   Trichoplax adhaerens
ref|XP_001622526.1|  predicted protein                                62.8    2e-07   Nematostella vectensis
ref|XP_004603908.1|  PREDICTED: CCR4-NOT transcription complex su...  62.0    3e-07   Sorex araneus [Eurasian shrew]
ref|XP_009050918.1|  hypothetical protein LOTGIDRAFT_114420           62.0    3e-07   Lottia gigantea
gb|ETO78825.1|  hypothetical protein, variant 3                       62.0    3e-07   Phytophthora parasitica P1976
gb|ETO78822.1|  hypothetical protein F444_06345                       62.0    3e-07   Phytophthora parasitica P1976
gb|ETP47801.1|  hypothetical protein, variant 3                       62.0    4e-07   Phytophthora parasitica P10297
ref|XP_008891725.1|  hypothetical protein, variant 3                  62.0    4e-07   Phytophthora parasitica INRA-310
gb|ETP47798.1|  hypothetical protein F442_06328                       62.0    4e-07   Phytophthora parasitica P10297
ref|XP_008891724.1|  hypothetical protein PPTG_02404                  62.0    4e-07   Phytophthora parasitica INRA-310
gb|ETP47800.1|  hypothetical protein, variant 2                       62.0    4e-07   Phytophthora parasitica P10297
gb|ETO78824.1|  hypothetical protein, variant 2                       61.6    4e-07   Phytophthora parasitica P1976
ref|XP_008891727.1|  hypothetical protein, variant 2                  61.6    4e-07   Phytophthora parasitica INRA-310
ref|XP_004603907.1|  PREDICTED: CCR4-NOT transcription complex su...  61.6    5e-07   Sorex araneus [Eurasian shrew]
ref|XP_006823331.1|  PREDICTED: CCR4-NOT transcription complex su...  60.8    7e-07   Saccoglossus kowalevskii
ref|XP_009519310.1|  hypothetical protein PHYSODRAFT_480853           60.8    8e-07   Phytophthora sojae
ref|XP_001945509.2|  PREDICTED: CCR4-NOT transcription complex su...  60.8    9e-07   Acyrthosiphon pisum
ref|XP_004603909.1|  PREDICTED: CCR4-NOT transcription complex su...  60.5    1e-06   Sorex araneus [Eurasian shrew]
ref|XP_009077648.1|  PREDICTED: CCR4-NOT transcription complex su...  60.1    1e-06   Acanthisitta chloris
ref|XP_010182737.1|  PREDICTED: CCR4-NOT transcription complex su...  60.1    1e-06   Mesitornis unicolor
gb|KFP72367.1|  CCR4-NOT transcription complex subunit 10             60.1    1e-06   Acanthisitta chloris
ref|XP_011494326.1|  PREDICTED: CCR4-NOT transcription complex su...  60.1    1e-06   Ceratosolen solmsi marchali
ref|XP_002594087.1|  hypothetical protein BRAFLDRAFT_118793           60.1    1e-06   Branchiostoma floridae
ref|XP_010132750.1|  PREDICTED: CCR4-NOT transcription complex su...  59.7    2e-06   Buceros rhinoceros silvestris
ref|NP_001084582.1|  CCR4-NOT transcription complex subunit 10-B      59.7    2e-06   Xenopus laevis [clawed frog]
ref|XP_007614074.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    2e-06   
dbj|BAB14478.1|  unnamed protein product                              59.7    2e-06   Homo sapiens [man]
ref|XP_009508096.1|  PREDICTED: CCR4-NOT transcription complex su...  59.7    2e-06   Phalacrocorax carbo [common cormorant]
ref|XP_008546859.1|  PREDICTED: CCR4-NOT transcription complex su...  59.3    2e-06   Microplitis demolitor
ref|XP_004662037.1|  PREDICTED: CCR4-NOT transcription complex su...  59.3    3e-06   Jaculus jaculus
ref|XP_007628400.1|  PREDICTED: CCR4-NOT transcription complex su...  59.3    3e-06   
ref|XP_002901762.1|  CCR4-NOT transcription complex subunit, puta...  58.9    3e-06   Phytophthora infestans T30-4
ref|NP_001016273.1|  CCR4-NOT transcription complex, subunit 10       58.9    3e-06   Xenopus tropicalis [western clawed frog]
ref|XP_009485879.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    3e-06   Pelecanus crispus
ref|XP_006890682.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    3e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005075085.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    3e-06   
ref|XP_008936076.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    4e-06   Merops nubicus
ref|XP_008850151.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    4e-06   Nannospalax galili
gb|KFQ35636.1|  CCR4-NOT transcription complex subunit 10             58.9    4e-06   Mesitornis unicolor
ref|XP_008850152.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    4e-06   Nannospalax galili
ref|XP_005075084.1|  PREDICTED: CCR4-NOT transcription complex su...  58.9    4e-06   Mesocricetus auratus [Syrian golden hamster]
ref|XP_009958067.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    4e-06   Leptosomus discolor
ref|XP_008850156.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    4e-06   
ref|NP_001086651.1|  CCR4-NOT transcription complex subunit 10-A      58.9    4e-06   Xenopus laevis [clawed frog]
ref|XP_010165272.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    4e-06   Antrostomus carolinensis
ref|XP_005075083.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    4e-06   
gb|KFO88687.1|  CCR4-NOT transcription complex subunit 10             58.5    4e-06   Buceros rhinoceros silvestris
ref|XP_006890680.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    4e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004588305.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Ochotona princeps [southern American pika]
ref|XP_010202620.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Colius striatus
ref|XP_010711381.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   
ref|XP_009686200.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Struthio camelus australis
ref|XP_009820912.1|  hypothetical protein H257_00088                  58.5    5e-06   Aphanomyces astaci
ref|XP_005152908.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Melopsittacus undulatus
ref|NP_001006364.1|  CCR4-NOT transcription complex subunit 10        58.5    5e-06   Gallus gallus [bantam]
ref|XP_009820913.1|  hypothetical protein, variant 1                  58.5    5e-06   Aphanomyces astaci
ref|XP_004588307.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Ochotona princeps [southern American pika]
ref|XP_005242317.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Falco peregrinus [peregrine]
ref|XP_011594399.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Aquila chrysaetos canadensis
ref|XP_009820915.1|  hypothetical protein, variant 3                  58.2    5e-06   Aphanomyces astaci
ref|XP_010560711.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Haliaeetus leucocephalus
ref|XP_009989295.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Tauraco erythrolophus
ref|XP_005514069.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   
ref|XP_004588306.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Ochotona princeps [southern American pika]
ref|XP_009686199.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Struthio camelus australis
ref|XP_009896680.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Picoides pubescens
ref|XP_010397659.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   
emb|CAB56027.2|  hypothetical protein                                 57.0    5e-06   Homo sapiens [man]
ref|XP_009568705.1|  PREDICTED: CCR4-NOT transcription complex su...  58.5    5e-06   Cuculus canorus
ref|XP_009918257.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Haliaeetus albicilla
ref|XP_009936379.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Opisthocomus hoazin [hoatzin]
ref|XP_009820914.1|  hypothetical protein, variant 2                  58.2    5e-06   Aphanomyces astaci
ref|XP_009890276.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Charadrius vociferus
ref|XP_008632217.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Corvus brachyrhynchos
ref|XP_006030270.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Alligator sinensis
ref|XP_009464806.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    5e-06   Nipponia nippon
ref|XP_010121881.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Chlamydotis macqueenii
ref|XP_005481122.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
ref|XP_010005916.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Chaetura pelagica
ref|XP_005445960.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
ref|XP_002198182.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Taeniopygia guttata
ref|XP_009864642.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Apaloderma vittatum
ref|XP_003215704.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Anolis carolinensis [Carolina anole]
ref|XP_008931797.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
gb|ENN80040.1|  hypothetical protein YQE_03517                        58.2    6e-06   Dendroctonus ponderosae
ref|XP_009084396.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Serinus canaria [canary]
ref|XP_005519035.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009322480.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Pygoscelis adeliae
ref|XP_010560712.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Haliaeetus leucocephalus
dbj|BAE29186.1|  unnamed protein product                              58.2    6e-06   Mus musculus [mouse]
gb|KFV65664.1|  CCR4-NOT transcription complex subunit 10             58.2    6e-06   Picoides pubescens
ref|XP_009633458.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Egretta garzetta
ref|XP_009686198.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Struthio camelus australis
gb|EDL76985.1|  CCR4-NOT transcription complex, subunit 10, isofo...  58.2    6e-06   Rattus norvegicus [brown rat]
ref|XP_008502597.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Calypte anna
ref|NP_001007004.1|  CCR4-NOT transcription complex subunit 10        58.2    6e-06   Rattus norvegicus [brown rat]
ref|XP_011594400.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Aquila chrysaetos canadensis
ref|XP_005348101.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
ref|XP_005348100.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Microtus ochrogaster [prairie voles]
ref|XP_005018050.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
ref|XP_009286934.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   
ref|XP_010072903.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Pterocles gutturalis
ref|XP_010288588.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    6e-06   Phaethon lepturus
gb|KFU85082.1|  CCR4-NOT transcription complex subunit 10             58.2    6e-06   Chaetura pelagica
ref|XP_005423462.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    7e-06   Geospiza fortis
ref|XP_006512462.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    7e-06   Mus musculus [mouse]
ref|XP_008850155.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    7e-06   Nannospalax galili
ref|XP_005348099.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    7e-06   Microtus ochrogaster [prairie voles]
ref|XP_003772099.1|  PREDICTED: CCR4-NOT transcription complex su...  58.2    7e-06   
ref|XP_010305264.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    7e-06   Balearica regulorum gibbericeps
ref|XP_011241357.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    7e-06   
ref|XP_005041178.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    7e-06   Ficedula albicollis
ref|NP_705813.2|  CCR4-NOT transcription complex subunit 10           57.8    7e-06   Mus musculus [mouse]
emb|CDQ83463.1|  unnamed protein product                              57.8    7e-06   Oncorhynchus mykiss
gb|EDL09301.1|  CCR4-NOT transcription complex, subunit 10, isofo...  57.8    7e-06   Mus musculus [mouse]
ref|XP_004822254.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   
ref|XP_004774263.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   
ref|XP_010217630.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Tinamus guttatus
ref|XP_007191588.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Balaenoptera acutorostrata scammoni
ref|XP_004315390.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_007505291.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Monodelphis domestica
dbj|BAB15629.1|  unnamed protein product                              57.4    8e-06   Homo sapiens [man]
ref|XP_009703032.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Cariama cristata
ref|XP_004676406.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   
ref|XP_007946833.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Orycteropus afer afer
ref|XP_006159029.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    8e-06   Tupaia chinensis
ref|XP_006200674.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_004676405.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Condylura cristata
ref|XP_004419519.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004409038.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Odobenus rosmarus divergens
ref|XP_010957959.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Camelus bactrianus [camel]
ref|XP_011531870.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_006189322.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_006200673.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Vicugna pacos
ref|XP_008581862.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003895271.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Papio anubis [baboon]
ref|XP_003826179.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Pan paniscus [bonobo]
ref|XP_008540367.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Equus przewalskii [Przewalski horse]
gb|EFB27836.1|  hypothetical protein PANDA_007664                     57.8    9e-06   Ailuropoda melanoleuca
ref|XP_004279739.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Orcinus orca [Orca]
ref|XP_010957958.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Camelus bactrianus [camel]
ref|XP_004315391.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004033849.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_001491273.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Equus caballus [domestic horse]
ref|XP_011531869.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   Homo sapiens [man]
ref|XP_006159030.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_003826181.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Pan paniscus [bonobo]
ref|XP_008581870.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006159028.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Tupaia chinensis
ref|XP_004279740.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Orcinus orca [Orca]
ref|XP_008982218.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   Callithrix jacchus [common marmoset]
ref|XP_526163.2|  PREDICTED: CCR4-NOT transcription complex subun...  57.8    9e-06   
ref|XP_007464984.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   Lipotes vexillifer [baiji]
dbj|BAB14108.1|  unnamed protein product                              57.4    9e-06   Homo sapiens [man]
ref|NP_056257.1|  CCR4-NOT transcription complex subunit 10 isofo...  57.4    9e-06   Homo sapiens [man]
ref|XP_005317374.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   Ictidomys tridecemlineatus
sp|Q4R350.1|CNO10_MACFA  RecName: Full=CCR4-NOT transcription com...  57.4    9e-06   Macaca fascicularis [crab eating macaque]
ref|XP_005695576.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_007946830.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   Orycteropus afer afer
ref|XP_005695577.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_005600922.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_006200672.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_007125308.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_005971831.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...  57.4    9e-06   
ref|XP_002803093.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_003930969.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_002814004.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_007505289.1|  PREDICTED: CCR4-NOT transcription complex su...  57.8    9e-06   
ref|XP_007946831.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_011721603.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_009237517.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_007464982.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_003363193.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_009443351.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_004894453.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    9e-06   
ref|XP_005545595.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_003992325.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_002803094.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_011223028.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
gb|EHB09215.1|  CCR4-NOT transcription complex subunit 10             57.4    1e-05   
ref|XP_012002487.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_008982217.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_008708677.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_009200123.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005317375.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_007191589.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_009200125.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|NP_001243671.1|  CCR4-NOT transcription complex subunit 10 is...  57.4    1e-05   
ref|XP_002759752.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_001098415.2|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005278755.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_011721597.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_009200122.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006905784.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010352757.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006713147.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004419518.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010352758.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005317376.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
gb|EGW04710.1|  CCR4-NOT transcription complex subunit 10             57.4    1e-05   
ref|XP_007524105.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_003895273.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004894452.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010833848.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005383683.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
gb|KFQ63580.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
ref|XP_004471170.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004471172.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010627946.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005005341.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006905785.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|NP_001077224.1|  CCR4-NOT transcription complex subunit 10        57.4    1e-05   
ref|XP_005898199.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...  57.4    1e-05   
ref|XP_007067281.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006189321.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004676404.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004409037.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010627948.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_008152162.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006079654.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005383682.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005317373.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006859233.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006159027.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005877172.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004018252.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006159026.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010745100.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010745099.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_010815822.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
gb|KFO30919.1|  CCR4-NOT transcription complex subunit 10             57.4    1e-05   
ref|XP_010769582.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...  57.4    1e-05   
ref|XP_010627945.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_007067280.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005005339.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005383684.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_007505288.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005005340.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_007505290.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_008152169.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_005278756.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006079655.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_003473448.2|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006087634.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_004894451.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006087635.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_008264326.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006759656.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
ref|XP_006759655.1|  PREDICTED: CCR4-NOT transcription complex su...  57.4    1e-05   
dbj|BAH13647.1|  unnamed protein product                              57.4    1e-05   
gb|KGL73045.1|  CCR4-NOT transcription complex subunit 10             57.4    1e-05   
gb|ELK33323.1|  CCR4-NOT transcription complex subunit 10             57.4    1e-05   
ref|XP_004704268.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_004471171.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_006735730.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_005075086.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_006890681.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_009443352.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
ref|XP_005152909.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
gb|KDR12225.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
gb|KFW67199.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
gb|KFQ04864.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
gb|KFV88004.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
ref|XP_004352948.1|  tetratricopeptide repeat-containing protein      57.0    1e-05   
gb|KFO59368.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
gb|KFQ78119.1|  CCR4-NOT transcription complex subunit 10             57.0    1e-05   
ref|XP_007505286.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    1e-05   
gb|KGL98834.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
ref|XP_008850154.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    2e-05   
ref|XP_007505287.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    2e-05   
gb|KFW75965.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
gb|KFP43469.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
ref|XP_008502598.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    2e-05   
gb|KFR13517.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
ref|XP_004588308.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    2e-05   
ref|XP_007099115.1|  PREDICTED: CCR4-NOT transcription complex su...  57.0    2e-05   
gb|KFV07841.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
gb|KFP85902.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
gb|KFM13825.1|  CCR4-NOT transcription complex subunit 10             57.0    2e-05   
gb|KFP26255.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
gb|KFP08646.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
gb|ETE67300.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
gb|KFO70770.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
ref|XP_005242318.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_006030271.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
gb|KFV05719.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
ref|XP_006134396.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_001604234.2|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_009084397.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
gb|KFP12907.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
ref|XP_003781821.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_006713148.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
gb|KFQ98173.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
ref|XP_008472475.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    2e-05   
gb|KFO13107.1|  CCR4-NOT transcription complex subunit 10             56.6    2e-05   
ref|XP_007421427.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_010593835.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_007421426.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_011603463.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_003965772.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_006273308.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_005519036.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_010593833.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_005951204.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_005813836.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_010593834.1|  PREDICTED: CCR4-NOT transcription complex su...  56.6    2e-05   
ref|XP_005348102.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    2e-05   
ref|XP_004315392.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    2e-05   
ref|XP_004279741.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    2e-05   
gb|KFP67266.1|  CCR4-NOT transcription complex subunit 10             56.2    2e-05   
ref|XP_009812323.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    2e-05   
emb|CAG02775.1|  unnamed protein product                              56.2    3e-05   
ref|XP_011483229.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    3e-05   
ref|XP_004077691.1|  PREDICTED: CCR4-NOT transcription complex su...  56.2    3e-05   
ref|XP_003826180.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_010882979.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_005695578.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
gb|AAH02928.1|  CNOT10 protein                                        55.8    3e-05   
ref|XP_007067282.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_007946832.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_010352759.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_005317377.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|NP_001243670.1|  CCR4-NOT transcription complex subunit 10 is...  55.8    3e-05   
ref|XP_005545596.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_004419520.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_010957960.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_004409039.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_007669258.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_003776340.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_011312808.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_006200675.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_004676407.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_010882978.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_007524106.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_011531868.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_010882977.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    3e-05   
ref|XP_005853792.1|  CCR4-NOT transcription complex subunit 10        55.8    3e-05   
ref|XP_006087636.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    4e-05   
ref|XP_007899015.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    4e-05   
ref|XP_005005338.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    4e-05   
ref|XP_006936622.1|  PREDICTED: CCR4-NOT transcription complex su...  55.8    4e-05   
ref|XP_006189323.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    4e-05   
ref|XP_006936621.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    4e-05   
ref|XP_006936620.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    4e-05   
ref|XP_003256865.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    4e-05   
ref|XP_003256863.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    4e-05   
ref|XP_005754427.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    5e-05   
ref|XP_008322082.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    5e-05   
gb|AAH90438.1|  Cnot10 protein                                        53.9    5e-05   
ref|XP_004377406.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    5e-05   
ref|XP_005754426.1|  PREDICTED: CCR4-NOT transcription complex su...  55.5    5e-05   
ref|XP_004571390.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
ref|XP_011483230.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
ref|XP_005459446.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
ref|XP_008322081.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
ref|XP_004377405.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
gb|ELW47943.1|  CCR4-NOT transcription complex subunit 10             55.1    5e-05   
ref|XP_003454915.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    5e-05   
gb|EWM22463.1|  ccr4-not transcription complex subunit 10-like pr...  55.1    6e-05   
ref|XP_008301820.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    6e-05   
ref|XP_005754424.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    6e-05   
ref|XP_004571388.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    6e-05   
ref|XP_004571387.1|  PREDICTED: CCR4-NOT transcription complex su...  55.1    6e-05   
emb|CCI39781.1|  unnamed protein product                              55.1    7e-05   
ref|XP_006635589.1|  PREDICTED: CCR4-NOT transcription complex su...  54.7    7e-05   
gb|KFV55061.1|  CCR4-NOT transcription complex subunit 10             54.7    7e-05   
emb|CCA15594.1|  CCR4NOT transcription complex subunit putative       54.7    7e-05   
ref|XP_008301817.1|  PREDICTED: CCR4-NOT transcription complex su...  54.7    9e-05   
ref|XP_008431031.1|  PREDICTED: CCR4-NOT transcription complex su...  54.3    9e-05   
ref|XP_008301824.1|  PREDICTED: CCR4-NOT transcription complex su...  54.3    9e-05   
ref|XP_008301819.1|  PREDICTED: CCR4-NOT transcription complex su...  54.3    1e-04   
ref|XP_005545597.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_005157919.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_003256864.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_008301818.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_005157920.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_007250488.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_008301822.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_007250489.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    1e-04   
ref|XP_007544093.1|  PREDICTED: CCR4-NOT transcription complex su...  53.9    2e-04   
ref|XP_004377407.1|  PREDICTED: CCR4-NOT transcription complex su...  53.5    2e-04   



>ref|XP_009779024.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Nicotiana 
sylvestris]
Length=864

 Score =   270 bits (690),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 170/214 (79%), Gaps = 5/214 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            I +YE I RKEN M+EQA+LADLA+VELELG+PLRAL+ A+SLLK+ ECSKIY FLGNVY
Sbjct  650  ICEYEAIGRKENLMIEQAVLADLAFVELELGNPLRALTIAKSLLKVQECSKIYIFLGNVY  709

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL+RPKEA ++LS Y++  KGV+ PFSQED E WR EK +DSE++NGGS T+N 
Sbjct  710  AAEALCLLNRPKEAVDYLSTYIAGGKGVDLPFSQEDSEMWRQEKTLDSEDTNGGSATLNS  769

Query  615  ----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
                ESQ F FL PEEARG+LF NLAAMS +QGD++QA  YA+ A +I P+  +AILTA+
Sbjct  770  FPSEESQAFAFLNPEEARGMLFANLAAMSVMQGDIEQAQNYAVQALSIKPQRPEAILTAV  829

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDLL+G+  EA+ KL+ CS +RF+  S   NGS
Sbjct  830  YVDLLRGRAHEALIKLKHCSRIRFLPGSPTLNGS  863



>emb|CAN68892.1| hypothetical protein VITISV_029859 [Vitis vinifera]
Length=701

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QA LA+LAYVELEL +PL+ALSTA SLLKL +CS+I+TFLG+V
Sbjct  486  SIAVYEDICRRENQMIKQATLANLAYVELELQNPLKALSTAWSLLKLPDCSRIFTFLGHV  545

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALCLL+RPKEA++HLS YLS    VE P+S+ED E WR EK +D EE NGGS T  
Sbjct  546  YAAEALCLLNRPKEASDHLSTYLSGGNNVELPYSEEDREQWRAEKTMDCEEVNGGSLTGK  605

Query  621  ---MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
               + + QG  FLKPEEARG L+ NLA MSA+QG+L+QA  +   A +IIP S++ ILTA
Sbjct  606  NPSLEDLQGITFLKPEEARGTLYANLATMSAMQGELEQARQFVKQALSIIPNSSEVILTA  665

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNS  364
            +YVDL+ GKT+EA+AKL++CS VRF+ +S
Sbjct  666  VYVDLVXGKTQEALAKLKQCSHVRFLASS  694



>ref|XP_009613357.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Nicotiana 
tomentosiformis]
Length=864

 Score =   268 bits (686),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            I +YE   RKEN M+EQA+LADLA+VELELG+PLRAL+ A SLLK+ ECSKIY FLGNVY
Sbjct  650  ICEYEATGRKENLMIEQAVLADLAFVELELGNPLRALTIATSLLKVQECSKIYIFLGNVY  709

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL+RPKEA EHLS Y++  K V+ PFSQED E WR EK +D E++NGGS T+N 
Sbjct  710  AAEALCLLNRPKEAVEHLSTYIAGSKCVDLPFSQEDSEMWRQEKTLDFEDTNGGSATLNS  769

Query  615  ----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
                ESQ FVFLKPEEARG+LF NLAAMS +QGD++QA  YA+ A +  P+  +AILTA+
Sbjct  770  FPSEESQAFVFLKPEEARGMLFANLAAMSVMQGDIEQAQNYAVQALSTKPQRPEAILTAV  829

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDLL+G+++EA+ KL+ CS +RF+  S   NGS
Sbjct  830  YVDLLRGRSQEALTKLKHCSRIRFLPGSPTLNGS  863



>emb|CBI28248.3| unnamed protein product [Vitis vinifera]
Length=812

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QA LA+LAYVELEL +PL+ALSTA SLLKL +CS+I+TFLG+V
Sbjct  597  SIAVYEDICRRENQMIKQATLANLAYVELELQNPLKALSTAWSLLKLPDCSRIFTFLGHV  656

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALCLL+RPKEA++HLS YLS    VE P+S+ED E WR EK +D EE NGGS T  
Sbjct  657  YAAEALCLLNRPKEASDHLSTYLSGGNNVELPYSEEDREQWRAEKTMDCEEVNGGSLTGK  716

Query  621  ---MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
               + + QG  FLKPEEARG L+ NLA MSA+QG+L+QA  +   A +IIP S++ ILTA
Sbjct  717  NPSLEDLQGITFLKPEEARGTLYANLATMSAMQGELEQARQFVKQALSIIPNSSEVILTA  776

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNS  364
            +YVDL+ GKT+EA+AKL++CS VRF+ +S
Sbjct  777  VYVDLVHGKTQEALAKLKQCSHVRFLASS  805



>ref|XP_002282408.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Vitis vinifera]
Length=857

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 167/209 (80%), Gaps = 5/209 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QA LA+LAYVELEL +PL+ALSTA SLLKL +CS+I+TFLG+V
Sbjct  642  SIAVYEDICRRENQMIKQATLANLAYVELELQNPLKALSTAWSLLKLPDCSRIFTFLGHV  701

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALCLL+RPKEA++HLS YLS    VE P+S+ED E WR EK +D EE NGGS T  
Sbjct  702  YAAEALCLLNRPKEASDHLSTYLSGGNNVELPYSEEDREQWRAEKTMDCEEVNGGSLTGK  761

Query  621  ---MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
               + + QG  FLKPEEARG L+ NLA MSA+QG+L+QA  +   A +IIP S++ ILTA
Sbjct  762  NPSLEDLQGITFLKPEEARGTLYANLATMSAMQGELEQARQFVKQALSIIPNSSEVILTA  821

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNS  364
            +YVDL+ GKT+EA+AKL++CS VRF+ +S
Sbjct  822  VYVDLVHGKTQEALAKLKQCSHVRFLASS  850



>ref|XP_004242757.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Solanum 
lycopersicum]
Length=857

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+ +YE  CRKEN M+EQA LADLA+VELELG+PL+AL+ ARSLLK+ ECS+IY FLGNV
Sbjct  642  SLGEYEATCRKENLMIEQAALADLAFVELELGNPLKALTIARSLLKVQECSRIYIFLGNV  701

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R KEAAEHLS ++S  K V+ PFS+ED E WR EK ++SE++N GS  +N
Sbjct  702  YAAEALCLLNRAKEAAEHLSTFISSGKDVDLPFSEEDSEMWRQEKTLESEDTNVGSAAVN  761

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 ESQ FVF+KPEEARGILFTNLAAM+A+QGD++QA  Y + A +  P+  +AILTA
Sbjct  762  SFPSEESQAFVFVKPEEARGILFTNLAAMAAMQGDIEQAQTYVMQALSTKPQRPEAILTA  821

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +Y+DLL GKT+EA+ KL++CS +RF+ +S   +GS
Sbjct  822  VYLDLLCGKTQEALTKLKQCSRIRFLPSSPTLSGS  856



>ref|XP_012081192.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Jatropha curcas]
Length=726

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            + D+EDI R+ENQM++QALLA+LAYVELEL +P +ALSTA+SLL+L ECS+IYTFLG +Y
Sbjct  513  VSDFEDILRRENQMIKQALLANLAYVELELENPEKALSTAKSLLELPECSRIYTFLGRMY  572

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL++PKEAAEHLS Y S    VE PFSQED E WRVEK  D EE NGGS T+  
Sbjct  573  AAEALCLLNKPKEAAEHLSRYFSGGNSVELPFSQEDCERWRVEKTFDCEEPNGGSATVKN  632

Query  615  ----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
                ES+G VFLKPEEARGIL+ N A + A QGDL++AH +   A +++P S +A LTAI
Sbjct  633  SSSEESRGIVFLKPEEARGILYANFATLYAAQGDLERAHHFVTQALSLVPDSPEATLTAI  692

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDL+ GK++ A++KL++CS VRF+ + +  N S
Sbjct  693  YVDLMLGKSQAAISKLKQCSRVRFLPSHVQLNKS  726



>ref|XP_012081191.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Jatropha curcas]
Length=868

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            + D+EDI R+ENQM++QALLA+LAYVELEL +P +ALSTA+SLL+L ECS+IYTFLG +Y
Sbjct  655  VSDFEDILRRENQMIKQALLANLAYVELELENPEKALSTAKSLLELPECSRIYTFLGRMY  714

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL++PKEAAEHLS Y S    VE PFSQED E WRVEK  D EE NGGS T+  
Sbjct  715  AAEALCLLNKPKEAAEHLSRYFSGGNSVELPFSQEDCERWRVEKTFDCEEPNGGSATVKN  774

Query  615  ----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
                ES+G VFLKPEEARGIL+ N A + A QGDL++AH +   A +++P S +A LTAI
Sbjct  775  SSSEESRGIVFLKPEEARGILYANFATLYAAQGDLERAHHFVTQALSLVPDSPEATLTAI  834

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDL+ GK++ A++KL++CS VRF+ + +  N S
Sbjct  835  YVDLMLGKSQAAISKLKQCSRVRFLPSHVQLNKS  868



>ref|XP_012081190.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Jatropha curcas]
 gb|KDP30247.1| hypothetical protein JCGZ_17029 [Jatropha curcas]
Length=869

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 166/214 (78%), Gaps = 5/214 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            + D+EDI R+ENQM++QALLA+LAYVELEL +P +ALSTA+SLL+L ECS+IYTFLG +Y
Sbjct  656  VSDFEDILRRENQMIKQALLANLAYVELELENPEKALSTAKSLLELPECSRIYTFLGRMY  715

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL++PKEAAEHLS Y S    VE PFSQED E WRVEK  D EE NGGS T+  
Sbjct  716  AAEALCLLNKPKEAAEHLSRYFSGGNSVELPFSQEDCERWRVEKTFDCEEPNGGSATVKN  775

Query  615  ----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
                ES+G VFLKPEEARGIL+ N A + A QGDL++AH +   A +++P S +A LTAI
Sbjct  776  SSSEESRGIVFLKPEEARGILYANFATLYAAQGDLERAHHFVTQALSLVPDSPEATLTAI  835

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDL+ GK++ A++KL++CS VRF+ + +  N S
Sbjct  836  YVDLMLGKSQAAISKLKQCSRVRFLPSHVQLNKS  869



>ref|XP_006358305.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Solanum 
tuberosum]
Length=860

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 168/215 (78%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+ +YE  CRKEN M+EQA LADLA+VELELG+ L+AL+ ARSLLK+ ECS+IY FLGNV
Sbjct  645  SLGEYEATCRKENLMIEQAALADLAFVELELGNALKALTIARSLLKVQECSRIYIFLGNV  704

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R KEAAEHLS Y+S  K V+ PFS+ED E W+ EK ++SE++N GS  +N
Sbjct  705  YAAEALCLLNRAKEAAEHLSTYISSGKDVDLPFSEEDSEMWKQEKTLESEDTNVGSAAVN  764

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 ESQ FVF+KPEE+RGILF NLAAMSA+ GD++QA  Y + A  I P+  +AILTA
Sbjct  765  SFPSEESQAFVFVKPEESRGILFANLAAMSAMLGDIEQAQTYVVQALLIKPQRPEAILTA  824

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GKT+EA+ KL++CS +RF+  S   +GS
Sbjct  825  VYVDLLCGKTQEALTKLKQCSRIRFLPGSPTLSGS  859



>ref|XP_007013546.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY31165.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=851

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 168/214 (79%), Gaps = 4/214 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YE ICR+ENQM++QALLA+LAYVELEL +PL+ALS ARSLL+L  CS+IY FLG+V
Sbjct  637  SISYYEGICRRENQMIKQALLANLAYVELELENPLKALSAARSLLELPGCSRIYIFLGHV  696

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            Y AEALCLL++PKEAAEHLS YLSE   VE PF QED E WRVEK VD EES G ++  N
Sbjct  697  YVAEALCLLNKPKEAAEHLSFYLSEGNNVELPFGQEDCEQWRVEKPVDCEESTGAASAKN  756

Query  615  ESQ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
             S      F+FL PEEARG L+ NLAA+SA+QG+L++AH +   A +++P S++A +TAI
Sbjct  757  PSPEGLVDFMFLNPEEARGTLYANLAAVSAIQGELERAHHFLRQALSLVPNSSEATMTAI  816

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            YVDL+ GK+++A++KL++CS VRF+ +SL  N S
Sbjct  817  YVDLMLGKSQDALSKLKRCSHVRFLPSSLQLNKS  850



>ref|XP_010250204.1| PREDICTED: CCR4-NOT transcription complex subunit 10-B-like [Nelumbo 
nucifera]
Length=845

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 163/207 (79%), Gaps = 8/207 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN M++QA+LADLAYVEL L +PL+ALS A+SLL+L ECS+IY FLG+V
Sbjct  638  SVSAYQDIYRRENNMIKQAILADLAYVELSLENPLKALSAAKSLLRLPECSRIYIFLGHV  697

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKG-VEQPFSQEDVEAWRVEKVVDSEESNGGSTTM  619
            YAAEALC L+R KEAAEHLS+Y+  I G VE P+S+ED E WRVEK  D E+SNGGS   
Sbjct  698  YAAEALCRLNRAKEAAEHLSVYI--IDGNVELPYSEEDREKWRVEKSGDGEDSNGGSVAS  755

Query  618  N-----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILT  454
            N     ESQG VFLKPEEARG L+ N A +SA+QG+LDQA+ +A  A A +P + +AILT
Sbjct  756  NNLPVEESQGIVFLKPEEARGTLYVNFATVSAIQGNLDQAYHFATKALATLPNNPRAILT  815

Query  453  AIYVDLLQGKTKEAVAKLRKCSSVRFI  373
            A YVDLLQGK++EA+ KL++CS VRF+
Sbjct  816  AAYVDLLQGKSQEALVKLKQCSHVRFV  842



>ref|XP_006453084.1| hypothetical protein CICLE_v10007427mg [Citrus clementina]
 ref|XP_006474416.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Citrus 
sinensis]
 gb|ESR66324.1| hypothetical protein CICLE_v10007427mg [Citrus clementina]
Length=854

 Score =   252 bits (643),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 167/210 (80%), Gaps = 5/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR+ENQM++QALLA+LAYVELE+ +P++AL+ ARSLL+L +CS+IY FLG++
Sbjct  639  SLSYYEDVCRRENQMIKQALLANLAYVELEMENPVKALAAARSLLELPDCSRIYIFLGHI  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGG-----  631
            YAAEALCLL+RPKEAAEH SMYLS     + PFS+ED E WRVEK++D EE NGG     
Sbjct  699  YAAEALCLLNRPKEAAEHFSMYLSGGDHFDLPFSREDCEQWRVEKIIDCEELNGGPAAAK  758

Query  630  STTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
            + +  +SQ  +F KPEEARG L+ N+AAM A+QG+ ++AH +   A +I+PRST+A LTA
Sbjct  759  NPSPEDSQDTMFPKPEEARGTLYVNIAAMFAMQGEFERAHHFVTQALSILPRSTEATLTA  818

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            IYVDL+ GK++EA+AKL+ C+ VRF+ + L
Sbjct  819  IYVDLMLGKSQEALAKLKHCNHVRFLPSGL  848



>gb|KHG25873.1| CCR4-NOT transcription complex subunit 10-B [Gossypium arboreum]
Length=866

 Score =   250 bits (639),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 168/218 (77%), Gaps = 8/218 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  + DICRKENQM++QALLA+LAY+ELEL +PL+ALS ARSLL+L  CS+IY FLG+V
Sbjct  648  SVAYFADICRKENQMMQQALLANLAYIELELENPLKALSAARSLLELPGCSRIYIFLGHV  707

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESN--GGSTT  622
            YAAEALCLL++PKEAAEHLS+YLS    VE PFSQED E W VEK +D EE N  GG+ T
Sbjct  708  YAAEALCLLNKPKEAAEHLSIYLSGPNKVESPFSQEDCEQWLVEKPIDCEEPNRGGGAVT  767

Query  621  MNE------SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAI  460
              +      +Q F+FLKPEEA G L+ NLAA+ A QG+LD+AH +   A +++P ST+A 
Sbjct  768  AAKNPSPEGTQEFMFLKPEEACGTLYANLAALYATQGELDRAHQFTTQALSLLPNSTEAT  827

Query  459  LTAIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +TAIY+DL+ GK++EA+ KL+ CS VRF+ ++L +N S
Sbjct  828  MTAIYIDLVLGKSQEALCKLKHCSHVRFLSSNLQSNKS  865



>gb|KJB23622.1| hypothetical protein B456_004G107500 [Gossypium raimondii]
Length=854

 Score =   249 bits (636),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 166/213 (78%), Gaps = 9/213 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QALLA+LAYVELEL +PL+ALS A++LL+L +CS+IY FLG+V
Sbjct  639  SISYYEDICRRENQMIKQALLANLAYVELELENPLKALSAAQALLELPDCSRIYVFLGHV  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            Y AEALCLL++PKEAAEHLS+YLS    ++ PF  ED E WRV+K +D EE+N G+    
Sbjct  699  YVAEALCLLNKPKEAAEHLSIYLSGESNIKLPFGLEDCEQWRVKKHIDCEEANVGAAAAK  758

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     + F+FLKPEEARG L+ NLAA+SA+QGDL++AH +   A +++P S++A +TA
Sbjct  759  NSSPEGLEDFMFLKPEEARGTLYANLAAVSAIQGDLERAHHFVTQALSLVPNSSEATMTA  818

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            IYVDL+ GK++EAV KL+ CS VRF    LP+N
Sbjct  819  IYVDLILGKSQEAVYKLKHCSHVRF----LPSN  847



>gb|KDO73490.1| hypothetical protein CISIN_1g003047mg [Citrus sinensis]
Length=854

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 166/210 (79%), Gaps = 5/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR+ENQM++QALLA+LAYVELE+ +P++AL+ ARSLL+L +CS+IY FLG++
Sbjct  639  SLSYYEDVCRRENQMIKQALLANLAYVELEMENPVKALAAARSLLELPDCSRIYIFLGHI  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGG-----  631
            YAAEALCLL+RPKEAAEH SMYLS     + PFS ED E WRVEK++D EE NGG     
Sbjct  699  YAAEALCLLNRPKEAAEHFSMYLSGGDNFDLPFSGEDCEQWRVEKIIDCEELNGGPAAAK  758

Query  630  STTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
            + +  +S+  +F KPEEARG L+ N+AAM A+QG+ ++AH +   A +I+PRST+A LTA
Sbjct  759  NPSPEDSRDTMFPKPEEARGTLYVNIAAMFAMQGEFERAHHFVTQALSILPRSTEATLTA  818

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            IYVDL+ GK++EA+AKL+ C+ VRF+ + L
Sbjct  819  IYVDLMLGKSQEALAKLKYCNHVRFLPSGL  848



>ref|XP_011020187.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Populus 
euphratica]
Length=862

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  +EDI R+ENQML+QALLA+LAYVELEL +P +ALSTARSLL+L  CS+IY FLG+V
Sbjct  648  SISFHEDIRRRENQMLKQALLANLAYVELELENPEKALSTARSLLELPVCSRIYIFLGHV  707

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGS----  628
            YAAEALCLL++PKEAAEHLS+YLS    VE PFSQED E WRVEK  D EE NGGS    
Sbjct  708  YAAEALCLLNKPKEAAEHLSIYLSGGNNVELPFSQEDFEQWRVEKAFDYEEMNGGSVATK  767

Query  627  -TTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             ++  ESQG VFL PEEARG L+TN A + A QGDL++AH +   A +++P   +A LTA
Sbjct  768  NSSPEESQGIVFLNPEEARGTLYTNFAVLCAAQGDLERAHHFVTQALSLVPNHPQATLTA  827

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
            +YVDL+   T+ A+ KL++CS VRF+
Sbjct  828  VYVDLMLCNTQAAIGKLKQCSRVRFL  853



>ref|XP_002308973.2| hypothetical protein POPTR_0006s06440g, partial [Populus trichocarpa]
 gb|EEE92496.2| hypothetical protein POPTR_0006s06440g, partial [Populus trichocarpa]
Length=649

 Score =   243 bits (621),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 158/206 (77%), Gaps = 5/206 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  +EDI R+ENQ+L+QALLA+LAYVELEL +P +ALSTARSLL+L  CS+IY FLG++
Sbjct  434  SISFHEDIRRRENQLLKQALLANLAYVELELENPEKALSTARSLLELPVCSRIYIFLGHL  493

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGS----  628
            YAAEALC+L++PKEAAEHLS+YLS    VE PFSQED E WRVEK  D EE NGGS    
Sbjct  494  YAAEALCMLNKPKEAAEHLSIYLSGGNNVELPFSQEDFEQWRVEKAFDYEEMNGGSVATK  553

Query  627  -TTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             ++  ESQG VFL PEEARG L+TN A + A QGDL++AH +   A +++P   +A LTA
Sbjct  554  NSSPEESQGIVFLNPEEARGTLYTNFAVLCAAQGDLERAHHFVTQALSLVPNHPQATLTA  613

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
            +YVDL+   ++ A+ KL++CS VRF+
Sbjct  614  VYVDLMLCNSQAAIGKLKQCSRVRFL  639



>ref|XP_002325199.2| hypothetical protein POPTR_0018s12640g [Populus trichocarpa]
 gb|EEF03764.2| hypothetical protein POPTR_0018s12640g [Populus trichocarpa]
Length=603

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 159/215 (74%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  +EDI R+ENQM++QALLA+LAYVELEL +P +ALS ARSLL+L  CS+IY FLG+V
Sbjct  388  SISFHEDIRRRENQMIKQALLANLAYVELELENPEKALSNARSLLELPVCSRIYIFLGHV  447

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL +PKEAAEHLS+YLS    V  PFSQ+D   WRVEK  D EE NGGS T  
Sbjct  448  YAAEALCLLDKPKEAAEHLSIYLSGGNNVGLPFSQDDYVQWRVEKAFDYEELNGGSITAK  507

Query  618  ----NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                +ESQG VFL PEEA G L+ N AAM A QGDL++AH +   A +++P   +A LTA
Sbjct  508  NSSPDESQGIVFLNPEEACGTLYANFAAMYAAQGDLERAHHFVTQALSLVPNRPEATLTA  567

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDL+ G ++ AVAKL++CS VRF+ + +  N S
Sbjct  568  VYVDLMLGNSQAAVAKLKQCSRVRFLPSDVQLNNS  602



>ref|XP_011017835.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Populus 
euphratica]
Length=861

 Score =   245 bits (625),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 162/213 (76%), Gaps = 5/213 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  +EDI R+ENQM++QALLA+LAYVELEL +P +ALS ARSLL+L  CS+IY FLG+V
Sbjct  647  SISFHEDIRRRENQMIKQALLANLAYVELELENPEKALSNARSLLELPVCSRIYIFLGHV  706

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGS----  628
            YAAEALCLL++PKEAAEHLS+YLS    VE PFSQ+D E WRVEK  D +E NGGS    
Sbjct  707  YAAEALCLLNKPKEAAEHLSVYLSGGNNVELPFSQDDYEQWRVEKAFDYDELNGGSISAK  766

Query  627  -TTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             ++ +ESQG VFL PEEARG L+ N AAM A QGDL++A  +A  A ++IP   +A LTA
Sbjct  767  NSSPDESQGIVFLNPEEARGTLYANFAAMYAAQGDLERAQHFATQALSLIPNRPEATLTA  826

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            +YVDL+ G ++  VAKL++CS +RF+ + +  N
Sbjct  827  VYVDLMLGNSQAVVAKLKQCSRLRFLPSDVQLN  859



>gb|KJB83205.1| hypothetical protein B456_013G235300 [Gossypium raimondii]
Length=799

 Score =   243 bits (620),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 166/219 (76%), Gaps = 9/219 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  + DICRKENQM++QALLA+LAYVELEL +PL+ALS ARSLL+L  CS+IY FLG+V
Sbjct  580  SVAYFADICRKENQMMKQALLANLAYVELELENPLKALSAARSLLELPGCSRIYIFLGHV  639

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL++PKEA EHLS+YLS    VE PFSQED E W  EK +D EE NGG     
Sbjct  640  YAAEALCLLNKPKEAVEHLSIYLSGPNKVESPFSQEDCEQWLTEKPIDCEEPNGGGGGAA  699

Query  618  ----NES----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKA  463
                N S    Q F+FLKPEEA G L+ NLAA+ A QG+LD+AH +   A +++P ST+A
Sbjct  700  TAAKNPSPEGMQEFMFLKPEEACGTLYANLAALYATQGELDRAHQFTTQALSLLPNSTEA  759

Query  462  ILTAIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
             +TAIY+DL+ GK++EA++KL++CS VRF+ ++L +N S
Sbjct  760  TMTAIYIDLVLGKSQEALSKLKRCSHVRFLSSNLQSNKS  798



>gb|KJB83204.1| hypothetical protein B456_013G235300 [Gossypium raimondii]
Length=833

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 166/219 (76%), Gaps = 9/219 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  + DICRKENQM++QALLA+LAYVELEL +PL+ALS ARSLL+L  CS+IY FLG+V
Sbjct  614  SVAYFADICRKENQMMKQALLANLAYVELELENPLKALSAARSLLELPGCSRIYIFLGHV  673

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL++PKEA EHLS+YLS    VE PFSQED E W  EK +D EE NGG     
Sbjct  674  YAAEALCLLNKPKEAVEHLSIYLSGPNKVESPFSQEDCEQWLTEKPIDCEEPNGGGGGAA  733

Query  618  ----NES----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKA  463
                N S    Q F+FLKPEEA G L+ NLAA+ A QG+LD+AH +   A +++P ST+A
Sbjct  734  TAAKNPSPEGMQEFMFLKPEEACGTLYANLAALYATQGELDRAHQFTTQALSLLPNSTEA  793

Query  462  ILTAIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
             +TAIY+DL+ GK++EA++KL++CS VRF+ ++L +N S
Sbjct  794  TMTAIYIDLVLGKSQEALSKLKRCSHVRFLSSNLQSNKS  832



>gb|KHF99103.1| CCR4-NOT transcription complex subunit 10-B [Gossypium arboreum]
Length=919

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 160/203 (79%), Gaps = 5/203 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            I  YEDICR+ENQM++QALLA+LAYVELEL +PL+ALS AR+LL+L  CS+IY FLG+VY
Sbjct  681  ISYYEDICRRENQMIKQALLANLAYVELELENPLKALSAARALLELPGCSRIYVFLGHVY  740

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE  613
             AEALCLL++PKEAAEHLS+YLS    +E PF  ED E WRV+K +D EE+N G+     
Sbjct  741  LAEALCLLNKPKEAAEHLSIYLSGESNIELPFGLEDCEQWRVKKHIDCEEANVGAAAAKN  800

Query  612  S-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
            S     + F+FLKP+EARG L+ NLAA+SA+QGDL++AH +   A +++P S++A +TAI
Sbjct  801  SSPEGLEDFMFLKPDEARGTLYANLAAVSAIQGDLERAHHFVTQALSLVPDSSEATMTAI  860

Query  447  YVDLLQGKTKEAVAKLRKCSSVR  379
            YVDL+ GK++EAV+KL+ CS VR
Sbjct  861  YVDLMLGKSQEAVSKLKHCSHVR  883



>gb|KJB83203.1| hypothetical protein B456_013G235300 [Gossypium raimondii]
Length=858

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 166/219 (76%), Gaps = 9/219 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  + DICRKENQM++QALLA+LAYVELEL +PL+ALS ARSLL+L  CS+IY FLG+V
Sbjct  639  SVAYFADICRKENQMMKQALLANLAYVELELENPLKALSAARSLLELPGCSRIYIFLGHV  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL++PKEA EHLS+YLS    VE PFSQED E W  EK +D EE NGG     
Sbjct  699  YAAEALCLLNKPKEAVEHLSIYLSGPNKVESPFSQEDCEQWLTEKPIDCEEPNGGGGGAA  758

Query  618  ----NES----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKA  463
                N S    Q F+FLKPEEA G L+ NLAA+ A QG+LD+AH +   A +++P ST+A
Sbjct  759  TAAKNPSPEGMQEFMFLKPEEACGTLYANLAALYATQGELDRAHQFTTQALSLLPNSTEA  818

Query  462  ILTAIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
             +TAIY+DL+ GK++EA++KL++CS VRF+ ++L +N S
Sbjct  819  TMTAIYIDLVLGKSQEALSKLKRCSHVRFLSSNLQSNKS  857



>ref|XP_004508459.1| PREDICTED: CCR4-NOT transcription complex subunit 10-A-like isoform 
X2 [Cicer arietinum]
Length=843

 Score =   241 bits (614),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR+ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  628  SLSYYEDLCRRENQLVKQAVLANLAYVELELDNPVKALSAAKSLLELPECSRIYIFLGHV  687

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST---  625
            YAAEALCLL+RPKEAAE LS YLS    VE PFSQED E   VE+ V+ EE NGGST   
Sbjct  688  YAAEALCLLNRPKEAAELLSYYLSGGNNVELPFSQEDCEKRVVERAVEFEEVNGGSTAAK  747

Query  624  --TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
              ++ ++Q  +FLKPEEAR  ++ N AAMSA+QG+ ++A+     A +I+P S +A LTA
Sbjct  748  NSSLQDTQSIIFLKPEEARAAIYANFAAMSAMQGEFEKANILVTQALSILPNSPEATLTA  807

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+A+L+ CS +RF+ +   +N S
Sbjct  808  VYVDLLLGKPQEALARLKSCSRIRFLPSETTSNKS  842



>ref|XP_004508458.1| PREDICTED: CCR4-NOT transcription complex subunit 10-A-like isoform 
X1 [Cicer arietinum]
Length=844

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR+ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  629  SLSYYEDLCRRENQLVKQAVLANLAYVELELDNPVKALSAAKSLLELPECSRIYIFLGHV  688

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST---  625
            YAAEALCLL+RPKEAAE LS YLS    VE PFSQED E   VE+ V+ EE NGGST   
Sbjct  689  YAAEALCLLNRPKEAAELLSYYLSGGNNVELPFSQEDCEKRVVERAVEFEEVNGGSTAAK  748

Query  624  --TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
              ++ ++Q  +FLKPEEAR  ++ N AAMSA+QG+ ++A+     A +I+P S +A LTA
Sbjct  749  NSSLQDTQSIIFLKPEEARAAIYANFAAMSAMQGEFEKANILVTQALSILPNSPEATLTA  808

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+A+L+ CS +RF+ +   +N S
Sbjct  809  VYVDLLLGKPQEALARLKSCSRIRFLPSETTSNKS  843



>gb|KHN15056.1| CCR4-NOT transcription complex subunit 10 [Glycine soja]
Length=571

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 160/215 (74%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++ ++ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  356  SLSYYENVRKRENQLVKQAVLANLAYVELELDNPVKALSVAKSLLELPECSRIYIFLGHV  415

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCL++RPKEAAEHLS YLS    V+ PFS ED E W+ E+  D +E NGGSTT  
Sbjct  416  YAAEALCLMNRPKEAAEHLSFYLSGGNNVDLPFSLEDCEKWQPERTADFDEVNGGSTTAK  475

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ ++++     A +I+P S +A LTA
Sbjct  476  NSSLEGTQSIVFLKPEEARATIYANFAVMSAMQGEFEKSNILVAQALSILPNSPEATLTA  535

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDL+ GK +EA+ KL++CS +RF+ + +  N S
Sbjct  536  VYVDLMLGKPQEALTKLKRCSRIRFLPSGITLNKS  570



>ref|XP_011084121.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Sesamum 
indicum]
Length=857

 Score =   238 bits (608),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 162/216 (75%), Gaps = 6/216 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI +YE I  KENQM++Q  LADLAYVEL LG+PL+ALS A+SL+KL +CSKIY FLG +
Sbjct  641  SITEYEHIRMKENQMMKQTALADLAYVELALGNPLKALSAAKSLIKLPDCSKIYIFLGTM  700

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALCLL++P EA E+L MY+S    +E P+SQED E WRVEKVVD +E NGG+T   
Sbjct  701  YAAEALCLLNKPNEAGEYLMMYVSGGNNIELPYSQEDCEKWRVEKVVDGDELNGGTTVPS  760

Query  621  ----MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILT  454
                 +ESQG +FL P EARG+   N AA  A+ GDL++AH + + A + IP S++AILT
Sbjct  761  AVSLADESQGSMFLSPVEARGMFCANYAANFALLGDLERAHHFVIKALSDIPNSSQAILT  820

Query  453  AIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            AIYVDL +GKT++A++KL++ + +RF+  SL  NGS
Sbjct  821  AIYVDLKRGKTQDALSKLKQHTGIRFLPGSLTVNGS  856



>gb|AES91602.2| CCR4-NOT transcription complex subunit-like protein [Medicago 
truncatula]
Length=857

 Score =   238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR++NQ+++QA+LA+LAYVELEL +P++AL+ A+SL +L ECS+IY FLG+V
Sbjct  642  SLSYYEDVCRRDNQLVKQAVLANLAYVELELDNPVKALAAAKSLFELPECSRIYIFLGHV  701

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST---  625
            YAAEALCLL+RPKEAA++LS YLS    VE PFSQ+D E  +VE+ V+ E+ NGGST   
Sbjct  702  YAAEALCLLNRPKEAADYLSYYLSGGNSVELPFSQDDCEKLQVERTVEFEDGNGGSTAAK  761

Query  624  --TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
              ++ + Q  VFLKPEEAR  ++ N A MSA+QG+L++A+     A +I+P S +A LTA
Sbjct  762  NSSLQDPQSIVFLKPEEARASIYANFAVMSAMQGELEKANILVTQALSILPNSPEATLTA  821

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+AKL+ CS +RF+ + +  N S
Sbjct  822  VYVDLLLGKPQEALAKLKSCSRIRFLPSGVSLNKS  856



>ref|XP_003549742.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Glycine max]
Length=857

 Score =   237 bits (604),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 160/215 (74%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++ ++ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  642  SLSYYENVRKRENQLVKQAVLANLAYVELELDNPVKALSVAKSLLELPECSRIYIFLGHV  701

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAAEHLS YLS    V+ PFS ED E W+ E+  D +E NGGSTT  
Sbjct  702  YAAEALCLLNRPKEAAEHLSFYLSGGNNVDLPFSLEDCEKWQPERTADFDEVNGGSTTAK  761

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ ++++     A +I+P S +A LTA
Sbjct  762  NSSLEGTQSIVFLKPEEARATIYANFAVMSAMQGEFEKSNILVAQALSILPNSPEATLTA  821

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDL+ GK +EA+ KL++CS +RF+ + +  N S
Sbjct  822  VYVDLMLGKPQEALTKLKRCSRIRFLPSGITLNKS  856



>ref|XP_003609405.1| CCR4-NOT transcription complex subunit 10-B [Medicago truncatula]
Length=881

 Score =   236 bits (602),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 160/206 (78%), Gaps = 5/206 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR++NQ+++QA+LA+LAYVELEL +P++AL+ A+SL +L ECS+IY FLG+V
Sbjct  642  SLSYYEDVCRRDNQLVKQAVLANLAYVELELDNPVKALAAAKSLFELPECSRIYIFLGHV  701

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST---  625
            YAAEALCLL+RPKEAA++LS YLS    VE PFSQ+D E  +VE+ V+ E+ NGGST   
Sbjct  702  YAAEALCLLNRPKEAADYLSYYLSGGNSVELPFSQDDCEKLQVERTVEFEDGNGGSTAAK  761

Query  624  --TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
              ++ + Q  VFLKPEEAR  ++ N A MSA+QG+L++A+     A +I+P S +A LTA
Sbjct  762  NSSLQDPQSIVFLKPEEARASIYANFAVMSAMQGELEKANILVTQALSILPNSPEATLTA  821

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
            +YVDLL GK +EA+AKL+ CS +RF+
Sbjct  822  VYVDLLLGKPQEALAKLKSCSRIRFL  847



>gb|KJB64702.1| hypothetical protein B456_010G061100 [Gossypium raimondii]
 gb|KJB64703.1| hypothetical protein B456_010G061100 [Gossypium raimondii]
Length=855

 Score =   236 bits (601),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDI R+ENQM++QALLA+LAYVELEL +PL+ALS A  LL+L  CS+IY FLG+V
Sbjct  640  SISYYEDIRRRENQMIKQALLANLAYVELELDNPLKALSAALLLLELPGCSRIYIFLGHV  699

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL++PKEAAEHL++YLS    +E PFSQED E WRVEK VD EE  GG+    
Sbjct  700  YAAEALCLLNKPKEAAEHLAIYLSGGNNIELPFSQEDFEQWRVEKPVDCEEPIGGAAAAK  759

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                   Q F+FLKPEEARG L+TNLAA+SA+QG+L++AH +   A +++P S+KA +TA
Sbjct  760  NPSHEGLQEFMFLKPEEARGTLYTNLAAVSAIQGELERAHHFVTQALSLVPNSSKATMTA  819

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            IYVDL+ GK++EA+ KL+ CS VRF+ +SL  N S
Sbjct  820  IYVDLMLGKSQEALPKLKHCSHVRFLPSSLQLNKS  854



>ref|XP_003542639.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Glycine max]
Length=859

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 158/215 (73%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++  +ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  644  SLSCYENVRNRENQLVKQAVLANLAYVELELDNPVKALSVAKSLLELPECSRIYIFLGHV  703

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCL++RPKEAAEHLS YLS    V+ PFS ED E W+ E+  D EE NGGST   
Sbjct  704  YAAEALCLMNRPKEAAEHLSFYLSGGNNVDLPFSLEDCEKWQPERTADFEEVNGGSTAAK  763

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ ++++     A +++P S +A LTA
Sbjct  764  NSSLEGTQSIVFLKPEEARATIYANFAVMSAMQGEFEKSNILVAQALSLLPNSPEATLTA  823

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+ KL++CS +RF+ + +  N S
Sbjct  824  VYVDLLLGKPQEALTKLKRCSRIRFLPSGITLNKS  858



>gb|KHN03608.1| CCR4-NOT transcription complex subunit 10 [Glycine soja]
Length=859

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 158/215 (73%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++  +ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  644  SLSCYENVRNRENQLVKQAVLANLAYVELELDNPVKALSVAKSLLELPECSRIYIFLGHV  703

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCL++RPKEAAEHLS YLS    V+ PFS ED E W+ E+  D EE NGGST   
Sbjct  704  YAAEALCLMNRPKEAAEHLSFYLSGGNNVDLPFSLEDCEKWQPERTADFEEVNGGSTAAK  763

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ ++++     A +++P S +A LTA
Sbjct  764  NSSLEGTQSIVFLKPEEARATIYANFAVMSAMQGEFEKSNILVAQALSLLPNSPEATLTA  823

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+ KL++CS +RF+ + +  N S
Sbjct  824  VYVDLLLGKPQEALTKLKRCSRIRFLPSGITLNKS  858



>ref|XP_006594244.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Glycine max]
Length=860

 Score =   234 bits (596),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 158/215 (73%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++  +ENQ+++QA+LA+LAYVELEL +P++ALS A+SLL+L ECS+IY FLG+V
Sbjct  645  SLSCYENVRNRENQLVKQAVLANLAYVELELDNPVKALSVAKSLLELPECSRIYIFLGHV  704

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCL++RPKEAAEHLS YLS    V+ PFS ED E W+ E+  D EE NGGST   
Sbjct  705  YAAEALCLMNRPKEAAEHLSFYLSGGNNVDLPFSLEDCEKWQPERTADFEEVNGGSTAAK  764

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ ++++     A +++P S +A LTA
Sbjct  765  NSSLEGTQSIVFLKPEEARATIYANFAVMSAMQGEFEKSNILVAQALSLLPNSPEATLTA  824

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +YVDLL GK +EA+ KL++CS +RF+ + +  N S
Sbjct  825  VYVDLLLGKPQEALTKLKRCSRIRFLPSGITLNKS  859



>gb|KHG02249.1| CCR4-NOT transcription complex subunit 10 [Gossypium arboreum]
Length=855

 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 165/215 (77%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDI R+ENQM++QALLA+LAYVELEL +PL+ALS A  LL+L  CS+IY FLG+V
Sbjct  640  SISYYEDIHRRENQMIKQALLANLAYVELELDNPLKALSAALLLLELPGCSRIYIFLGHV  699

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL++PKEAAEHL++YLS    +E PFSQ+D E WRVEK VD EE  GG+    
Sbjct  700  YAAEALCLLNKPKEAAEHLAIYLSGGNNIELPFSQDDCEQWRVEKPVDCEEPIGGAAAAK  759

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                   Q F+FLKPEEARG L+TNLAAMSA+QG+L++AH +   A +++P S+KA +TA
Sbjct  760  NPSHEGLQEFMFLKPEEARGALYTNLAAMSAIQGELERAHHFVTQALSLVPNSSKATMTA  819

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            IYVDL+ GK++EA+ KL+  S VRF+ +SL  N S
Sbjct  820  IYVDLMLGKSQEALPKLKHGSHVRFLPSSLQLNKS  854



>ref|XP_007155052.1| hypothetical protein PHAVU_003G169000g [Phaseolus vulgaris]
 gb|ESW27046.1| hypothetical protein PHAVU_003G169000g [Phaseolus vulgaris]
Length=858

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 157/215 (73%), Gaps = 5/215 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE++ ++ENQ+++QA+LA+LAYVELEL +P++ALS ARSLL+L ECS+IY FLG+V
Sbjct  643  SLSYYENVRKRENQLVKQAVLANLAYVELELDNPVKALSVARSLLELPECSRIYIFLGHV  702

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAAEHLS YLS    V+ PFS +D E W+ E+  + EE N GS   N
Sbjct  703  YAAEALCLLNRPKEAAEHLSFYLSGGSNVDLPFSLDDCEKWQPERTAEFEEVNVGSVAAN  762

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     Q  VFLKPEEAR  ++ N A MSA+QG+ +++      A +I+P S +A +TA
Sbjct  763  NSSLEGAQSIVFLKPEEARATIYANFAVMSAMQGEFEKSSILITQALSILPNSPEATITA  822

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            +Y+DLL GK +EA+ KL++CS +RF+ + +  N S
Sbjct  823  VYLDLLLGKPQEALTKLKRCSRIRFLPSGITLNKS  857



>gb|KGN65121.1| hypothetical protein Csa_1G228970 [Cucumis sativus]
Length=777

 Score =   228 bits (580),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 156/210 (74%), Gaps = 5/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y++I R+EN +++QALLA+LAYVEL+LG+PLRAL+ ARSL++L E SK+YTFLG+V
Sbjct  562  SLSYYDEISRRENLLIKQALLANLAYVELKLGNPLRALTIARSLVELQESSKVYTFLGHV  621

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAA+HL  YL      + PFSQED E WR++   D E +NGGSTT N
Sbjct  622  YAAEALCLLNRPKEAADHLLYYLFGGVDFKLPFSQEDCELWRMDGTGDLEGANGGSTTAN  681

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 E     FL+PEEAR +L  N A +SA+QG+ ++A  +   A +I+P S +A LTA
Sbjct  682  ISSQEEPHHINFLRPEEARAVLLANFATVSALQGNFEEAKQFVSEALSIMPNSPEATLTA  741

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +YVDL  GK++EAVAKL++CS VRF+ + L
Sbjct  742  VYVDLALGKSQEAVAKLKQCSCVRFLPSGL  771



>ref|XP_008795858.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Phoenix 
dactylifera]
Length=855

 Score =   228 bits (580),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 151/211 (72%), Gaps = 10/211 (5%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CRKEN  + QA+L DLAYV L L DPL+AL   +SL +L +CSK+  FLG+V
Sbjct  637  SVAGYEDMCRKENHRIRQAVLGDLAYVGLCLEDPLKALVAVKSLQQLPDCSKMSLFLGHV  696

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGG-----  631
            YAAEALC L+RPKEAAE LS+Y+++ + VE P++ ED E W  EK  D EESNG      
Sbjct  697  YAAEALCCLNRPKEAAEQLSVYIADGQNVELPYTNEDREKWSDEKAADYEESNGSLTAKP  756

Query  630  -----STTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTK  466
                  TT+ ES+   FL P+EARG+L+ NLAAMSA+QGDL+QA  +A    + +P + +
Sbjct  757  TVEGTKTTIEESRDMGFLNPDEARGVLYVNLAAMSAMQGDLEQASHFAKQGLSSLPNNPR  816

Query  465  AILTAIYVDLLQGKTKEAVAKLRKCSSVRFI  373
             +L A+Y+DLLQGKT+EA+AKLRKC  VRF+
Sbjct  817  VLLAAVYMDLLQGKTQEALAKLRKCRRVRFL  847



>ref|XP_004150203.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Cucumis 
sativus]
Length=853

 Score =   228 bits (580),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 156/210 (74%), Gaps = 5/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y++I R+EN +++QALLA+LAYVEL+LG+PLRAL+ ARSL++L E SK+YTFLG+V
Sbjct  638  SLSYYDEISRRENLLIKQALLANLAYVELKLGNPLRALTIARSLVELQESSKVYTFLGHV  697

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAA+HL  YL      + PFSQED E WR++   D E +NGGSTT N
Sbjct  698  YAAEALCLLNRPKEAADHLLYYLFGGVDFKLPFSQEDCELWRMDGTGDLEGANGGSTTAN  757

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 E     FL+PEEAR +L  N A +SA+QG+ ++A  +   A +I+P S +A LTA
Sbjct  758  ISSQEEPHHINFLRPEEARAVLLANFATVSALQGNFEEAKQFVSEALSIMPNSPEATLTA  817

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +YVDL  GK++EAVAKL++CS VRF+ + L
Sbjct  818  VYVDLALGKSQEAVAKLKQCSCVRFLPSGL  847



>ref|XP_008443951.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Cucumis 
melo]
Length=853

 Score =   228 bits (580),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 157/210 (75%), Gaps = 5/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y++I R+EN +++QALLA+LAYVEL+LG+PLRAL+ ARSL++L E SK+YTFLG+V
Sbjct  638  SLSYYDEISRRENLLIKQALLANLAYVELKLGNPLRALTIARSLVELQESSKVYTFLGHV  697

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAA+HL  YLS     + PFSQED E WR++   D E +NGG TT N
Sbjct  698  YAAEALCLLNRPKEAADHLLYYLSGGVDFKLPFSQEDCELWRMDGTGDLEGANGGLTTAN  757

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S         FL+PEEAR +L +N A +SA+QG+ ++A  +   A +I+P S +A LTA
Sbjct  758  NSSQEDPHHINFLRPEEARAVLLSNFATVSALQGNYEEAKQFVSEALSIMPNSPEATLTA  817

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +YVDL  GK++EAVAKL++CS VRF+ + L
Sbjct  818  VYVDLALGKSQEAVAKLKQCSCVRFLPSGL  847



>ref|XP_010241578.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Nelumbo 
nucifera]
Length=846

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 162/206 (79%), Gaps = 6/206 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+D+ R+EN M++QA+LADLAYVEL L +PL+AL+ A+SLL+L ECS+IY FLG+V
Sbjct  639  SVSSYKDMYRRENNMIKQAVLADLAYVELNLENPLKALAAAKSLLRLPECSRIYIFLGHV  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGS----  628
            YAAEALC L+R  EAAEHLS+Y+++ K +E P+S+ED E WRVEK  + EE+NGGS    
Sbjct  699  YAAEALCCLNRLTEAAEHLSVYVTDGK-IELPYSEEDREKWRVEKGGEGEEANGGSLAPK  757

Query  627  -TTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 ESQG VFLKPEEARG L+ NLA MS +QGD+DQA  +A  A + +P + KA++TA
Sbjct  758  NQPAEESQGIVFLKPEEARGTLYVNLATMSIIQGDIDQAQRFATEALSALPNNPKAVVTA  817

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
            +YVDLLQGK++EA++KL++CS  RF+
Sbjct  818  VYVDLLQGKSQEALSKLKQCSHARFV  843



>ref|XP_010913323.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X3 [Elaeis guineensis]
Length=749

 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 146/212 (69%), Gaps = 11/212 (5%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CRKEN  + QA+L DLAYV L L DPL+AL  A+SL  L +CSK++ FLG+V
Sbjct  530  SVARYEDVCRKENHRIRQAVLGDLAYVGLCLEDPLKALVAAKSLQHLPDCSKMHLFLGHV  589

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALC L+RPKEAAE L +Y+++ + VE P++ ED E W  EK  D EESNG  T   
Sbjct  590  YAAEALCCLNRPKEAAEQLLVYIADGQNVELPYTNEDREKWSNEKAADYEESNGSLTAKT  649

Query  615  ESQG-----------FVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRST  469
              +G             FLKP+EARG L+ NLAAMSA+QGDL QA  +A    + +P S 
Sbjct  650  TVEGTKTTVEGSRDIMGFLKPDEARGALYVNLAAMSAIQGDLGQASHFAKQGLSSLPNSP  709

Query  468  KAILTAIYVDLLQGKTKEAVAKLRKCSSVRFI  373
            + +L  +YVDLLQGKT+EA+AKLRKC  VRF+
Sbjct  710  RVLLAVVYVDLLQGKTQEALAKLRKCRRVRFL  741



>ref|XP_009406653.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Musa 
acuminata subsp. malaccensis]
Length=845

 Score =   224 bits (572),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 151/203 (74%), Gaps = 2/203 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            ++  YE+ICRKEN M+ QA+L +LAYVEL LG+PL+ALS A+ L +L +CS++Y FL +V
Sbjct  634  ALSSYEEICRKENNMIRQAVLGNLAYVELSLGNPLKALSAAKELRQLSDCSRMYIFLSHV  693

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG--GSTT  622
            YAAEALC L+RP+EAAE+LS Y+ E   V+ P+S ++ E WR+++  D +E NG   + T
Sbjct  694  YAAEALCYLNRPEEAAEYLSFYVLEENDVQLPYSDKEREKWRIDRNGDGDELNGQHNAKT  753

Query  621  MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYV  442
              E QG +F+KPEEARG+L+ NLAA+SAVQG+++QA      A + +P + +A+L AIYV
Sbjct  754  SEEFQGMMFMKPEEARGVLYVNLAAISAVQGNVEQASLLVKKALSALPTNPRAVLAAIYV  813

Query  441  DLLQGKTKEAVAKLRKCSSVRFI  373
            DLL G+T +AV KLR+C  VRF 
Sbjct  814  DLLSGRTPDAVVKLRQCRHVRFF  836



>ref|XP_010913322.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Elaeis guineensis]
Length=803

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 146/212 (69%), Gaps = 11/212 (5%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CRKEN  + QA+L DLAYV L L DPL+AL  A+SL  L +CSK++ FLG+V
Sbjct  584  SVARYEDVCRKENHRIRQAVLGDLAYVGLCLEDPLKALVAAKSLQHLPDCSKMHLFLGHV  643

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALC L+RPKEAAE L +Y+++ + VE P++ ED E W  EK  D EESNG  T   
Sbjct  644  YAAEALCCLNRPKEAAEQLLVYIADGQNVELPYTNEDREKWSNEKAADYEESNGSLTAKT  703

Query  615  ESQG-----------FVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRST  469
              +G             FLKP+EARG L+ NLAAMSA+QGDL QA  +A    + +P S 
Sbjct  704  TVEGTKTTVEGSRDIMGFLKPDEARGALYVNLAAMSAIQGDLGQASHFAKQGLSSLPNSP  763

Query  468  KAILTAIYVDLLQGKTKEAVAKLRKCSSVRFI  373
            + +L  +YVDLLQGKT+EA+AKLRKC  VRF+
Sbjct  764  RVLLAVVYVDLLQGKTQEALAKLRKCRRVRFL  795



>gb|KJB23623.1| hypothetical protein B456_004G107500 [Gossypium raimondii]
Length=832

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QALLA+LAYVELEL +PL+ALS A++LL+L +CS+IY FLG+V
Sbjct  639  SISYYEDICRRENQMIKQALLANLAYVELELENPLKALSAAQALLELPDCSRIYVFLGHV  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            Y AEALCLL++PKEAAEHLS+YLS    ++ PF  ED E WRV+K +D EE+N G+    
Sbjct  699  YVAEALCLLNKPKEAAEHLSIYLSGESNIKLPFGLEDCEQWRVKKHIDCEEANVGAAAAK  758

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     + F+FLKPEEARG L+ NLAA+SA+QGDL++AH +   A +++P S++A +TA
Sbjct  759  NSSPEGLEDFMFLKPEEARGTLYANLAAVSAIQGDLERAHHFVTQALSLVPNSSEATMTA  818

Query  450  IYVDLLQG  427
            IYVDL+ G
Sbjct  819  IYVDLILG  826



>ref|XP_010913321.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Elaeis guineensis]
Length=856

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 146/212 (69%), Gaps = 11/212 (5%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CRKEN  + QA+L DLAYV L L DPL+AL  A+SL  L +CSK++ FLG+V
Sbjct  637  SVARYEDVCRKENHRIRQAVLGDLAYVGLCLEDPLKALVAAKSLQHLPDCSKMHLFLGHV  696

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALC L+RPKEAAE L +Y+++ + VE P++ ED E W  EK  D EESNG  T   
Sbjct  697  YAAEALCCLNRPKEAAEQLLVYIADGQNVELPYTNEDREKWSNEKAADYEESNGSLTAKT  756

Query  615  ESQG-----------FVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRST  469
              +G             FLKP+EARG L+ NLAAMSA+QGDL QA  +A    + +P S 
Sbjct  757  TVEGTKTTVEGSRDIMGFLKPDEARGALYVNLAAMSAIQGDLGQASHFAKQGLSSLPNSP  816

Query  468  KAILTAIYVDLLQGKTKEAVAKLRKCSSVRFI  373
            + +L  +YVDLLQGKT+EA+AKLRKC  VRF+
Sbjct  817  RVLLAVVYVDLLQGKTQEALAKLRKCRRVRFL  848



>ref|XP_008389696.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Malus 
domestica]
Length=693

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 151/209 (72%), Gaps = 4/209 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y D+  KEN +++QALLA+LAYVELEL +P++ALS ARSLL+L ECS+IY FLG+V
Sbjct  484  SLSYYADVRNKENLLIKQALLANLAYVELELENPMKALSIARSLLELPECSRIYIFLGHV  543

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPK+AA+HL  YLS    VE PFS+ED E  +  + VD EESNGGS    
Sbjct  544  YAAEALCLLNRPKDAADHLMTYLSGGNDVELPFSEEDCEQLQGIRAVDYEESNGGSMAAK  603

Query  615  ESQ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
             S     G VFLKPEEAR  L+ N AA+ A+QG+LDQA  +   A +I P S +A LTA+
Sbjct  604  NSSENRLGIVFLKPEEARANLYVNFAALYAMQGELDQACQFVAQALSITPNSPEATLTAV  663

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            YVDL  G ++EA+AKL++C  + F+ + L
Sbjct  664  YVDLKLGHSQEALAKLKQCGRITFVPSGL  692



>gb|KJB23621.1| hypothetical protein B456_004G107500 [Gossypium raimondii]
Length=850

 Score =   223 bits (567),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YEDICR+ENQM++QALLA+LAYVELEL +PL+ALS A++LL+L +CS+IY FLG+V
Sbjct  639  SISYYEDICRRENQMIKQALLANLAYVELELENPLKALSAAQALLELPDCSRIYVFLGHV  698

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            Y AEALCLL++PKEAAEHLS+YLS    ++ PF  ED E WRV+K +D EE+N G+    
Sbjct  699  YVAEALCLLNKPKEAAEHLSIYLSGESNIKLPFGLEDCEQWRVKKHIDCEEANVGAAAAK  758

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     + F+FLKPEEARG L+ NLAA+SA+QGDL++AH +   A +++P S++A +TA
Sbjct  759  NSSPEGLEDFMFLKPEEARGTLYANLAAVSAIQGDLERAHHFVTQALSLVPNSSEATMTA  818

Query  450  IYVDLL  433
            IYVDL+
Sbjct  819  IYVDLI  824



>ref|XP_009363975.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Pyrus 
x bretschneideri]
Length=831

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 151/209 (72%), Gaps = 4/209 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y D+  KEN +++QALLA+LAYVELEL +P++ALS ARSLL+L ECS+IY FLG+V
Sbjct  622  SLSYYADVRNKENLLIKQALLANLAYVELELENPMKALSIARSLLELPECSRIYIFLGHV  681

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPK+AA+HL  YLS    VE PFS+ED E  +  + VD EESNGGS    
Sbjct  682  YAAEALCLLNRPKDAADHLMTYLSGGNDVELPFSEEDCEQLQGVRAVDYEESNGGSMAAK  741

Query  615  ESQ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
             S     G  FLKPEEAR  L+ N AA+ A+QG+LDQA  +   A +I P S +A LTA+
Sbjct  742  NSSEDRLGIAFLKPEEARANLYVNFAALYAMQGELDQARQFVAQALSITPNSPEATLTAV  801

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            YVDL  G+++EA+AKL++C  + F+ + L
Sbjct  802  YVDLKLGQSQEALAKLKQCGRITFVPSGL  830



>ref|XP_008242819.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Prunus 
mume]
Length=832

 Score =   218 bits (556),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y DI  KEN +L+QALLA+LAYVELEL +P++ALS ARSLL+L ECS+IY FLG+VYAAE
Sbjct  621  YADIRNKENLLLKQALLANLAYVELELENPMKALSIARSLLELPECSRIYIFLGHVYAAE  680

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQ-  607
            ALCLL+R K+AA+HL  YLS    V+ PFS+ED E  +  + VD EE NGGS +   S  
Sbjct  681  ALCLLNRAKDAADHLMTYLSGGNNVDLPFSEEDSEQLQGVRAVDYEELNGGSMSAKSSSP  740

Query  606  ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVD  439
                G VFLKPEEA   L+ N AA+ A+QG+LDQA  +   A +I+P S +A LTA+YVD
Sbjct  741  EDTLGIVFLKPEEALASLYVNFAALYAMQGELDQARQFVAQALSIVPNSPEATLTAVYVD  800

Query  438  LLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            L  GK++EA+AKL++CS V F+ + L  N
Sbjct  801  LKLGKSQEALAKLKQCSRVTFLPSGLTLN  829



>ref|XP_010090188.1| CCR4-NOT transcription complex subunit 10 [Morus notabilis]
 gb|EXB39017.1| CCR4-NOT transcription complex subunit 10 [Morus notabilis]
Length=809

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 156/213 (73%), Gaps = 6/213 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED C++EN +++QALLA+LAY+ELELG+P++A   AR+L +L ECS++Y FLG++
Sbjct  595  SLTSYEDTCKRENMLIKQALLANLAYIELELGNPIKAHLNARALCELPECSRVYLFLGHI  654

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            +AAEALCLL+R KEA EHLS+YLSE   VE PFSQED E  +V++  D EE NGG  +  
Sbjct  655  FAAEALCLLNREKEAIEHLSIYLSE-GNVELPFSQEDCERGQVDRTGDCEELNGGQASAK  713

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S     +G VFLKPEEA   L+ N A++ A+QG+ + AH +   A ++ P S +A LTA
Sbjct  714  NSYSQDVEGIVFLKPEEAHAALYVNFASLYAMQGEFELAHQFVSQALSLTPNSPEANLTA  773

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            +Y++L+ GK +EA+AKL++CS +RF+ + L +N
Sbjct  774  VYINLMHGKPQEALAKLKQCSRIRFLSSGLTSN  806



>gb|EYU34972.1| hypothetical protein MIMGU_mgv1a001701mg [Erythranthe guttata]
Length=770

 Score =   216 bits (551),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            + DYE IC KE  M++QA LADLAYVEL LG+PL+AL+TA++LLKL ECS++Y FLG VY
Sbjct  562  VADYEYICTKEIHMIKQATLADLAYVELALGNPLKALTTAKTLLKLPECSRMYVFLGTVY  621

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE  613
            AAEALCLL+RP EA+E+L +Y S     E P+S+ED E W  EK+VDSE+SN  S T ++
Sbjct  622  AAEALCLLNRPNEASEYLLLYGSVGNNFELPYSREDCEKWTTEKLVDSEDSN--SVTTDK  679

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ  VF  PEEARGI   N AA  A+ GD + A  +   A + IP S +AILTA Y+DL 
Sbjct  680  SQVPVFSSPEEARGIFCANYAANFALLGDFELAQRFVTKALSDIPNSPQAILTATYLDLK  739

Query  432  QGKTKEAVAKLRKCSSVRFIHNSL  361
            +GK  EA+AKL++ S+VRF+ + L
Sbjct  740  RGKINEALAKLKRHSAVRFVPSGL  763



>ref|XP_007204657.1| hypothetical protein PRUPE_ppa001423mg [Prunus persica]
 gb|EMJ05856.1| hypothetical protein PRUPE_ppa001423mg [Prunus persica]
Length=808

 Score =   216 bits (549),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y DI  KEN +L+QALLA+LA+VELEL +P++ALS ARSLL+L ECS+IY FLG+VYAAE
Sbjct  597  YADIRNKENLLLKQALLANLAFVELELENPIKALSIARSLLELPECSRIYIFLGHVYAAE  656

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQ-  607
            ALCLL+R K+AA+HL  YLS    V+ PFS+ED E  +  + VD EE NGGS +   S  
Sbjct  657  ALCLLNRAKDAADHLMTYLSGGNNVDLPFSEEDSEQLQGVRAVDYEELNGGSMSAKSSSP  716

Query  606  ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVD  439
                G VFLKPEEA   L+ N AA+ A+QG+LDQA  +   A +++P S +A LTA+YVD
Sbjct  717  EDTLGIVFLKPEEALASLYVNFAALYAMQGELDQARQFVARALSLVPNSPEATLTAVYVD  776

Query  438  LLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            L  GK++EA+AKL++CS V F+ + L  N
Sbjct  777  LKLGKSQEALAKLKQCSRVTFLPSGLTLN  805



>ref|XP_009420726.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=845

 Score =   216 bits (549),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE+ICRKE  M++Q +L +LAYVEL LG+PL+ALS A+ L +L  CS++Y FL +V
Sbjct  634  SLSSYEEICRKEMNMIKQVVLGNLAYVELNLGNPLKALSAAKELQQLPGCSRMYVFLSHV  693

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST--T  622
            Y+AEALC +++PKEAAEHLS Y+SE   V+ P+S+ED E WR ++  D EES+G     T
Sbjct  694  YSAEALCYMNQPKEAAEHLSFYVSEKNEVQLPYSEEDREKWRTDRSGDGEESSGPPNVKT  753

Query  621  MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYV  442
              E QG +F+KP+EARG L+ NLAA+ A+QG+++QA   A  A   +P + +A L AIY+
Sbjct  754  SEEIQGMMFMKPDEARGTLYVNLAAICAIQGNIEQASLLAKKALVALPNNPRAALAAIYI  813

Query  441  DLLQGKTKEAVAKLRKCSSVRFI  373
            DLL G+T++A  KL+ C  VRF 
Sbjct  814  DLLLGRTQDAQVKLKHCRQVRFF  836



>ref|XP_009420725.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=846

 Score =   216 bits (549),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YE+ICRKE  M++Q +L +LAYVEL LG+PL+ALS A+ L +L  CS++Y FL +V
Sbjct  635  SLSSYEEICRKEMNMIKQVVLGNLAYVELNLGNPLKALSAAKELQQLPGCSRMYVFLSHV  694

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST--T  622
            Y+AEALC +++PKEAAEHLS Y+SE   V+ P+S+ED E WR ++  D EES+G     T
Sbjct  695  YSAEALCYMNQPKEAAEHLSFYVSEKNEVQLPYSEEDREKWRTDRSGDGEESSGPPNVKT  754

Query  621  MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYV  442
              E QG +F+KP+EARG L+ NLAA+ A+QG+++QA   A  A   +P + +A L AIY+
Sbjct  755  SEEIQGMMFMKPDEARGTLYVNLAAICAIQGNIEQASLLAKKALVALPNNPRAALAAIYI  814

Query  441  DLLQGKTKEAVAKLRKCSSVRFI  373
            DLL G+T++A  KL+ C  VRF 
Sbjct  815  DLLLGRTQDAQVKLKHCRQVRFF  837



>ref|XP_007204658.1| hypothetical protein PRUPE_ppa001423mg [Prunus persica]
 gb|EMJ05857.1| hypothetical protein PRUPE_ppa001423mg [Prunus persica]
Length=832

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 151/209 (72%), Gaps = 5/209 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y DI  KEN +L+QALLA+LA+VELEL +P++ALS ARSLL+L ECS+IY FLG+VYAAE
Sbjct  621  YADIRNKENLLLKQALLANLAFVELELENPIKALSIARSLLELPECSRIYIFLGHVYAAE  680

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQ-  607
            ALCLL+R K+AA+HL  YLS    V+ PFS+ED E  +  + VD EE NGGS +   S  
Sbjct  681  ALCLLNRAKDAADHLMTYLSGGNNVDLPFSEEDSEQLQGVRAVDYEELNGGSMSAKSSSP  740

Query  606  ----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVD  439
                G VFLKPEEA   L+ N AA+ A+QG+LDQA  +   A +++P S +A LTA+YVD
Sbjct  741  EDTLGIVFLKPEEALASLYVNFAALYAMQGELDQARQFVARALSLVPNSPEATLTAVYVD  800

Query  438  LLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            L  GK++EA+AKL++CS V F+ + L  N
Sbjct  801  LKLGKSQEALAKLKQCSRVTFLPSGLTLN  829



>ref|XP_002531955.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30437.1| conserved hypothetical protein [Ricinus communis]
Length=851

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  +EDI R+ENQM++QALLADLAYVELEL +P +ALS A+ LL+L ECS+IY FL +V
Sbjct  656  SISYFEDIHRRENQMIKQALLADLAYVELELENPEKALSAAKCLLELPECSRIYVFLSHV  715

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALC+L++PKEAAE+LS+Y+S    VE PFSQED E  R EK  D EESNGGS T  
Sbjct  716  YAAEALCVLNKPKEAAEYLSIYMSGGNNVELPFSQEDTEQLRAEKSYDYEESNGGSATAK  775

Query  621  ---MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
               + E QG  FLKPEEARGIL+TN A M A QG++++AH +   A +++P S +A LTA
Sbjct  776  SSSVEEPQGMEFLKPEEARGILYTNFATMYAAQGEIERAHHFVSQALSLVPDSPEATLTA  835

Query  450  IYVDL  436
            +YVDL
Sbjct  836  VYVDL  840



>ref|XP_009340640.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Pyrus 
x bretschneideri]
 ref|XP_009340642.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Pyrus 
x bretschneideri]
 ref|XP_009340643.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Pyrus 
x bretschneideri]
Length=837

 Score =   215 bits (547),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y D+  KEN +++QALLA+LAYVELEL +P++A S ARSLL+L ECS+IY FLG+V
Sbjct  622  SLSYYADVRNKENLLIKQALLANLAYVELELENPMKAFSIARSLLELPECSRIYIFLGHV  681

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R K+AA+HL  YLS    VE PFS+ED E  +  +  D EESNGGS    
Sbjct  682  YAAEALCLLNRLKDAADHLMTYLSGGNDVELPFSEEDCEQLQGVRADDYEESNGGSMAAR  741

Query  615  ESQ-----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S      G  FLKPEEAR  L+ N AA+ A+QG+LDQA  +   A +I P S +A LTA
Sbjct  742  NSSPEDRLGIAFLKPEEARANLYVNFAALYAMQGELDQARQFVAQALSITPNSPEATLTA  801

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            +YVDL  G+++EA+AKL+ CS + F+ + L  N
Sbjct  802  VYVDLKAGRSQEALAKLKHCSRITFVPSGLTLN  834



>ref|XP_004287280.2| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex 
subunit 10 [Fragaria vesca subsp. vesca]
Length=830

 Score =   213 bits (543),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            +  Y +I +KEN +L+QALLA+ AYVELEL +PL+ALS ++SLL++ ECS+IY FLG+VY
Sbjct  617  LSSYGEIRKKENLLLKQALLANQAYVELELENPLKALSISKSLLEIPECSRIYIFLGHVY  676

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN-  616
            AAEALCLL+RPK+AAEHL  YLS +  VE PF+++D E  +  + VD EE NGGS T + 
Sbjct  677  AAEALCLLNRPKDAAEHLLTYLSGVNNVELPFTEDDFEQLKGVRTVDYEEVNGGSATASL  736

Query  615  ---ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ++  F F+KPEEA G L+ N AA+ A+QG+LD+AH +   A +I+P + +A LTA+Y
Sbjct  737  RPEDALSFAFIKPEEALGALYVNFAALYAMQGELDRAHQFVAQALSIVPNNPQASLTAVY  796

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            VDL  GK ++A++KL++CS + F+ + L  N
Sbjct  797  VDLKLGKCQDALSKLKRCSRITFLPSGLTLN  827



>emb|CDP10451.1| unnamed protein product [Coffea canephora]
Length=862

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 5/155 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+ DYEDICRKENQM+EQALLAD+AYVELEL +PL+ALSTA+SLLKL ECSKIY FLG++
Sbjct  667  SVSDYEDICRKENQMIEQALLADMAYVELELENPLKALSTAKSLLKLFECSKIYVFLGHL  726

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RPKEAAEHLS+Y++    V+ P+SQ+D+E W VEK+VD EE NGG +++N
Sbjct  727  YAAEALCLLNRPKEAAEHLSVYVTGGSNVQLPYSQDDLEKWSVEKIVDFEEPNGGPSSVN  786

Query  615  ES-----QGFVFLKPEEARGILFTNLAAMSAVQGD  526
             S     QGF FLKPEEARG +  NLA ++A  GD
Sbjct  787  ASSSDEFQGFTFLKPEEARGTICANLALLAAELGD  821



>ref|XP_008336988.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Malus 
domestica]
Length=835

 Score =   211 bits (536),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 148/213 (69%), Gaps = 5/213 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y D+  KEN +++QALLA+LAYVELEL +P++AL  ARSLL+L ECS+IY FLG+V
Sbjct  620  SLSYYADVRNKENLLIKQALLANLAYVELELENPMKALXIARSLLELPECSRIYIFLGHV  679

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R K+AA+HL  YLS    VE PFS+ED E  +  +  D EESNGGS    
Sbjct  680  YAAEALCLLNRLKDAADHLMTYLSGGNDVELPFSEEDCEQLQGVRADDYEESNGGSMAAR  739

Query  615  ESQ-----GFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
             S      G  FLKPEEA   L+ N AA+ A+QG+LDQA  +   A +I P S +A LTA
Sbjct  740  NSSPEDRLGIAFLKPEEAXANLYVNFAALYAMQGELDQARQFVAQALSITPNSPEATLTA  799

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            +YVDL  G+++EA+AKL+ CS + F+ + L  N
Sbjct  800  VYVDLKVGQSQEALAKLKHCSRITFVPSGLTLN  832



>ref|XP_010687919.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Beta vulgaris 
subsp. vulgaris]
Length=846

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 151/206 (73%), Gaps = 6/206 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            ++ +YE+ICR+ENQ ++QA+L DLA+VELELG+PL+AL+TA +LLK+ ECS++Y F G++
Sbjct  632  ALSEYEEICRRENQKIKQAVLIDLAFVELELGNPLKALTTALTLLKIPECSRMYAFWGHI  691

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R KEAAEHLS YLS    +E P+S+ED   W+ +K +D+++ N G T   
Sbjct  692  YAAEALCLLNRLKEAAEHLSTYLSG-GTLELPYSEEDCRLWQAKKTLDADDPNTGQTATR  750

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 E Q  VFL PEEARG L+ NLA+M  +QG+ +QA  YA  A A +P S +A L A
Sbjct  751  VPSSVEQQDNVFLTPEEARGALYVNLASMLVLQGEFEQASRYATQALASLPNSQEAALMA  810

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
            +Y+DL   K +EA+AKL++C  V+F+
Sbjct  811  VYLDLKLAKPREALAKLKRCCRVKFL  836



>ref|XP_010047986.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Eucalyptus 
grandis]
Length=843

 Score =   208 bits (529),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED  R+++++++QA+LA+ A+VELEL +P+ ALS A ++L+L +CS+IYTFL ++
Sbjct  628  SLSMYEDNRRRQSRLMKQAILANQAFVELELENPMGALSCALAILQLPDCSRIYTFLAHM  687

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R K+AAEHL  YLSE   +E P+ +ED E WR E++ D EE+NGG+ T N
Sbjct  688  YAAEALCLLNRTKDAAEHLLFYLSEGNQIELPYCEEDFEQWRTERIFDPEETNGGTATAN  747

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 E+Q  +FLKPEEAR  L+ NLAA SA+QG+L+ A      A A++P S +A LTA
Sbjct  748  NFSSEEAQTLMFLKPEEARATLYANLAAKSALQGELEMAQQLVAQALAVLPASREATLTA  807

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
             Y+ L+ G ++EA++KL++ + VRF+
Sbjct  808  TYIHLMLGNSQEALSKLKQFNHVRFL  833



>gb|KCW80059.1| hypothetical protein EUGRSUZ_C01387 [Eucalyptus grandis]
Length=868

 Score =   208 bits (529),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 5/206 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED  R+++++++QA+LA+ A+VELEL +P+ ALS A ++L+L +CS+IYTFL ++
Sbjct  653  SLSMYEDNRRRQSRLMKQAILANQAFVELELENPMGALSCALAILQLPDCSRIYTFLAHM  712

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R K+AAEHL  YLSE   +E P+ +ED E WR E++ D EE+NGG+ T N
Sbjct  713  YAAEALCLLNRTKDAAEHLLFYLSEGNQIELPYCEEDFEQWRTERIFDPEETNGGTATAN  772

Query  615  -----ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTA  451
                 E+Q  +FLKPEEAR  L+ NLAA SA+QG+L+ A      A A++P S +A LTA
Sbjct  773  NFSSEEAQTLMFLKPEEARATLYANLAAKSALQGELEMAQQLVAQALAVLPASREATLTA  832

Query  450  IYVDLLQGKTKEAVAKLRKCSSVRFI  373
             Y+ L+ G ++EA++KL++ + VRF+
Sbjct  833  TYIHLMLGNSQEALSKLKQFNHVRFL  858



>emb|CDY33691.1| BnaC04g29600D [Brassica napus]
Length=778

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN +L+QALLA++AYVELEL +P++ALS A SLL+L +CSKIY FLG++
Sbjct  573  SLSAYKDIRRRENHLLKQALLANMAYVELELENPIKALSAANSLLQLPDCSKIYVFLGHI  632

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL   +  + PF+QED + WR+    D EE++  ST   
Sbjct  633  YAAEALCLLNRPGEAGAHLSAYLLGQEDFKLPFAQEDFDPWRMNMSSDCEETSDCSTGNA  692

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                   LKPEEARG LF NLAA+ A QG  DQA  +   A  ++P + +A +TA+Y+DL
Sbjct  693  RDS----LKPEEARGALFANLAALFATQGHYDQARPFIQHALTLLPSNVQATITAVYIDL  748

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++AVA+L++C+ V F+   L    S
Sbjct  749  MVGRSQDAVARLKQCTRVSFVPGRLEVRAS  778



>ref|XP_006306788.1| hypothetical protein CARUB_v10008327mg [Capsella rubella]
 gb|EOA39686.1| hypothetical protein CARUB_v10008327mg [Capsella rubella]
Length=722

 Score =   204 bits (520),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 142/201 (71%), Gaps = 2/201 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  ++D CR+E Q+++QALLA++AYVELEL +P+  LS A SLL+L +CSKI  FLG+V
Sbjct  521  SISAFKDGCRREKQLIKQALLANMAYVELELDNPINGLSAANSLLQLRDCSKISAFLGHV  580

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA EHLS YL      + P++QED + WR+    D +E+  G  +  
Sbjct  581  YAAEALCLLNRPTEAGEHLSGYLVGENDFDLPYAQEDFDQWRMHTSSDCDET--GDLSTE  638

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             +Q    LKP+EARG+LF + AA+ A +GD DQA  +   A  ++P + KA +TA+Y+DL
Sbjct  639  NAQDSALLKPQEARGVLFADFAALLATKGDYDQAKQFVTKALTLLPNNVKATVTAVYIDL  698

Query  435  LQGKTKEAVAKLRKCSSVRFI  373
            + G+T++A+ +L++C+ V F+
Sbjct  699  MLGRTQDAITQLKQCTGVSFV  719



>ref|XP_006306789.1| hypothetical protein CARUB_v10008327mg, partial [Capsella rubella]
 gb|EOA39687.1| hypothetical protein CARUB_v10008327mg, partial [Capsella rubella]
Length=812

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 142/201 (71%), Gaps = 2/201 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  ++D CR+E Q+++QALLA++AYVELEL +P+  LS A SLL+L +CSKI  FLG+V
Sbjct  611  SISAFKDGCRREKQLIKQALLANMAYVELELDNPINGLSAANSLLQLRDCSKISAFLGHV  670

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA EHLS YL      + P++QED + WR+    D +E+  G  +  
Sbjct  671  YAAEALCLLNRPTEAGEHLSGYLVGENDFDLPYAQEDFDQWRMHTSSDCDET--GDLSTE  728

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             +Q    LKP+EARG+LF + AA+ A +GD DQA  +   A  ++P + KA +TA+Y+DL
Sbjct  729  NAQDSALLKPQEARGVLFADFAALLATKGDYDQAKQFVTKALTLLPNNVKATVTAVYIDL  788

Query  435  LQGKTKEAVAKLRKCSSVRFI  373
            + G+T++A+ +L++C+ V F+
Sbjct  789  MLGRTQDAITQLKQCTGVSFV  809



>gb|EYU18247.1| hypothetical protein MIMGU_mgv1a001551mg [Erythranthe guttata]
Length=797

 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 153/216 (71%), Gaps = 6/216 (3%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+ DYE+I  KENQ++ QA LADLA+VEL LG+P +ALSTA+SL+KL EC K+Y FLG V
Sbjct  581  SVLDYENIRTKENQVMRQATLADLAFVELALGNPSKALSTAKSLMKLPECEKMYRFLGIV  640

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEI-KGVEQPFSQEDVEAWRVEKVV-DSEESNGGSTT  622
            YAAEALCLL++P EAAEHL  Y+S     VE P+S ED E W VEKVV D++E   G T 
Sbjct  641  YAAEALCLLNKPMEAAEHLMTYVSGANNNVELPYSHEDCEKWTVEKVVPDNDELQQGGTV  700

Query  621  M----NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILT  454
            +    +E +      PEEARGI+  N AA  A+ G+L++A  +   A + IP+S++A+LT
Sbjct  701  VTRKEDEFRRSTSHSPEEARGIICANYAANFALMGELEKAQYFVTKALSDIPKSSQAVLT  760

Query  453  AIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            AIYVD+ +G T+EA+AKL++ S VRF+ + L   G+
Sbjct  761  AIYVDIKRGDTQEALAKLKQHSGVRFLRSDLTLTGT  796



>ref|XP_010910864.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Elaeis 
guineensis]
Length=640

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED C+K N +++QA+L DLAYVEL L +PL+AL+ A++L +L +CS+IY FL +V
Sbjct  427  SVTAYEDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAKALQQLPDCSRIYNFLSHV  486

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GST  625
            YA+EALCLL+RPKEAAEHL +Y+S+   V+ P+S ED + WRVEK  + EE +G    +T
Sbjct  487  YASEALCLLNRPKEAAEHLLVYISDKNEVQFPYSDEDRDIWRVEKGGEGEELSGYSNATT  546

Query  624  TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
            ++ E QG V LKPEEARG+L+ NLA MS +QG+ +QA  +   A + +P + +AIL AIY
Sbjct  547  SLEEPQGMVLLKPEEARGVLYVNLATMSIMQGNHEQASRFVKEALSALPNNPRAILAAIY  606

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            VDLL G+ ++A+ KL++C  VRF    +
Sbjct  607  VDLLLGREQDALVKLKQCRHVRFFRGGV  634



>emb|CDX74654.1| BnaA04g07350D [Brassica napus]
Length=777

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN +L+QALLA++AYVELEL +P++ALS A SLL+L + SKIY FLG++
Sbjct  572  SLSAYKDIRRRENHLLKQALLANMAYVELELENPIKALSAANSLLQLPDSSKIYVFLGHI  631

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL   +  + PF+QED + WR+    D EE++  ST   
Sbjct  632  YAAEALCLLNRPGEAGAHLSAYLLGQEDFKLPFAQEDFDPWRMNMSSDCEETSDCSTGNA  691

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                   LKPEEARG LF NLAA+ A QG  DQA  +   A  ++P + +A +TA+Y+DL
Sbjct  692  RDS----LKPEEARGALFANLAALFATQGHYDQAKPFIQHALTVLPNNVQATITAVYIDL  747

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++AVA+L++C+ V F+   L    S
Sbjct  748  MVGRSQDAVARLKQCTRVSFVPGRLEVRAS  777



>ref|XP_010906725.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Elaeis 
guineensis]
Length=847

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED C+K N +++QA+L DLAYVEL L +PL+AL+ A++L +L +CS+IY FL +V
Sbjct  634  SVSAYEDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAQALQQLPDCSRIYNFLSHV  693

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GST  625
            YAAEALC L+RPKEAA HLS+Y+S+   V+ P+S ED + WR+EK  D EE NG     T
Sbjct  694  YAAEALCHLNRPKEAAGHLSIYISDKNEVQLPYSDEDRDKWRIEKGGDGEEVNGRLNAKT  753

Query  624  TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               E QG VFLKPEEARG L+ NLA MS +QGD +QA  +   A +++P +  A L AIY
Sbjct  754  CSEEPQGMVFLKPEEARGALYVNLATMSIIQGDHEQASQFLREAVSLLPNNPTATLAAIY  813

Query  444  VDLLQGKTKEAVAKLRKCSSVRFI  373
            VD+L G+ ++A  KL++   VRF+
Sbjct  814  VDILLGRIQDARVKLKQSRHVRFL  837



>ref|XP_009124296.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Brassica 
rapa]
Length=763

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN +L+QALLA++AYVELEL +P++ALS A SLL+L + SKIY FLG++
Sbjct  558  SLSAYKDIRRRENHLLKQALLANMAYVELELENPIKALSAANSLLQLPDSSKIYVFLGHI  617

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL   +  + PF+QED + WR+    D EE++  ST   
Sbjct  618  YAAEALCLLNRPGEAGAHLSAYLLGQEDFKLPFAQEDFDPWRMNMSSDCEETSDCSTGNA  677

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                   LKPEEARG LF NLAA+ A QG  DQA  +   A  ++P + +A +TA+Y+DL
Sbjct  678  RDS----LKPEEARGALFANLAALFATQGHYDQAKPFIQHALTVLPNNVQATITAVYIDL  733

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++AVA+L++C+ V F+   L    S
Sbjct  734  MVGRSQDAVARLKQCTRVSFVPGRLEVRAS  763



>ref|XP_009124280.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Brassica rapa]
Length=775

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN +L+QALLA++AYVELEL +P++ALS A SLL+L + SKIY FLG++
Sbjct  570  SLSAYKDIRRRENHLLKQALLANMAYVELELENPIKALSAANSLLQLPDSSKIYVFLGHI  629

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL   +  + PF+QED + WR+    D EE++  ST   
Sbjct  630  YAAEALCLLNRPGEAGAHLSAYLLGQEDFKLPFAQEDFDPWRMNMSSDCEETSDCSTGNA  689

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                   LKPEEARG LF NLAA+ A QG  DQA  +   A  ++P + +A +TA+Y+DL
Sbjct  690  RDS----LKPEEARGALFANLAALFATQGHYDQAKPFIQHALTVLPNNVQATITAVYIDL  745

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++AVA+L++C+ V F+   L    S
Sbjct  746  MVGRSQDAVARLKQCTRVSFVPGRLEVRAS  775



>ref|XP_009124279.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Brassica rapa]
Length=777

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 4/210 (2%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI R+EN +L+QALLA++AYVELEL +P++ALS A SLL+L + SKIY FLG++
Sbjct  572  SLSAYKDIRRRENHLLKQALLANMAYVELELENPIKALSAANSLLQLPDSSKIYVFLGHI  631

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL   +  + PF+QED + WR+    D EE++  ST   
Sbjct  632  YAAEALCLLNRPGEAGAHLSAYLLGQEDFKLPFAQEDFDPWRMNMSSDCEETSDCSTGNA  691

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                   LKPEEARG LF NLAA+ A QG  DQA  +   A  ++P + +A +TA+Y+DL
Sbjct  692  RDS----LKPEEARGALFANLAALFATQGHYDQAKPFIQHALTVLPNNVQATITAVYIDL  747

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++AVA+L++C+ V F+   L    S
Sbjct  748  MVGRSQDAVARLKQCTRVSFVPGRLEVRAS  777



>ref|XP_008793964.1| PREDICTED: CCR4-NOT transcription complex subunit 10-B-like isoform 
X3 [Phoenix dactylifera]
Length=745

 Score =   202 bits (514),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            YED C+K N +++QA+L DLAYVEL L +PL+AL+ A++L  L +CS+IY FL ++YAAE
Sbjct  536  YEDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAKALQHLPDCSRIYNFLSHIYAAE  595

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GSTTMNE  613
            ALC L+RPKEAAEHLS+Y+S+   V+ P+S ED + WR+EK  D EE  G     T++ E
Sbjct  596  ALCHLNRPKEAAEHLSIYISDKNEVQFPYSDEDRDLWRMEKGGDGEELGGHLNAKTSLEE  655

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
             QG VFLKPEEARG+L+ NLA MS +QG+ +QA  Y   A + +P + +A L AIYVDLL
Sbjct  656  PQGTVFLKPEEARGVLYVNLATMSILQGNHEQASRYVKEALSALPNNPRATLAAIYVDLL  715

Query  432  QGKTKEAVAKLRKCSSVRFI  373
             G+ ++A+ KL++C  V F+
Sbjct  716  LGRIQDALVKLKQCRHVAFV  735



>ref|XP_008793962.1| PREDICTED: CCR4-NOT transcription complex subunit 10-B-like isoform 
X1 [Phoenix dactylifera]
Length=853

 Score =   202 bits (514),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            YED C+K N +++QA+L DLAYVEL L +PL+AL+ A++L  L +CS+IY FL ++YAAE
Sbjct  644  YEDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAKALQHLPDCSRIYNFLSHIYAAE  703

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GSTTMNE  613
            ALC L+RPKEAAEHLS+Y+S+   V+ P+S ED + WR+EK  D EE  G     T++ E
Sbjct  704  ALCHLNRPKEAAEHLSIYISDKNEVQFPYSDEDRDLWRMEKGGDGEELGGHLNAKTSLEE  763

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
             QG VFLKPEEARG+L+ NLA MS +QG+ +QA  Y   A + +P + +A L AIYVDLL
Sbjct  764  PQGTVFLKPEEARGVLYVNLATMSILQGNHEQASRYVKEALSALPNNPRATLAAIYVDLL  823

Query  432  QGKTKEAVAKLRKCSSVRFI  373
             G+ ++A+ KL++C  V F+
Sbjct  824  LGRIQDALVKLKQCRHVAFV  843



>ref|XP_010541904.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex 
subunit 10-like [Tarenaya hassleriana]
Length=800

 Score =   202 bits (513),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 146/201 (73%), Gaps = 1/201 (0%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+D    EN M+ QALLA++A+VELEL +P++ALS A+SLL++ +CSKIY FLG++
Sbjct  589  SLSFYKDARAWENHMIRQALLANMAFVELELENPVKALSAAKSLLEIPDCSKIYLFLGHI  648

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+R ++A   LS+YL    G + PF QED++ W + + VDSEE    S+ + 
Sbjct  649  YAAEALCLLNRTEDAGGQLSVYLHRQDGFKLPFPQEDLDQWCIHRNVDSEEPK-DSSPVG  707

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
            E+Q  VFLKP+EARG L+ NLA + A QG+LD+A      A +++P + +A LT IY+DL
Sbjct  708  ETQEAVFLKPKEARGTLYANLAVLLATQGELDRAQHLVAEALSLLPNNLQAALTGIYIDL  767

Query  435  LQGKTKEAVAKLRKCSSVRFI  373
            + GK+ EAVA+L++C+ V F+
Sbjct  768  MLGKSHEAVARLKQCNRVSFL  788



>ref|XP_008793963.1| PREDICTED: CCR4-NOT transcription complex subunit 10-B-like isoform 
X2 [Phoenix dactylifera]
Length=792

 Score =   201 bits (512),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            YED C+K N +++QA+L DLAYVEL L +PL+AL+ A++L  L +CS+IY FL ++YAAE
Sbjct  583  YEDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAKALQHLPDCSRIYNFLSHIYAAE  642

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GSTTMNE  613
            ALC L+RPKEAAEHLS+Y+S+   V+ P+S ED + WR+EK  D EE  G     T++ E
Sbjct  643  ALCHLNRPKEAAEHLSIYISDKNEVQFPYSDEDRDLWRMEKGGDGEELGGHLNAKTSLEE  702

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
             QG VFLKPEEARG+L+ NLA MS +QG+ +QA  Y   A + +P + +A L AIYVDLL
Sbjct  703  PQGTVFLKPEEARGVLYVNLATMSILQGNHEQASRYVKEALSALPNNPRATLAAIYVDLL  762

Query  432  QGKTKEAVAKLRKCSSVRFI  373
             G+ ++A+ KL++C  V F+
Sbjct  763  LGRIQDALVKLKQCRHVAFV  782



>ref|XP_010557608.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Tarenaya 
hassleriana]
Length=816

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 143/208 (69%), Gaps = 1/208 (0%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+  +EN M++QALLA+ A+VELEL D ++AL  A+SLL+L ECSKIY FLG++
Sbjct  607  SLSLYEDVRARENHMMKQALLANTAFVELELEDYVKALPAAKSLLELPECSKIYVFLGHI  666

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEAL L ++ +EAA+HLS+YL     +E PF QED+  WR  + VD EE    S+T  
Sbjct  667  YAAEALSLQNKAEEAAKHLSVYLHGQDSIELPFIQEDLNQWRFHRSVDCEERK-DSSTGE  725

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
                  FL PEEARG ++ NLAAM A++GD D+A      A +I+P + +A LT IY+DL
Sbjct  726  AKDNTAFLSPEEARGSVYANLAAMRAIRGDFDRAQQLVSQALSILPNNVQATLTGIYIDL  785

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
              GKT++AVA+L++C+ V F+   L  N
Sbjct  786  KLGKTQDAVARLKQCNRVSFLPAKLELN  813



>ref|XP_008807048.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Phoenix 
dactylifera]
Length=850

 Score =   200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y D C+K N +++QA+L DLAYVEL L +PL+AL+ A++L +L +CS+IY FL +V
Sbjct  637  SVSAYGDTCKKVNNLIKQAVLGDLAYVELSLENPLKALAAAKALQQLPDCSRIYNFLSHV  696

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GST  625
            YAAEALC L++PKEAAEHLS+Y+S+   V+ P+S ED + WR EK  D EE NG     T
Sbjct  697  YAAEALCHLNQPKEAAEHLSIYISDKNEVQLPYSDEDRDKWRTEKGGDGEEVNGHLNAKT  756

Query  624  TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
            ++ E QG VF KPEEARG L+ NLA MS +QGD +QA  +   A +++P + +A L AIY
Sbjct  757  SLEEPQGMVFPKPEEARGALYVNLATMSIIQGDHEQASRFLKEALSLLPNNPRATLAAIY  816

Query  444  VDLLQGKTKEAVAKLRKCSSVRFI  373
            VD+L G+ ++A+ KL++C   RF 
Sbjct  817  VDILLGRIQDALVKLKQCRCARFF  840



>ref|XP_010533130.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex 
subunit 10-like [Tarenaya hassleriana]
Length=813

 Score =   199 bits (505),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI  +ENQM+ QALLA++A+VE+E+ +P++ALS A+SLL+L +CSKIY FLG++
Sbjct  604  SLSFYKDIQARENQMIRQALLANMAFVEMEMENPVKALSAAKSLLELPDCSKIYVFLGHI  663

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            Y AEALCLL R KEA EHLS+YL E  G E PF QED+  W + +  + E+    S++M 
Sbjct  664  YTAEALCLLDRTKEAGEHLSVYLHEQDGFELPFLQEDLSHWLIHRNPEFEDPK-ESSSMG  722

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
            E Q  VFLKP++ARG+L+ NLAA+ A QGD D+A      A +++P + +A LT IY+D+
Sbjct  723  EGQDSVFLKPKDARGMLYANLAALLATQGDFDRARDLVTQALSLLPNNVQATLTGIYIDI  782

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
              GK+ EAVA+LR+C+ V F+   L  N
Sbjct  783  KLGKSHEAVARLRQCNRVSFLPGGLQLN  810



>ref|XP_010480606.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Camelina 
sativa]
Length=706

 Score =   196 bits (498),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 143/203 (70%), Gaps = 9/203 (4%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++DICR+E Q+++QALLA++AYVELEL +P++ALS A SLL+L +CS I  FLG+V
Sbjct  507  SLSAFKDICRREKQLIKQALLANMAYVELELENPIKALSAATSLLQLQDCSNINVFLGHV  566

Query  795  YAAEALCLLSRPKEAAEHLSMY-LSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM  619
            YAAEALCLL+RP EA  HLS Y L E    + P++QED + WR+    D +E+   ST  
Sbjct  567  YAAEALCLLNRPTEACTHLSGYLLLEQNDFKLPYAQEDFDLWRMHTSSDCDETLDLSTE-  625

Query  618  NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVD  439
                    LKPEEARG+LF N AA+ A QGD DQA  +   A  ++P + +A +TA+Y+D
Sbjct  626  ------TALKPEEARGVLFANFAALLATQGDHDQAKLFVTRALNLLPNNVQATVTAVYID  679

Query  438  L-LQGKTKEAVAKLRKCSSVRFI  373
            L L G++++A+A+L+KCS V F+
Sbjct  680  LMLGGRSQDALARLKKCSHVSFV  702



>gb|EPS65667.1| hypothetical protein M569_09110 [Genlisea aurea]
Length=824

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 151/226 (67%), Gaps = 22/226 (10%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI DYE +  KEN+++ QA LADLAYVEL LGDPL AL  A+SLL+L +CSK+Y F G+V
Sbjct  599  SIADYEHMKAKENRLIRQASLADLAYVELALGDPLLALQVAKSLLELPDCSKMYAFFGSV  658

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWR--VEKVVDSEESNGGSTT  622
            YAAEALCLL+RP EAA+HL  Y+S    V+ P+++ED E W    EK +DSE+SN  +++
Sbjct  659  YAAEALCLLNRPTEAAKHLLAYISVGNDVDLPYTREDCENWTPAAEKFIDSEDSNDLASS  718

Query  621  ---------------MNESQGFVFLKPEEARGILFTNLAA-MSAVQGDLDQahayalaaa  490
                             ES    +L PE ARGI +TN A  +S + GDL+QA   A  A 
Sbjct  719  NPAAVIEKQQPQQQQQQESS---YLSPESARGIFYTNHAVNISLMGGDLEQARLLATRAL  775

Query  489  AIIPRSTKAILTAIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            + IP  ++A+LTA+Y+DL QGKT+EA+AKL++  S RF+  + P+N
Sbjct  776  SDIPNDSRAVLTAVYLDLKQGKTQEALAKLKRYGSTRFVPTA-PSN  820



>gb|EMS67321.1| CCR4-NOT transcription complex subunit 10 [Triticum urartu]
Length=791

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI RKEN  + QA+L DLA+VEL L +PL+ALS A SLL++ +CS++Y FLG+V
Sbjct  580  SLAMYDDIIRKENLKIRQAILGDLAFVELCLENPLKALSIANSLLQVPDCSRMYLFLGHV  639

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL+R KEA + L++YL +   +E P+S E+ E   VEK  D E+S   + T  
Sbjct  640  YAAEALCLLNRLKEAVDQLTVYLRDDNAIELPYSVENREKAPVEKDSDGEDSVTPAMTKL  699

Query  618  --NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ESQ  + LKPEEA G+L+ +L   +AVQG+L+QA+       A++P S +A+L +IY
Sbjct  700  TSEESQHSMSLKPEEACGVLYVDLGMTAAVQGELEQANYLVSRGFAMLPNSPRALLASIY  759

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            VDLLQGK +EA+ KLR+C +VRF  +S+
Sbjct  760  VDLLQGKAQEAIGKLRRCRNVRFKTSSV  787



>dbj|BAJ97945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=821

 Score =   192 bits (489),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI RKEN  + QA+L DLA++EL L +PL+ALSTA SLL++ +CS++Y FLG+V
Sbjct  609  SLAMYDDIIRKENLKIRQAILGDLAFIELCLENPLKALSTANSLLQVPDCSRMYLFLGHV  668

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALC L+R KEAA+ L++YL +   +E P+S E+ E   VEK  D E+S   + T  
Sbjct  669  YAAEALCALNRLKEAADQLTVYLRDDNAIELPYSVENREKAPVEKDSDGEDSVTPAMTKL  728

Query  618  --NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ESQ  + LKPEEA G+L+ +L   +AVQG+L+QA+       A++P + +A+L +IY
Sbjct  729  ASEESQHSMSLKPEEACGVLYVDLGMTAAVQGELEQANYLVSRGFAMLPNNPRALLASIY  788

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            VDLLQGK +EA +KLR+C +VRF  +S+
Sbjct  789  VDLLQGKAQEATSKLRRCRNVRFKTSSV  816



>ref|XP_002459892.1| hypothetical protein SORBIDRAFT_02g013160 [Sorghum bicolor]
 gb|EER96413.1| hypothetical protein SORBIDRAFT_02g013160 [Sorghum bicolor]
Length=825

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y++ICRKEN  + QA+L +LA+VEL L +PL+ALS A+S+L+L +CS++Y FL +VYAAE
Sbjct  618  YDEICRKENLKIRQAILGNLAFVELCLENPLKALSYAKSVLQLTDCSRMYVFLSHVYAAE  677

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT---MNE  613
            ALC L+RPK+AAE LS+Y+ +   +E P++ E+ E   VE+  D E+S   S T     E
Sbjct  678  ALCTLNRPKDAAEKLSVYIRDGNDIELPYNVENSEKALVERDSDGEDSVAPSVTKLATEE  737

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            S+    L+PEEARG+L+ +L   +A+QG+++QA+       A++P + +A+L ++Y+DLL
Sbjct  738  SEHSESLRPEEARGVLYIDLGMTAAMQGEVEQANYMVSRGLAMLPNNPRAVLASVYIDLL  797

Query  432  QGKTKEAVAKLRKCSSVRF  376
            QGK++EAV KLR+C +VRF
Sbjct  798  QGKSQEAVGKLRQCRNVRF  816



>ref|XP_006403088.1| hypothetical protein EUTSA_v10003437mg [Eutrema salsugineum]
 gb|ESQ44541.1| hypothetical protein EUTSA_v10003437mg [Eutrema salsugineum]
Length=781

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 149/210 (71%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+   EDI  +ENQ+++QALLA++AYVELEL +P++ALS+A SLL+L +CSKIY FLG++
Sbjct  574  SLSALEDIRSRENQLIKQALLANMAYVELELENPIKALSSANSLLQLPDCSKIYIFLGHI  633

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + PF+QED + WR+    D EE+   ST   
Sbjct  634  YAAEALCLLNRPVEAGAHLSAYLLGQDDFKLPFAQEDFDQWRMHVSFDCEETADAST--G  691

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  V LKPEEARG+LF NLAA+ A QG  DQA    + A  ++P + +A +TA+Y+DL
Sbjct  692  NARDSVCLKPEEARGVLFANLAALLATQGHYDQAKPLIMHALTVLPNNVQATVTAVYIDL  751

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+A+L++C+ V F+ + L    S
Sbjct  752  MLGRSQDALARLKQCTRVSFVPSRLEVRAS  781



>ref|NP_001169495.1| hypothetical protein [Zea mays]
 gb|ACN33910.1| unknown [Zea mays]
 tpg|DAA60741.1| TPA: hypothetical protein ZEAMMB73_688350 [Zea mays]
Length=617

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y +ICRKEN  + QA+L +LA+VEL L +PL+ALS A+S++++ +CS++Y FL +V
Sbjct  406  SLAFYNEICRKENLKMRQAILGNLAFVELCLENPLKALSYAKSVMQVKDCSRMYIFLSHV  465

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALC L+RP +AAE LS+Y+ +   +E P++ E+ E   VEK  DSE+    + T  
Sbjct  466  YAAEALCTLNRPTDAAEKLSVYIRDGNDIELPYNMENSEKALVEKDSDSEDLAAATVTKV  525

Query  621  -MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ES+    L+PEEARG+L+ NLA  +AVQG ++QA+       A++P + +A+L ++Y
Sbjct  526  ATEESEYSEGLRPEEARGVLYINLAMTAAVQGKVEQANYMVSRGLAMLPNNPRAVLASVY  585

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +DLLQGK++EAV KLR C +VRF   S+
Sbjct  586  IDLLQGKSQEAVVKLRHCRNVRFRPGSI  613



>ref|XP_008651723.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=825

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y +ICRKEN  + QA+L +LA+VEL L +PL+ALS A+S++++ +CS++Y FL +V
Sbjct  614  SLAFYNEICRKENLKMRQAILGNLAFVELCLENPLKALSYAKSVMQVKDCSRMYIFLSHV  673

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTT--  622
            YAAEALC L+RP +AAE LS+Y+ +   +E P++ E+ E   VEK  DSE+    + T  
Sbjct  674  YAAEALCTLNRPTDAAEKLSVYIRDGNDIELPYNMENSEKALVEKDSDSEDLAAATVTKV  733

Query  621  -MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ES+    L+PEEARG+L+ NLA  +AVQG ++QA+       A++P + +A+L ++Y
Sbjct  734  ATEESEYSEGLRPEEARGVLYINLAMTAAVQGKVEQANYMVSRGLAMLPNNPRAVLASVY  793

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +DLLQGK++EAV KLR C +VRF   S+
Sbjct  794  IDLLQGKSQEAVVKLRHCRNVRFRPGSI  821



>gb|EMT03772.1| CCR4-NOT transcription complex subunit 10 [Aegilops tauschii]
Length=807

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 145/207 (70%), Gaps = 3/207 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y+DI +KEN  + QA+L DLA+VEL L +PL+ALSTA SLL++ +CS++Y FLG+V
Sbjct  580  SLAMYDDIIKKENLKIRQAILGDLAFVELCLENPLKALSTANSLLQVPDCSRMYLFLGHV  639

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM-  619
            YAAEALCLL+R KEA + L++YL +   +E P+S E+ E   VEK  D E+S   + T  
Sbjct  640  YAAEALCLLNRLKEAVDQLTVYLRDGNAIELPYSVENREKAPVEKDSDGEDSVTPAMTKL  699

Query  618  --NESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
               ESQ  + LKPEEA G+L+ +L   +AVQG+L+QA+       A++P S +A+L +IY
Sbjct  700  TSEESQHSMSLKPEEACGVLYVDLGMAAAVQGELEQANYLVSRGFAMLPNSPRALLASIY  759

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNS  364
            VDLLQGK +EA+ KLR+C + R +  +
Sbjct  760  VDLLQGKAQEAIGKLRRCRNERNVQKA  786



>dbj|BAB08702.1| unnamed protein product [Arabidopsis thaliana]
Length=597

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 143/210 (68%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  +EDI  +E Q++ QAL A++AYVELEL +P++ALS A SLL+L +CSKIY FLG++
Sbjct  390  SLSAFEDIRNREKQLMRQALFANMAYVELELANPIKALSAATSLLQLADCSKIYVFLGHI  449

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P++QED + W      D EE+   ST   
Sbjct  450  YAAEALCLLNRPIEAGAHLSAYLLGQDDFKLPYAQEDFDQWWKHTSSDCEETLDPST--G  507

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA +    A  ++P + +A +TA+Y+DL
Sbjct  508  NTRDSVFLKPEEARGALFADLAALLATQGHHDQAKSLITHALTLLPNNVQATVTAVYIDL  567

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+A+L++C+ V F+   L    S
Sbjct  568  MLGRSQDALARLKQCTHVSFVPGRLEVRAS  597



>ref|NP_198393.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL09746.1| AT5g35440/MOK9_2 [Arabidopsis thaliana]
 gb|AAM65360.1| AT5g35440/MOK9_2 [Arabidopsis thaliana]
 dbj|BAD43730.1| putative protein [Arabidopsis thaliana]
 gb|AED93967.1| uncharacterized protein AT5G35430 [Arabidopsis thaliana]
Length=786

 Score =   185 bits (469),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 143/210 (68%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  +EDI  +E Q++ QAL A++AYVELEL +P++ALS A SLL+L +CSKIY FLG++
Sbjct  579  SLSAFEDIRNREKQLMRQALFANMAYVELELANPIKALSAATSLLQLADCSKIYVFLGHI  638

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P++QED + W      D EE+   ST   
Sbjct  639  YAAEALCLLNRPIEAGAHLSAYLLGQDDFKLPYAQEDFDQWWKHTSSDCEETLDPST--G  696

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA +    A  ++P + +A +TA+Y+DL
Sbjct  697  NTRDSVFLKPEEARGALFADLAALLATQGHHDQAKSLITHALTLLPNNVQATVTAVYIDL  756

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+A+L++C+ V F+   L    S
Sbjct  757  MLGRSQDALARLKQCTHVSFVPGRLEVRAS  786



>ref|XP_006282564.1| hypothetical protein CARUB_v10004173mg [Capsella rubella]
 gb|EOA15462.1| hypothetical protein CARUB_v10004173mg [Capsella rubella]
Length=787

 Score =   185 bits (469),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++D+  +E Q+L+QALLA+ AYVELEL DP++ALS A SLL+L +CSKIY FLG++
Sbjct  580  SLSAFKDVQSREKQLLKQALLANTAYVELELEDPIKALSAANSLLQLPDCSKIYVFLGHI  639

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P++QED + WR+    + EE++   T   
Sbjct  640  YAAEALCLLNRPVEAGAHLSAYLVGQDDFKLPYAQEDFDQWRMHTSSECEETSDSPT--G  697

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  +QA      A  ++P + +A +TAIY+DL
Sbjct  698  NTRDSVFLKPEEARGALFADLAALLATQGHHEQAKHMITNALTLLPNNVQATVTAIYIDL  757

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+ +L++C+ V F+   L    S
Sbjct  758  MLGRSQDAITRLKQCTRVSFVPGRLEVRAS  787



>ref|XP_002868420.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44679.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=787

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 143/210 (68%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++D+C KE Q+++QAL A++AYVELEL +P++ALS A SLL+L +CSKIY FLG++
Sbjct  580  SLSAFKDMCSKEKQLMQQALFANMAYVELELENPVKALSAATSLLQLPDCSKIYVFLGHI  639

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL        P++QED + W      D EE+   ST   
Sbjct  640  YAAEALCLLNRPIEAGAHLSAYLVGQDDFRLPYAQEDFDQWWKHTSSDCEETLDPST--G  697

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA      A  ++P + +A +TA+Y+DL
Sbjct  698  NARESVFLKPEEARGALFADLAALLATQGHHDQAKPLITHALTLLPNNVQATVTAVYIDL  757

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+A+L++C+ V F+   L    S
Sbjct  758  MLGRSQDALARLKQCTRVSFVPGRLEVRAS  787



>ref|XP_010237317.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Brachypodium distachyon]
Length=758

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 139/199 (70%), Gaps = 3/199 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+ ICRKEN  + QA+L DLA++EL L +PL+ALS A+ L +L +CS++Y FL +VYAAE
Sbjct  550  YDAICRKENLKIRQAILGDLAFIELCLENPLKALSIAKLLQQLPDCSRMYLFLSHVYAAE  609

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S+  + T     E
Sbjct  610  ALCALNRPKEAAEQLTVYLRDGNDIELPYSVENCEKAPVEKDSDGEDSHAPAVTKLTSEE  669

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ  + L PE+A  +++ +L   +A+QGDL+QA+       A++P + +A+L ++YVDLL
Sbjct  670  SQHSLSLSPEDACAVVYVDLGMTAAMQGDLEQANYMVNRGFAMLPNNPRALLASVYVDLL  729

Query  432  QGKTKEAVAKLRKCSSVRF  376
            QGK + A+ KLR+C +VRF
Sbjct  730  QGKVQGAMGKLRQCRNVRF  748



>ref|XP_003576897.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Brachypodium distachyon]
Length=824

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 139/199 (70%), Gaps = 3/199 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+ ICRKEN  + QA+L DLA++EL L +PL+ALS A+ L +L +CS++Y FL +VYAAE
Sbjct  616  YDAICRKENLKIRQAILGDLAFIELCLENPLKALSIAKLLQQLPDCSRMYLFLSHVYAAE  675

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S+  + T     E
Sbjct  676  ALCALNRPKEAAEQLTVYLRDGNDIELPYSVENCEKAPVEKDSDGEDSHAPAVTKLTSEE  735

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ  + L PE+A  +++ +L   +A+QGDL+QA+       A++P + +A+L ++YVDLL
Sbjct  736  SQHSLSLSPEDACAVVYVDLGMTAAMQGDLEQANYMVNRGFAMLPNNPRALLASVYVDLL  795

Query  432  QGKTKEAVAKLRKCSSVRF  376
            QGK + A+ KLR+C +VRF
Sbjct  796  QGKVQGAMGKLRQCRNVRF  814



>ref|XP_010450377.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Camelina 
sativa]
Length=363

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 143/210 (68%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++ I  +E  +++QALLA++AYVELEL +P++AL+ A SLL+L +CSKIY FLG++
Sbjct  156  SLSAFKGIQSREKLLIKQALLANMAYVELELENPIKALAAANSLLQLPDCSKIYVFLGHL  215

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P+ QED + WR+    D EE+   ST   
Sbjct  216  YAAEALCLLNRPVEAGAHLSAYLVGPDDFKLPYEQEDFDQWRMNTSSDCEETLDSST--G  273

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA A    A  +IP + +A +TA+Y+D+
Sbjct  274  NARDSVFLKPEEARGALFADLAALLATQGHHDQAKAMITHALTLIPNNVQATVTAVYIDM  333

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+ +L++C+ V F+   L    S
Sbjct  334  MLGRSQDALTRLKQCTRVSFVPGRLEVRAS  363



>ref|XP_004956331.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Setaria 
italica]
Length=823

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 143/212 (67%), Gaps = 13/212 (6%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y++ICRKEN  + QA+L  LA+VEL L +PL+ALS A+ L +L +CS++Y FL +VYAAE
Sbjct  617  YDEICRKENLKIRQAILGSLAFVELCLENPLKALSYAKLLQQLTDCSRMYVFLSHVYAAE  676

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGST-------  625
            ALC L+RPK+AAE LS+Y+ +   +E P++ E+      EK +D ++S+G  T       
Sbjct  677  ALCALNRPKDAAEQLSVYIKDGNDIELPYNVEN-----CEKALDEKDSDGEDTVAPAVTK  731

Query  624  -TMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAI  448
             T  ESQ    LKPEEARG+L+ +L   +A+QG+ +QA        A++P + +A+L ++
Sbjct  732  LTSEESQHSESLKPEEARGVLYIDLGMTAAMQGEFEQADYMVSRGLAMLPNNPRAVLASV  791

Query  447  YVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            Y+DLLQGK++ AVAKLR C  VRF  + L T+
Sbjct  792  YMDLLQGKSQGAVAKLRHCRHVRFRPSVLATS  823



>ref|XP_003571631.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Brachypodium 
distachyon]
Length=817

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            SI  YE+ICRKEN  ++QA+LADLA+VEL L +P RALS A+ L +L +CS++Y FL  V
Sbjct  606  SIASYEEICRKENLEIKQAVLADLAFVELCLENPSRALSVAKLLQQLPDCSRMYVFLSRV  665

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVE-AWRVEKVVDSEESNGGSTT-  622
            Y AEALC+L RP EAAE LS+Y++++   E PF  E+ E    V+K  D E+S   +   
Sbjct  666  YCAEALCVLKRPDEAAEELSVYMTDVNNFEVPFVIENFEKGGLVDKDSDCEDSVAPAAMK  725

Query  621  -MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIY  445
             + E+Q  V  KPEEA G+L+ +   +SA+QGD+++A        A++P   +A L A+Y
Sbjct  726  PIPEAQHSVCHKPEEALGVLYIDQGMLSAMQGDIERATYLVDRGFALLPNDARATLAAVY  785

Query  444  VDLLQGKTKEAVAKLRKCSSVRFIHNSL  361
            +DL+QGKT+EA+ KLR+C +VRF  +S+
Sbjct  786  LDLVQGKTQEALPKLRQCKNVRFRGDSV  813



>gb|KFK22360.1| hypothetical protein AALP_AAs57819U000100 [Arabis alpina]
Length=777

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 141/205 (69%), Gaps = 2/205 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++DI  +ENQ  +QAL A++AYVELEL +P++ALS A SLL+L +CSKIY FLG++
Sbjct  571  SLSAFKDIKTRENQFAKQALFANMAYVELELENPIKALSAANSLLQLPDCSKIYAFLGHL  630

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP +A  HLS YL        PF QED + WR+    D EE+   ST   
Sbjct  631  YAAEALCLLNRPVDAGAHLSAYLLGQDDFNMPFGQEDFDQWRMNVSYDCEETWDSST--G  688

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEE+RG LF +LAA+ A QG  DQA      A +I+  + +A +TAIY+DL
Sbjct  689  NARDSVFLKPEESRGTLFADLAALLATQGHYDQAKPLIAHALSILQNNVEATVTAIYIDL  748

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSL  361
            + G +++A+A+L++C+ V F+  +L
Sbjct  749  MLGSSQDALARLKQCTRVSFVPGTL  773



>ref|XP_006665031.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Oryza 
brachyantha]
Length=825

 Score =   182 bits (463),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+DICRKEN  + QA+L DLA++EL L + L+ALS A+SL +L ECS+IY FL +VYAAE
Sbjct  618  YDDICRKENLKIRQAILGDLAFIELCLQNYLKALSIAKSLQQLPECSRIYVFLSHVYAAE  677

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S     T     E
Sbjct  678  ALCALNRPKEAAEQLTVYLRDGDDIELPYSVENCEKALVEKDSDGEDSVAPVVTKLSSGE  737

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ    LKPEEA+G+L+ +L   +AVQG+ +QA+       A++P + +A+L ++YVDLL
Sbjct  738  SQYPESLKPEEAQGVLYIDLGMTAAVQGEFEQANYMVSRGVALLPNNPRAVLASVYVDLL  797

Query  432  QGKTKEAVAKL  400
            QGK++EA+AKL
Sbjct  798  QGKSQEAIAKL  808



>ref|XP_010928522.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex 
subunit 10-like [Elaeis guineensis]
Length=711

 Score =   181 bits (459),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 139/212 (66%), Gaps = 15/212 (7%)
 Frame = -1

Query  972  IPDYEDICRKENQMLEQALL--ADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGN  799
            +  YE ICRKEN  + Q +L   DLAYV L L D L+AL  A++L +L +CSKIY FL  
Sbjct  495  VAGYEVICRKENHRIRQTVLTLGDLAYVALWLEDHLKALVAAKTLRQLPDCSKIYLFLSY  554

Query  798  VYAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGS---  628
            VYAAE+LC L++PKEAAE L +Y+++ K VE P++ ED E W  EK     + +  +   
Sbjct  555  VYAAESLCRLNQPKEAAEQLGVYVADGKNVELPYTNEDTENWGDEKGAGCADLDSSATAK  614

Query  627  -------TTMNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRST  469
                   TT+ ESQ   F+KPEEARG L+ NLA+MSA+QGDL+QA  +     + +P + 
Sbjct  615  TTVKGTKTTVKESQDMGFVKPEEARGFLYVNLASMSAMQGDLEQASHFIKQGLSSLPNNP  674

Query  468  KAILTAIYVDLLQGKTKEAVAKLRKCSSVRFI  373
            + +L A+YVDLLQGKT+EA+ K R+   VRF+
Sbjct  675  RLLLAAVYVDLLQGKTEEALFKFRR---VRFL  703



>ref|XP_010450378.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Camelina 
sativa]
Length=776

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++DI  +E  +++QALLA++AYVELEL +P++AL+ A SLL+L +CSKIY FLG++
Sbjct  569  SLSAFKDIQSREKLLIKQALLANMAYVELELENPIKALAAANSLLQLPDCSKIYVFLGHL  628

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P+ QED + WR+    D EE+   ST   
Sbjct  629  YAAEALCLLNRPVEAGAHLSAYLVGPDDFKLPYEQEDFDQWRMNTSSDCEETLDSST--G  686

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA A    A  ++P + +A +TA+Y+D+
Sbjct  687  NARDSVFLKPEEARGALFADLAALLATQGHHDQAKAMITHALTLLPNNVQATVTAVYIDM  746

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+ +L++C+ V F+   L    S
Sbjct  747  MLGRSQDALTRLKQCTRVSFVPGRLEVRAS  776



>ref|NP_001062600.1| Os09g0123100 [Oryza sativa Japonica Group]
 dbj|BAD20099.1| putative Cnot10 protein [Oryza sativa Japonica Group]
 dbj|BAF24514.1| Os09g0123100 [Oryza sativa Japonica Group]
 dbj|BAG96196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+DICRKEN  ++QA+L DLA++EL L + L+ALS A+ L +L ECS++Y FL +VYAAE
Sbjct  620  YDDICRKENLKIKQAILGDLAFIELCLQNHLKALSIAKLLQQLPECSRMYVFLSHVYAAE  679

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S     T     E
Sbjct  680  ALCALNRPKEAAEQLTVYLRDGDDIELPYSIENCEKALVEKDSDGEDSVAPVVTKLSSGE  739

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ    LKPEEA+G+L+ +L   +AVQG+L+QA+       A++P + +A+L ++YVDLL
Sbjct  740  SQYSESLKPEEAQGVLYIDLGMTAAVQGELEQANYMVSRGVALLPNNPRAVLASVYVDLL  799

Query  432  QGKTKEAVAKL  400
            QGK +EA+AKL
Sbjct  800  QGKAQEAIAKL  810



>gb|EEC84105.1| hypothetical protein OsI_30425 [Oryza sativa Indica Group]
Length=850

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+DICRKEN  ++QA+L DLA++EL L + L+ALS A+ L +L ECS++Y FL +VYAAE
Sbjct  643  YDDICRKENLKIKQAILGDLAFIELCLQNHLKALSIAKLLQQLPECSRMYVFLSHVYAAE  702

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S     T     E
Sbjct  703  ALCALNRPKEAAEQLTVYLRDGDDIELPYSIENCEKALVEKDSDGEDSVAPVVTKLSSGE  762

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ    LKPEEA+G+L+ +L   +AVQG+L+QA+       A++P + +A+L ++YVDLL
Sbjct  763  SQYSESLKPEEAQGVLYIDLGMTAAVQGELEQANYMVSRGVALLPNNPRAVLASVYVDLL  822

Query  432  QGKTKEAVAKL  400
            QGK +EA+AKL
Sbjct  823  QGKAQEAIAKL  833



>gb|EEE69207.1| hypothetical protein OsJ_28413 [Oryza sativa Japonica Group]
Length=849

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  963  YEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAE  784
            Y+DICRKEN  ++QA+L DLA++EL L + L+ALS A+ L +L ECS++Y FL +VYAAE
Sbjct  642  YDDICRKENLKIKQAILGDLAFIELCLQNHLKALSIAKLLQQLPECSRMYVFLSHVYAAE  701

Query  783  ALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTM---NE  613
            ALC L+RPKEAAE L++YL +   +E P+S E+ E   VEK  D E+S     T     E
Sbjct  702  ALCALNRPKEAAEQLTVYLRDGDDIELPYSIENCEKALVEKDSDGEDSVAPVVTKLSSGE  761

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
            SQ    LKPEEA+G+L+ +L   +AVQG+L+QA+       A++P + +A+L ++YVDLL
Sbjct  762  SQYSESLKPEEAQGVLYIDLGMTAAVQGELEQANYMVSRGVALLPNNPRAVLASVYVDLL  821

Query  432  QGKTKEAVAKL  400
            QGK +EA+AKL
Sbjct  822  QGKAQEAIAKL  832



>ref|XP_006856524.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Amborella 
trichopoda]
 gb|ERN17991.1| hypothetical protein AMTR_s00046p00133890 [Amborella trichopoda]
Length=842

 Score =   180 bits (456),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 140/214 (65%), Gaps = 10/214 (5%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  YED+CR EN ++ QA+LADLA+VEL L +PL+AL  +++LL+L  CS IY +LG+V
Sbjct  626  SVHAYEDLCRNENFLIRQAVLADLAFVELALENPLKALGFSKALLQLDICSNIYVYLGHV  685

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKV-VDSEESNG---GS  628
            YAAEALC L+R +EA+EHL +Y++    +E PFS ED   WR EKV VD +E NG     
Sbjct  686  YAAEALCRLNRLEEASEHLRVYVTGESNMELPFSDEDCRKWRNEKVGVDGDEPNGFANAK  745

Query  627  TTMNESQGFVFLKP--EEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILT  454
            TT   +       P  EEAR  L  NL AMSA+ GDLD+A  +A  A  + P    A+L 
Sbjct  746  TTPPNANAPDISHPTSEEARLALAVNLVAMSAMLGDLDKASHHANEALLMAPSDPSAVLA  805

Query  453  AIYVDLLQGKTKEAVAKLRKCSSVRFIHNSLPTN  352
            ++YV+LL GK+++A+ KL++   VRF    LP N
Sbjct  806  SVYVELLHGKSQDALNKLKQIRPVRF----LPVN  835



>ref|XP_010440719.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like [Camelina 
sativa]
Length=777

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  +++I  +E  +++QALLA++AYVELEL +P++AL+ A SLL++ +CSKIY FLG++
Sbjct  570  SLSAFKNIQSREKLLIKQALLANMAYVELELENPIKALAAANSLLQVPDCSKIYVFLGHL  629

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P+ QED + WR+    D EE+   ST   
Sbjct  630  YAAEALCLLNRPVEAGAHLSAYLVGQDDFKLPYEQEDFDQWRMHTSSDCEETLDSST--G  687

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA A    A  +IP + +A +TA+Y+D+
Sbjct  688  NARDSVFLKPEEARGALFADLAALLATQGHHDQAKAMITHALTLIPNNVQATVTAVYIDM  747

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+ +L++C+ V F+   L    S
Sbjct  748  MLGRSQDALTRLKQCTRVSFVPGRLEVRAS  777



>ref|XP_010435435.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X1 [Camelina sativa]
 ref|XP_010435436.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X2 [Camelina sativa]
Length=777

 Score =   179 bits (453),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 144/210 (69%), Gaps = 2/210 (1%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  ++DI  +E  +++QALLA++AYVELEL +P++AL+ A SLL+L +CSKIY FLG++
Sbjct  570  SLSAFKDIQSREKLLIKQALLANMAYVELELENPIKALAAANSLLQLPDCSKIYVFLGHL  629

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALCLL+RP EA  HLS YL      + P+ QED + WR+    + EE+   ST   
Sbjct  630  YAAEALCLLNRPVEAGAHLSAYLVGQDDFKLPYEQEDFDQWRMHTSSECEETLDSST--G  687

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++  VFLKPEEARG LF +LAA+ A QG  DQA A    A  ++P + +A +TA+Y+D+
Sbjct  688  NARDSVFLKPEEARGALFADLAALLATQGHHDQAKAMITHALTLLPNNVQATVTAVYIDM  747

Query  435  LQGKTKEAVAKLRKCSSVRFIHNSLPTNGS  346
            + G++++A+ +L++C+ V F+   L    S
Sbjct  748  MLGRSQDALTRLKQCTRVSFVPGRLEVRAS  777



>ref|XP_008668388.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=684

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 143/200 (72%), Gaps = 0/200 (0%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y++I RKE   + QA+LA+LA+VEL L +PL+ L+ A+S+L++ +CS++Y FL +V
Sbjct  465  SLAFYDEIRRKEYIKIRQAVLANLAFVELCLDNPLKTLTYAKSVLQVTDCSRMYAFLSHV  524

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALC L+R ++AAE+LS+Y+ +   VE P+S E+ E   VEK  D E+    + T  
Sbjct  525  YAAEALCTLNRTEDAAENLSVYIRDGNHVELPYSVENSEKALVEKDSDGEDLVAPAVTKL  584

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++    L+PEEARG+L+ NL  ++A QG++++A+       A++P + +A+L ++YVDL
Sbjct  585  ATEEPEQLRPEEARGVLYINLGMIAARQGEVEKANYMVSRGLAMLPNNPRAVLASVYVDL  644

Query  435  LQGKTKEAVAKLRKCSSVRF  376
            LQGK++EAV KLR+C +VRF
Sbjct  645  LQGKSQEAVVKLRRCRNVRF  664



>ref|NP_001169345.1| hypothetical protein [Zea mays]
 gb|ACN33497.1| unknown [Zea mays]
 tpg|DAA39520.1| TPA: hypothetical protein ZEAMMB73_098635 [Zea mays]
Length=831

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 143/200 (72%), Gaps = 0/200 (0%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            S+  Y++I RKE   + QA+LA+LA+VEL L +PL+ L+ A+S+L++ +CS++Y FL +V
Sbjct  612  SLAFYDEIRRKEYIKIRQAVLANLAFVELCLDNPLKTLTYAKSVLQVTDCSRMYAFLSHV  671

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMN  616
            YAAEALC L+R ++AAE+LS+Y+ +   VE P+S E+ E   VEK  D E+    + T  
Sbjct  672  YAAEALCTLNRTEDAAENLSVYIRDGNHVELPYSVENSEKALVEKDSDGEDLVAPAVTKL  731

Query  615  ESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDL  436
             ++    L+PEEARG+L+ NL  ++A QG++++A+       A++P + +A+L ++YVDL
Sbjct  732  ATEEPEQLRPEEARGVLYINLGMIAARQGEVEKANYMVSRGLAMLPNNPRAVLASVYVDL  791

Query  435  LQGKTKEAVAKLRKCSSVRF  376
            LQGK++EAV KLR+C +VRF
Sbjct  792  LQGKSQEAVVKLRRCRNVRF  811



>ref|XP_002984433.1| hypothetical protein SELMODRAFT_41131, partial [Selaginella moellendorffii]
 gb|EFJ14483.1| hypothetical protein SELMODRAFT_41131, partial [Selaginella moellendorffii]
Length=759

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 110/191 (58%), Gaps = 8/191 (4%)
 Frame = -1

Query  942  ENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSR  763
            E  M+   +L DLA+VEL L +PL ALS A + L+    +K Y+FL +VYAAEALCLL R
Sbjct  566  EAAMIRVCVLVDLAFVELCLENPLAALSNAEAALQQHHVTKAYSFLAHVYAAEALCLLDR  625

Query  762  PKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVD---SEESNGG----STTMNESQG  604
             KEA  HL   + +       F +ED  A   +K  D    + S+GG    S  + E   
Sbjct  626  IKEAEGHLEKCMMDWTSSSGDFLEEDTAAA-TQKNGDHNNGDASSGGEDGSSRNLKEQMN  684

Query  603  FVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLLQGK  424
            F      +AR  L+ N AA+ A+QG+L QA   AL A AI P S+ A+L  +YV+L QG+
Sbjct  685  FARFTGTQARASLYVNFAAIHAMQGELLQARQCALQALAIAPGSSMAVLAMVYVELSQGR  744

Query  423  TKEAVAKLRKC  391
            TKEAV  L++C
Sbjct  745  TKEAVTMLKRC  755



>ref|XP_002965785.1| hypothetical protein SELMODRAFT_61158, partial [Selaginella moellendorffii]
 gb|EFJ33205.1| hypothetical protein SELMODRAFT_61158, partial [Selaginella moellendorffii]
Length=759

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 110/193 (57%), Gaps = 12/193 (6%)
 Frame = -1

Query  942  ENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSR  763
            E  M+   +L DLA+VEL L +PL ALS A + L+    +K Y+FL +VYAAEALCLL R
Sbjct  566  EAAMIRVCVLVDLAFVELCLENPLAALSNAEAALQQHHVTKAYSFLAHVYAAEALCLLDR  625

Query  762  PKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG--------GST-TMNES  610
             KEA  HL   + +       F +ED  A   +   + + +NG        GST  + E 
Sbjct  626  IKEAEGHLEKCMMDWTSSSGDFLEEDTAAAAQK---NGDHNNGDASSGGEDGSTRNLKEQ  682

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLLQ  430
              F      +AR  L+ N AA+ A+QG+L QA   AL A AI P S+ A+L  +YV+L Q
Sbjct  683  VNFARFTGTQARASLYVNFAAIHAMQGELLQARQCALQALAIAPGSSMAVLAMVYVELSQ  742

Query  429  GKTKEAVAKLRKC  391
            G+TKEAV  L++C
Sbjct  743  GRTKEAVTMLKRC  755



>ref|XP_001783331.1| predicted protein [Physcomitrella patens]
 gb|EDQ51876.1| predicted protein [Physcomitrella patens]
Length=783

 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 110/185 (59%), Gaps = 16/185 (9%)
 Frame = -1

Query  915  LADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEAAEHLS  736
            LA L+Y +L +G PLRAL +A  LL+   C++ Y  LG+VYAAEALC L RP+EA EHLS
Sbjct  587  LAALSYCQLGVGHPLRALRSAEQLLRQASCARPYMLLGHVYAAEALCHLERPQEALEHLS  646

Query  735  MYLSEIKGVEQPF---SQEDVEAWRVEKVVDSEESNG----GST----TMNESQGFVFLK  589
              L+E     +P    ++E+   W   K  D+ E++G    G+T     + ++     L 
Sbjct  647  TCLNE--ATAEPTNAGTEEENLKW---KGGDNSEASGDGEDGATFSVGALGDAASVARLT  701

Query  588  PEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLLQGKTKEAV  409
               AR  L+ NLAA+ A+QG++ +AH  A +A AI P +  A+L A+YV+L   + + A+
Sbjct  702  GTSARASLYINLAAVYAMQGNIQEAHRLAHSALAIAPTNPTAMLAAVYVELKLERMESAL  761

Query  408  AKLRK  394
            A L++
Sbjct  762  ALLKQ  766



>ref|XP_001781914.1| predicted protein [Physcomitrella patens]
 gb|EDQ53279.1| predicted protein [Physcomitrella patens]
Length=832

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 109/192 (57%), Gaps = 10/192 (5%)
 Frame = -1

Query  945  KENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLS  766
            +E   L    LA LAY +L +  PLRAL +A  LL+   C++ Y  LG+VYAAEALC L 
Sbjct  626  QEAAALRMWALAALAYCQLGVSHPLRALRSAEQLLRQPSCARPYLLLGHVYAAEALCQLE  685

Query  765  RPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG----GST----TMNES  610
            RP+EA EHLS  L+E     +P S    E     K  D+ E++G    G+T     + ++
Sbjct  686  RPQEALEHLSTCLNE--SASEPTSSGTEEESLKWKYGDNSEASGDGEDGATYTVGALGDA  743

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLLQ  430
                 L    AR  L+ NLAA+ A+QG+L +AH  A AA  + P ++ A+L A+YV+L +
Sbjct  744  ASVARLTGTSARVSLYINLAAVYAMQGNLQEAHRLAQAALTMAPTNSTAMLAAVYVELKR  803

Query  429  GKTKEAVAKLRK  394
             +   A+A L++
Sbjct  804  ERMASALALLKQ  815



>gb|AEX11688.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11689.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11690.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11691.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11692.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11693.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11694.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11695.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11696.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11697.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11698.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11699.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11700.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11701.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11702.1| hypothetical protein 0_16547_01, partial [Pinus taeda]
 gb|AEX11703.1| hypothetical protein 0_16547_01, partial [Pinus radiata]
Length=135

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 78/135 (58%), Gaps = 15/135 (11%)
 Frame = -1

Query  843  LKLIECSKIYTFLGNVYAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFS-QEDVEAWRV  667
            LK  ECSK Y +LG++YAAE+LC L+RPKEAA+HLS+ + E   +E  F+  ED   WR 
Sbjct  1    LKQPECSKTYIYLGHIYAAESLCRLNRPKEAAKHLSVCMEEGGNIELAFNGNEDGRKWRS  60

Query  666  EKVVDSEESNGG-----STTMN-------ESQGFVFLKPEEARGILFTNLAAMSAVQGDL  523
             +  +SE S  G     S   N       ES     L   +AR  L+ NLAA+ A+QGDL
Sbjct  61   GE--NSEASGDGEDISSSVVCNSSFGNSIESSSISHLISGQARTALYVNLAAVFAMQGDL  118

Query  522  DQahayalaaaAIIP  478
             QAH YA  A ++ P
Sbjct  119  QQAHQYATQAVSLTP  133



>ref|XP_005827553.1| hypothetical protein GUITHDRAFT_164635 [Guillardia theta CCMP2712]
 gb|EKX40573.1| hypothetical protein GUITHDRAFT_164635 [Guillardia theta CCMP2712]
Length=704

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 89/187 (48%), Gaps = 17/187 (9%)
 Frame = -1

Query  945  KENQMLEQALLADLAYVELELGDPLRALSTARSLL-KLIECSKIYTFLGNVYAAEALCLL  769
             E   L QA+L  +AYV L L +PL +L     LL    +C   Y++   +Y  EALCLL
Sbjct  524  NERWTLRQAILCKMAYVHLCLDNPLMSLKAVNELLANESQCRPEYSYSARMYGTEALCLL  583

Query  768  SRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GSTTMNESQGFV  598
             + +EA   L           +P  Q+D+ A  V       +S     G + M+E+ G V
Sbjct  584  EKSEEAVNML-----------EPLIQKDLFAADVISGCGHGQSPARRCGLSHMSEASGMV  632

Query  597  FLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLLQGKTK  418
              +   AR  L  NLAA+  +Q  L++AH +   A    P     ++ A+Y+++ +G T 
Sbjct  633  --ETAAARSALHINLAAICVMQEKLNEAHQHVRIALNESPTCPAGLMIAVYLEIRKGNTA  690

Query  417  EAVAKLR  397
             A+  L+
Sbjct  691  AALNILK  697



>emb|CBJ25843.1| conserved unknown protein [Ectocarpus siliculosus]
Length=923

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = -1

Query  930  LEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEA  751
            L +  LADLAYV L L DP+ AL+ A  LL+    S + T L ++YAAEALCLL RP EA
Sbjct  724  LYRVALADLAYVHLGLDDPVSALTYAGRLLE-TNPSAVSTHLAHLYAAEALCLLGRPAEA  782

Query  750  AEHLS  736
             EHLS
Sbjct  783  LEHLS  787



>ref|XP_002109023.1| hypothetical protein TRIADDRAFT_52629 [Trichoplax adhaerens]
 gb|EDV29821.1| hypothetical protein TRIADDRAFT_52629 [Trichoplax adhaerens]
Length=627

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 97/203 (48%), Gaps = 26/203 (13%)
 Frame = -1

Query  930  LEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEA  751
            L  A+LA +A+V L+LG+ + AL  ++ LL L     +Y +LG++YAAEAL  L++  EA
Sbjct  437  LRYAILAAIAFVSLQLGELVLALERSKELLALPSLPGLYRYLGHMYAAEALIRLNKIDEA  496

Query  750  AEHLSMYLSEIKGVEQPFSQEDVE-AWRVEKVVDSEESNGGSTTMNESQGFVFLKP-EEA  577
             +HLS           P +  D+  ++  +    SE         + +    F +  E A
Sbjct  497  VQHLS-----------PETITDISCSFSTQPETTSENKTEADNISSAATRHKFPRTIESA  545

Query  576  RGILFTNLAAMSAVQGDLDQahayalaaaAI------IPRSTKAILTAIYVDLLQGKTKE  415
            R ++F NLA+   +Q   ++A      A+ +      IP    A+L +IY++L  G    
Sbjct  546  RALMFVNLASAYCLQRKPEKARKCIEQASVLRLEKEHIP---GAVLISIYIELANGNVAS  602

Query  414  AVAKLRKCSSVRFIHNSLPTNGS  346
            A+  L++     F  N    NGS
Sbjct  603  ALEVLKRQQLYPFQRN----NGS  621



>ref|XP_001622526.1| predicted protein [Nematostella vectensis]
 gb|EDO30426.1| predicted protein, partial [Nematostella vectensis]
Length=683

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 90/189 (48%), Gaps = 10/189 (5%)
 Frame = -1

Query  945  KENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLS  766
            KE   L  ++LA  AYV L LGD + AL  A++LL          F+G++YAAEAL  L+
Sbjct  496  KEVPHLRNSILACSAYVSLGLGDNVTALGHAKNLLSQSGLPGSLKFVGHLYAAEALIKLN  555

Query  765  RPKEAAEHLSM-YLSEIKGVEQPFSQE-DVEAWRVEKVVDSEESNGGSTTMNESQGFVFL  592
            R  EA  HL+   + ++    QP +    V+    ++   +        T++  Q     
Sbjct  556  RISEATIHLAPENVIDMNVCPQPHATTGTVQGGMCKRCGSTLHKRCKEGTVDFPQCV---  612

Query  591  KPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRS---TKAILTAIYVDLLQGKT  421
               E R  L  NLA+   ++ ++D+A      A ++ P      + +L A+YV+LL G  
Sbjct  613  --SEGRTTLLVNLASTYCLRNEVDKAKRCLSQACSMCPPDWCMARIVLVAVYVELLSGNI  670

Query  420  KEAVAKLRK  394
              A+  ++K
Sbjct  671  SGALQTIKK  679



>ref|XP_004603908.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Sorex araneus]
Length=642

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  417  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADRLLQQPKLSGSLKFLGHLYA  476

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  D E    +   ++ ES+G        
Sbjct  477  AEALISLDRISDAITHLNP--ENVTDVSLGISSNDQEQGSEKGDNEAMESSGKRAPQCYP  534

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I PR    +AIL A+Y++
Sbjct  535  SSV-----NSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPREVPPEAILLAVYLE  589

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  590  LQNGNTQLALQIIKR  604



>ref|XP_009050918.1| hypothetical protein LOTGIDRAFT_114420 [Lottia gigantea]
 gb|ESO98211.1| hypothetical protein LOTGIDRAFT_114420 [Lottia gigantea]
Length=632

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 16/143 (11%)
 Frame = -1

Query  930  LEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEA  751
            L  ++L   AY+ L L D L AL+ A++LL+  + S    +LGN+Y AEAL +L R  +A
Sbjct  492  LRCSILCSAAYISLCLNDHLMALNHAKNLLRQTKISGAQRYLGNLYMAEALVVLDRISDA  551

Query  750  AEHLSMYL--SEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPEE-  580
              HL   L  S+I  +     +E VE  + +K  D EE        +E        P+E 
Sbjct  552  VNHLQPDLIKSDINILP---PEEKVE--KTDKEKDKEE------PADEKGPLYQWNPKEL  600

Query  579  --ARGILFTNLAAMSAVQGDLDQ  517
              A+GI+  NLAA+ A++GD ++
Sbjct  601  SQAKGIMNYNLAAVYAIRGDFNK  623



>gb|ETO78825.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
Length=639

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>gb|ETO78822.1| hypothetical protein F444_06345 [Phytophthora parasitica P1976]
 gb|ETO78823.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=708

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>gb|ETP47801.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=639

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>ref|XP_008891725.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI50091.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETK89982.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL43383.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL96567.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETM49721.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETN22478.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETP19882.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=639

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>gb|ETP47798.1| hypothetical protein F442_06328 [Phytophthora parasitica P10297]
 gb|ETP47799.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=708

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>ref|XP_008891724.1| hypothetical protein PPTG_02404 [Phytophthora parasitica INRA-310]
 ref|XP_008891726.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETI50088.1| hypothetical protein F443_06287 [Phytophthora parasitica P1569]
 gb|ETI50089.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETK89979.1| hypothetical protein L915_06162 [Phytophthora parasitica]
 gb|ETK89980.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL43380.1| hypothetical protein L916_06097 [Phytophthora parasitica]
 gb|ETL43381.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL96564.1| hypothetical protein L917_05974 [Phytophthora parasitica]
 gb|ETL96565.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM49718.1| hypothetical protein L914_06095 [Phytophthora parasitica]
 gb|ETM49719.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETN22475.1| hypothetical protein PPTG_02404 [Phytophthora parasitica INRA-310]
 gb|ETN22476.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETP19879.1| hypothetical protein F441_06289 [Phytophthora parasitica CJ01A1]
 gb|ETP19880.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=708

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  554  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  613

Query  753  AAEHL  739
            A E L
Sbjct  614  ATETL  618



>gb|ETP47800.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=707

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  553  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  612

Query  753  AAEHL  739
            A E L
Sbjct  613  ATETL  617



>gb|ETO78824.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
Length=707

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  553  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  612

Query  753  AAEHL  739
            A E L
Sbjct  613  ATETL  617



>ref|XP_008891727.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETI50090.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETK89981.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL43382.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL96566.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM49720.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN22477.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETP19881.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=707

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            ML Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  553  MLRQKALVNLSYVYLSMYEPHLAITSAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  612

Query  753  AAEHL  739
            A E L
Sbjct  613  ATETL  617



>ref|XP_004603907.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Sorex araneus]
Length=802

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  577  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADRLLQQPKLSGSLKFLGHLYA  636

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  D E    +   ++ ES+G        
Sbjct  637  AEALISLDRISDAITHLNP--ENVTDVSLGISSNDQEQGSEKGDNEAMESSGKRAPQCYP  694

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I PR    +AIL A+Y++
Sbjct  695  SSV-----NSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPREVPPEAILLAVYLE  749

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  750  LQNGNTQLALQIIKR  764



>ref|XP_006823331.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like, partial 
[Saccoglossus kowalevskii]
Length=736

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 91/186 (49%), Gaps = 3/186 (2%)
 Frame = -1

Query  942  ENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSR  763
            E + L+ ++LA+ AYV L LGD L AL  + +LL   + S  + FLG++YAAEAL  L +
Sbjct  519  EVESLKCSILANSAYVCLGLGDVLTALEHSINLLNQPKLSGSHKFLGHLYAAEALVSLDK  578

Query  762  PKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPE  583
              +A  HLS+       V  P + E         +  SE S   S T      +     +
Sbjct  579  ISDAISHLSIDSITDVSVTYPGAPEVSGDKGGNDIGGSENSGDVSETPTAVTRYFPASIQ  638

Query  582  EARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRS---TKAILTAIYVDLLQGKTKEA  412
             AR     NL+   +++ + D+A      A ++IP S    +A++ A+Y++L  G    A
Sbjct  639  SARATFLFNLSTSYSLRSEYDKARRALQQACSLIPASEIPQQALILAVYLELQNGNFPLA  698

Query  411  VAKLRK  394
            +  ++K
Sbjct  699  LQMVKK  704



>ref|XP_009519310.1| hypothetical protein PHYSODRAFT_480853 [Phytophthora sojae]
 gb|EGZ24022.1| hypothetical protein PHYSODRAFT_480853 [Phytophthora sojae]
Length=714

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            +L Q  L +L+YV L + +P  A++TA+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  560  VLRQKALVNLSYVYLSMYEPQLAITTAKELLALPTCSKANSFLARSYTAEALCMLSRAPE  619

Query  753  AAEHL  739
            A E L
Sbjct  620  ATEAL  624



>ref|XP_001945509.2| PREDICTED: CCR4-NOT transcription complex subunit 10 [Acyrthosiphon 
pisum]
Length=650

 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 28/131 (21%)
 Frame = -1

Query  903  AYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEAAEHL--SMY  730
            AY+ L LGDP+ AL  ++ LLK  + +K++ FLG++YAAEAL L  +P EA + L  S  
Sbjct  494  AYIALCLGDPVVALKYSQELLKSDKINKVHKFLGHLYAAEALILSDKPNEAIDMLKESNA  553

Query  729  LSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPEEARGILFTNLA  550
              +I+   +   Q  +E W+ +                        K + A+ +L+ NLA
Sbjct  554  FDDIE--PEIHEQLRIEQWKPD------------------------KQKSAKAVLYYNLA  587

Query  549  AMSAVQGDLDQ  517
                ++GDLD+
Sbjct  588  VALTLRGDLDK  598



>ref|XP_004603909.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Sorex araneus]
Length=615

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 92/186 (49%), Gaps = 10/186 (5%)
 Frame = -1

Query  942  ENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSR  763
            E++    ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YAAEAL  L R
Sbjct  399  ESETCRCSILACSAYVALALGDNLMALNHADRLLQQPKLSGSLKFLGHLYAAEALISLDR  458

Query  762  PKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPE  583
              +A  HL+     +  V    S  D E    +   ++ ES+G                 
Sbjct  459  ISDAITHLNP--ENVTDVSLGISSNDQEQGSEKGDNEAMESSGKRAPQCYPSSV-----N  511

Query  582  EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVDLLQGKTKEA  412
             AR ++  NL +   ++ + D+A      AA++I PR    +AIL A+Y++L  G T+ A
Sbjct  512  SARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPREVPPEAILLAVYLELQNGNTQLA  571

Query  411  VAKLRK  394
            +  +++
Sbjct  572  LQIIKR  577



>ref|XP_009077648.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Acanthisitta chloris]
Length=736

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  510  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  569

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  D +    +   ++ ES+G  T     
Sbjct  570  AEALISLDRISDAITHLNP--ENVTDVSLGISSNDQDQGSDKGENEAMESSGKQTPQCYP  627

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  628  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  682

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  683  LQNGNTQLALQIIKR  697



>ref|XP_010182737.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Mesitornis 
unicolor]
Length=785

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  559  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  618

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   D+ ES+G  T     
Sbjct  619  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENDAMESSGKQTPQCYP  676

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  677  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  731

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  732  LQNGNTQLALQIIKR  746



>gb|KFP72367.1| CCR4-NOT transcription complex subunit 10, partial [Acanthisitta 
chloris]
Length=737

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  511  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  570

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  D +    +   ++ ES+G  T     
Sbjct  571  AEALISLDRISDAITHLNP--ENVTDVSLGISSNDQDQGSDKGENEAMESSGKQTPQCYP  628

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  629  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  683

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  684  LQNGNTQLALQIIKR  698



>ref|XP_011494326.1| PREDICTED: CCR4-NOT transcription complex subunit 10-B [Ceratosolen 
solmsi marchali]
Length=757

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 77/156 (49%), Gaps = 16/156 (10%)
 Frame = -1

Query  975  SIPDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNV  796
            +IP    I   EN  L+ ++L   AY+ L LGD L AL  A+SLL + +    +  LGN+
Sbjct  563  TIPSQSTIV--ENLNLKISILTASAYISLCLGDYLLALEYAKSLLSIKKLPGAHLLLGNL  620

Query  795  YAAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRV--EKVVDSEESNGGSTT  622
            YAAE+L  L R  EA EHL           +P + +D+  +    E V D E+       
Sbjct  621  YAAESLIFLDRIYEALEHL-----------KPENLQDINTYIPIGEVVGDKEKIIEEIIE  669

Query  621  MNESQ-GFVFLKPEEARGILFTNLAAMSAVQGDLDQ  517
               S+  +  L    A+ IL  NLA   A++G+LD+
Sbjct  670  QKPSRISWYPLNIATAKSILRYNLAVAYAIRGELDK  705



>ref|XP_002594087.1| hypothetical protein BRAFLDRAFT_118793 [Branchiostoma floridae]
 gb|EEN50098.1| hypothetical protein BRAFLDRAFT_118793 [Branchiostoma floridae]
Length=775

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 95/183 (52%), Gaps = 10/183 (5%)
 Frame = -1

Query  930  LEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEA  751
            L  ++LA  AYV L LGD + AL  A++LL     S    FLG++YAAEAL  L +  EA
Sbjct  564  LRCSVLACSAYVALGLGDNVTALHHAQNLLTQPSLSGSLKFLGHLYAAEALISLDQVSEA  623

Query  750  AEHLSM-YLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPEEAR  574
             +HL+   +S++  V  P + +       EK   S+E     +    SQ +     + A+
Sbjct  624  IQHLNPDNISDV-SVSLPGTVDTT----AEKGKGSDEGEERESQAVHSQNYPH-SLQSAK  677

Query  573  GILFTNLAAMSAVQGDLDQahayalaaaAIIPRS---TKAILTAIYVDLLQGKTKEAVAK  403
              L  NLA+   ++ + ++A      AA++IP +    +AI+  +Y++L  G TK A+  
Sbjct  678  ATLMFNLASAHCLRSEFEKAKKCLHQAASLIPPNEIPPQAIMLGVYLELQSGNTKLALQI  737

Query  402  LRK  394
            ++K
Sbjct  738  IKK  740



>ref|XP_010132750.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Buceros rhinoceros silvestris]
Length=614

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  388  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  447

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   +S ES+G  T     
Sbjct  448  AEALISLDRISDAIAHLNP--ENVTDVSLGISSNEQDQGSDKGESESMESSGKQTPQCYP  505

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  506  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  560

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  561  LQNGNTQLALQIIKR  575



>ref|NP_001084582.1| CCR4-NOT transcription complex subunit 10-B [Xenopus laevis]
 sp|Q6NU53.1|CN10B_XENLA RecName: Full=CCR4-NOT transcription complex subunit 10-B [Xenopus 
laevis]
 gb|AAH68748.1| MGC81242 protein [Xenopus laevis]
Length=748

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 99/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + R+E + L  ++LA +AYV L LGD L AL+ A  LL+    S    FLG++YA
Sbjct  521  PPSSPLRRQEVENLRCSVLACIAYVALALGDNLMALNHAEKLLQQPRLSGSLKFLGHLYA  580

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  V      + S+ G     ES
Sbjct  581  AEALISLDRISDAITHLN-----------PENVTDV-SLGVSSNEQEQGSDKGENEPMES  628

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  629  AGKQI--PQCYPSSVTSARTMMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEIPPEAI  686

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  687  LLAVYLELQNGNTQLALQIIKR  708



>ref|XP_007614074.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3, partial [Cricetulus griseus]
Length=339

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 100/200 (50%), Gaps = 20/200 (10%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  113  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALSHADQLLQQPKLSGSLKFLGHLYA  172

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  173  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  220

Query  609  QGFVFLK--P---EEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILT  454
             G    +  P     AR ++  NL +   ++ + D+A      AA++I P+    +AIL 
Sbjct  221  SGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILL  280

Query  453  AIYVDLLQGKTKEAVAKLRK  394
            A+Y++L  G T+ A+  +++
Sbjct  281  AVYLELQNGNTQLALQMIKR  300



>dbj|BAB14478.1| unnamed protein product [Homo sapiens]
Length=744

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 99/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G + TM ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENETM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_009508096.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Phalacrocorax 
carbo]
Length=753

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  527  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  586

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   +S ES+G  T     
Sbjct  587  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENESMESSGKQTPQCYP  644

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  645  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  699

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  700  LQNGNTQLALQIIKR  714



>ref|XP_008546859.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Microplitis 
demolitor]
Length=784

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 72/145 (50%), Gaps = 18/145 (12%)
 Frame = -1

Query  930  LEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKEA  751
            L+ A+L   AYV L LGD + AL  AR+LLK+      Y  LGN+YAAE+L L+ +  EA
Sbjct  599  LKIAILTASAYVSLCLGDYVLALEHARTLLKIESLPGAYKMLGNLYAAESLILMDKINEA  658

Query  750  AEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE-------SQGFVFL  592
              HL +            + ED+       V+ +++ +  S   NE       S  +   
Sbjct  659  IAHLRLQ-----------NLEDISTAMPTVVIPADQDDDDSDKKNEVKRESSLSASWFPK  707

Query  591  KPEEARGILFTNLAAMSAVQGDLDQ  517
                A+GIL  NLA   A++G+LD+
Sbjct  708  SLNTAKGILRYNLAVSYAIRGELDK  732



>ref|XP_004662037.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Jaculus 
jaculus]
Length=740

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  514  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHAEKLLQQPKLSGSLKFLGHLYA  573

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  574  AEALISLDRISDAITHLN-----------PENVTDVSLGVSSNEQDQGSDKGDNEAM-ES  621

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  622  SG--KRAPQCYPSSVSSARTVMLFNLGSAHCLRSEYDKARKCLHQAASMIHPKEVPPEAI  679

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  680  LLAVYLELQNGNTQLALQIIKR  701



>ref|XP_007628400.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Cricetulus griseus]
Length=744

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALSHADQLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQMIKR  705



>ref|XP_002901762.1| CCR4-NOT transcription complex subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY57152.1| CCR4-NOT transcription complex subunit, putative [Phytophthora 
infestans T30-4]
Length=706

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  933  MLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRPKE  754
            +L Q  L +L+YV L + +P  A+++A+ LL L  CSK  +FL   Y AEALC+LSR  E
Sbjct  552  VLRQKALVNLSYVYLSMYEPQLAITSAKELLVLPTCSKANSFLARSYTAEALCMLSRAAE  611

Query  753  AAEHL  739
            A E L
Sbjct  612  ATETL  616



>ref|NP_001016273.1| CCR4-NOT transcription complex, subunit 10 [Xenopus (Silurana) 
tropicalis]
 emb|CAJ83566.1| CCR4-NOT transcription complex, subunit 10 [Xenopus (Silurana) 
tropicalis]
Length=510

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 98/203 (48%), Gaps = 26/203 (13%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + R+E + L  ++LA  AYV L LGD L AL+ A  LL+    S    FLG++YA
Sbjct  277  PPSSPLRRQEVENLRCSVLACSAYVALALGDNLMALNHAEKLLQQPRLSGSLKFLGHLYA  336

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV       V  +E+  G     NE 
Sbjct  337  AEALISLDRISDAITHLN-----------PENVTDVSLG----VSSNEQEQGSDKGENEP  381

Query  609  QGFVFLK-PE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KA  463
               V  + P+        AR ++  NL +   ++ + D+A      AA++I P+    +A
Sbjct  382  MESVGKQMPQCYPSSVTSARTMMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEIPPEA  441

Query  462  ILTAIYVDLLQGKTKEAVAKLRK  394
            IL A+Y++L  G T+ A+  +++
Sbjct  442  ILLAVYLELQNGNTQLALQIIKR  464



>ref|XP_009485879.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Pelecanus 
crispus]
Length=451

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  225  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  284

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  285  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  342

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  343  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  397

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  398  LQNGNTQLALQIIKR  412



>ref|XP_006890682.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Elephantulus edwardii]
Length=644

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  418  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALSHADKLLQQPKLSGSLKFLGHLYA  477

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  478  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  525

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  526  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  583

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  584  LLAVYLELQNGNTQLALQIIKR  605



>ref|XP_005075085.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Mesocricetus auratus]
Length=743

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLVALSHADQLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQMIKR  704



>ref|XP_008936076.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Merops nubicus]
Length=339

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  113  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  172

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  173  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  230

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  231  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  285

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  286  LQNGNTQLALQIIKR  300



>ref|XP_008850151.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Nannospalax galili]
Length=744

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 97/202 (48%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M  S
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAMESS  626

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
               V   P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  627  GKRV---PQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>gb|KFQ35636.1| CCR4-NOT transcription complex subunit 10, partial [Mesitornis 
unicolor]
Length=738

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 98/196 (50%), Gaps = 11/196 (6%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQ-ALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            P    + ++E + L Q ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++Y
Sbjct  511  PPSSPLKKQELENLRQCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLY  570

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE  613
            AAEAL  L R  +A  HL+     +  V    S  + +    +   D+ ES+G  T    
Sbjct  571  AAEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENDAMESSGKQTPQCY  628

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYV  442
                       AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y+
Sbjct  629  PSSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYL  683

Query  441  DLLQGKTKEAVAKLRK  394
            +L  G T+ A+  +++
Sbjct  684  ELQNGNTQLALQIIKR  699



>ref|XP_008850152.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Nannospalax galili]
Length=743

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 97/202 (48%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M  S
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAMESS  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
               V   P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  GKRV---PQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQIIKR  704



>ref|XP_005075084.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Mesocricetus auratus]
Length=744

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLVALSHADQLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQMIKR  705



>ref|XP_009958067.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Leptosomus discolor]
 ref|XP_009965124.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like, partial 
[Tyto alba]
Length=339

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  113  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  172

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  173  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  230

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  231  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  285

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  286  LQNGNTQLALQIIKR  300



>ref|XP_008850156.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X5 [Nannospalax galili]
Length=608

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 97/202 (48%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  382  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  441

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M  S
Sbjct  442  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAMESS  490

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
               V   P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  491  GKRV---PQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  547

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  548  LLAVYLELQNGNTQLALQIIKR  569



>ref|NP_001086651.1| CCR4-NOT transcription complex subunit 10-A [Xenopus laevis]
 sp|Q6DE97.1|CN10A_XENLA RecName: Full=CCR4-NOT transcription complex subunit 10-A [Xenopus 
laevis]
 gb|AAH77237.1| Cnot10-prov protein [Xenopus laevis]
Length=748

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 98/203 (48%), Gaps = 26/203 (13%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + R+E + L  ++LA  AYV L LGD L AL+ A  LL+    S    FLG++YA
Sbjct  521  PPSSPLKRQEVENLRCSVLACSAYVGLALGDNLMALNHAEKLLQQPRLSGSLKFLGHLYA  580

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV       V  +E+  G     NE 
Sbjct  581  AEALISLDRISDAITHLN-----------PENVTDVSLG----VSSNEQEQGSDKGENEP  625

Query  609  QGFVFLK-PE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKA  463
               V  + P+        AR ++  NL +   ++ + D+A      AA++I P+    +A
Sbjct  626  MESVGKQMPQCYPSSVTSARTMMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEIPPEA  685

Query  462  ILTAIYVDLLQGKTKEAVAKLRK  394
            IL A+Y++L  G T+ A+  +++
Sbjct  686  ILLAVYLELQNGNTQLALQIIKR  708



>ref|XP_010165272.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Caprimulgus carolinensis]
Length=339

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  113  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  172

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  173  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  230

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  231  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  285

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  286  LQNGNTQLALQIIKR  300



>ref|XP_005075083.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Mesocricetus auratus]
Length=803

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  577  PPSSPLRKQELENLKCSILACSAYVALALGDNLVALSHADQLLQQPKLSGSLKFLGHLYA  636

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  637  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  684

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  685  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  742

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  743  LLAVYLELQNGNTQLALQMIKR  764



>gb|KFO88687.1| CCR4-NOT transcription complex subunit 10, partial [Buceros rhinoceros 
silvestris]
Length=603

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 98/196 (50%), Gaps = 11/196 (6%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQ-ALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            P    + ++E + L Q ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++Y
Sbjct  376  PPSSPLKKQELENLRQCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLY  435

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE  613
            AAEAL  L R  +A  HL+     +  V    S  + +    +   +S ES+G  T    
Sbjct  436  AAEALISLDRISDAIAHLNP--ENVTDVSLGISSNEQDQGSDKGESESMESSGKQTPQCY  493

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYV  442
                       AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y+
Sbjct  494  PSSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYL  548

Query  441  DLLQGKTKEAVAKLRK  394
            +L  G T+ A+  +++
Sbjct  549  ELQNGNTQLALQIIKR  564



>ref|XP_006890680.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Elephantulus edwardii]
Length=744

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L ALS A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALSHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_004588305.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Ochotona princeps]
Length=804

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  578  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  637

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  V      + S+ G     ES
Sbjct  638  AEALISLDRISDAITHLN-----------PENVTDV-SLGVSSNEQDQGSDKGENEAMES  685

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  686  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASVIHPKEVPPEAI  743

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  744  LLAVYLELQNGNTQLALQIIKR  765



>ref|XP_010202620.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Colius 
striatus]
Length=645

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  419  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  478

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  479  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  536

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  537  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  591

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  592  LQNGNTQLALQIIKR  606



>ref|XP_010711381.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Meleagris 
gallopavo]
Length=793

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  567  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  626

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  627  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  684

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  685  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  739

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  740  LQNGNTQLALQIIKR  754



>ref|XP_009686200.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Struthio camelus australis]
 ref|XP_009686202.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Struthio camelus australis]
Length=645

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  419  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  478

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  479  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  536

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  537  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  591

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  592  LQNGNTQLALQIIKR  606



>ref|XP_009820912.1| hypothetical protein H257_00088 [Aphanomyces astaci]
 gb|ETV88512.1| hypothetical protein H257_00088 [Aphanomyces astaci]
Length=749

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -1

Query  969  PDYEDICRKEN-QMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            PD   +  +++ ++L Q  L +LAY  L +  P  A+ TA+ LL +  C+  + FL   Y
Sbjct  583  PDSSGVSLEDSLELLRQKALVNLAYAYLSMNAPELAIHTAKELLSMPTCTPAHRFLVRSY  642

Query  792  AAEALCLLSRPKEAAEHLSM  733
             AEALCLLSR  EA+ HL +
Sbjct  643  YAEALCLLSRSAEASVHLKL  662



>ref|XP_005152908.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Melopsittacus undulatus]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSIT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|NP_001006364.1| CCR4-NOT transcription complex subunit 10 [Gallus gallus]
 sp|Q5ZIW2.1|CNO10_CHICK RecName: Full=CCR4-NOT transcription complex subunit 10 [Gallus 
gallus]
 emb|CAG32331.1| hypothetical protein RCJMB04_23c21 [Gallus gallus]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_009820913.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV88513.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=702

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -1

Query  969  PDYEDICRKEN-QMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            PD   +  +++ ++L Q  L +LAY  L +  P  A+ TA+ LL +  C+  + FL   Y
Sbjct  583  PDSSGVSLEDSLELLRQKALVNLAYAYLSMNAPELAIHTAKELLSMPTCTPAHRFLVRSY  642

Query  792  AAEALCLLSRPKEAAEHLSM  733
             AEALCLLSR  EA+ HL +
Sbjct  643  YAEALCLLSRSAEASVHLKL  662



>ref|XP_004588307.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Ochotona princeps]
Length=743

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  V      + S+ G     ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDV-SLGVSSNEQDQGSDKGENEAMES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASVIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQIIKR  704



>ref|XP_005242317.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Falco peregrinus]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_011594399.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Aquila chrysaetos canadensis]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_009820915.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 gb|ETV88515.1| hypothetical protein, variant 3 [Aphanomyces astaci]
Length=642

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -1

Query  969  PDYEDICRKEN-QMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            PD   +  +++ ++L Q  L +LAY  L +  P  A+ TA+ LL +  C+  + FL   Y
Sbjct  523  PDSSGVSLEDSLELLRQKALVNLAYAYLSMNAPELAIHTAKELLSMPTCTPAHRFLVRSY  582

Query  792  AAEALCLLSRPKEAAEHLSM  733
             AEALCLLSR  EA+ HL +
Sbjct  583  YAEALCLLSRSAEASVHLKL  602



>ref|XP_010560711.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Haliaeetus leucocephalus]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_009989295.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Tauraco 
erythrolophus]
Length=756

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  530  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  589

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  590  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  647

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  648  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  702

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  703  LQNGNTQLALQIIKR  717



>ref|XP_005514069.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Columba 
livia]
Length=709

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  483  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  542

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  543  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  600

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  601  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  655

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  656  LQNGNTQLALQIIKR  670



>ref|XP_004588306.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Ochotona princeps]
Length=744

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  V      + S+ G     ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDV-SLGVSSNEQDQGSDKGENEAMES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASVIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_009686199.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Struthio camelus australis]
Length=725

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  499  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  558

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  559  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  616

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  617  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  671

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  672  LQNGNTQLALQIIKR  686



>ref|XP_009896680.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Picoides 
pubescens]
Length=715

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  489  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  548

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  549  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  606

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  607  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  661

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  662  LQNGNTQLALQIIKR  676



>ref|XP_010397659.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Corvus 
cornix cornix]
Length=776

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  550  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  609

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  610  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  667

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  668  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  722

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  723  LQNGNTQLALQIIKR  737



>emb|CAB56027.2| hypothetical protein [Homo sapiens]
Length=263

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 20/200 (10%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  37   PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  96

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  97   AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  144

Query  609  QGFVFLK--P---EEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILT  454
             G    +  P     AR ++  NL +   ++ + D+A      AA++I P+    +AIL 
Sbjct  145  SGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILL  204

Query  453  AIYVDLLQGKTKEAVAKLRK  394
            A+Y++L  G T+ A+  +++
Sbjct  205  AVYLELQNGNTQLALQIIKR  224



>ref|XP_009568705.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Cuculus 
canorus]
Length=775

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  549  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  608

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  609  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  666

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  667  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  721

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  722  LQNGNTQLALQIIKR  736



>ref|XP_009918257.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Haliaeetus albicilla]
Length=736

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  510  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  569

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  570  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  627

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  628  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  682

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  683  LQNGNTQLALQIIKR  697



>ref|XP_009936379.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Opisthocomus 
hoazin]
Length=756

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  530  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  589

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  590  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  647

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  648  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  702

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  703  LQNGNTQLALQIIKR  717



>ref|XP_009820914.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV88514.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=689

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 91/197 (46%), Gaps = 32/197 (16%)
 Frame = -1

Query  969  PDYEDICRKEN-QMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVY  793
            PD   +  +++ ++L Q  L +LAY  L +  P  A+ TA+ LL +  C+  + FL   Y
Sbjct  523  PDSSGVSLEDSLELLRQKALVNLAYAYLSMNAPELAIHTAKELLSMPTCTPAHRFLVRSY  582

Query  792  AAEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNE  613
             AEALCLLSR  EA+ HL   L+++  +   +++E              +++  +   N 
Sbjct  583  YAEALCLLSRSAEASVHLK--LNDMLSLADAYARE-------------AKADTAAVHAN-  626

Query  612  SQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTKAILTAIYVDLL  433
                           L  N A ++ +Q ++ QA      A  + P S  ++   +Y+ L 
Sbjct  627  ---------------LHVNNATVAILQKNMPQAEQSVAQAVRLAPTSRHSLELLVYILLR  671

Query  432  QGKTKEAVAKLRKCSSV  382
            +G + +A+  L++   V
Sbjct  672  KGHSNKAMQILKEARVV  688



>ref|XP_009890276.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Charadrius 
vociferus]
Length=747

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  521  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  580

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  581  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  638

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  639  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  693

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  694  LQNGNTQLALQIIKR  708



>ref|XP_008632217.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Corvus 
brachyrhynchos]
Length=756

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  530  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  589

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  590  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  647

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  648  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  702

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  703  LQNGNTQLALQIIKR  717



>ref|XP_006030270.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Alligator sinensis]
Length=745

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  519  PPSSPLRKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  578

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  579  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  636

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  637  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  691

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  692  LQNGNTQLALQIIKR  706



>ref|XP_009464806.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Nipponia 
nippon]
Length=762

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  536  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  595

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  596  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  653

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  654  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  708

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  709  LQNGNTQLALQIIKR  723



>ref|XP_010121881.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Chlamydotis macqueenii]
Length=736

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  510  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  569

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  570  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  627

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  628  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  682

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  683  LQNGNTQLALQIIKR  697



>ref|XP_005481122.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Zonotrichia 
albicollis]
Length=739

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  513  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  572

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  573  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  630

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  631  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  685

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  686  LQNGNTQLALQIIKR  700



>ref|XP_010005916.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Chaetura 
pelagica]
Length=801

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  575  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  634

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  635  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  692

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  693  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  747

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  748  LQNGNTQLALQIIKR  762



>ref|XP_005445960.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Falco cherrug]
Length=783

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  557  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  616

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  617  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  674

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  675  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  729

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  730  LQNGNTQLALQIIKR  744



>ref|XP_002198182.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Taeniopygia 
guttata]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_009864642.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Apaloderma 
vittatum]
Length=809

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  583  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  642

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  643  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  700

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  701  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  755

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  756  LQNGNTQLALQIIKR  770



>ref|XP_003215704.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Anolis 
carolinensis]
Length=743

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 98/199 (49%), Gaps = 18/199 (9%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLRCSILACSAYVSLALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDV----EAWRVEKVVDSEESNGGSTT  622
            AEAL  L R  +A  HL+           P +  DV     +   ++  D  E+    TT
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAMETT  625

Query  621  MNESQGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTA  451
              ++          AR ++  NL +   ++ + D+A      AA++I P+    +AIL A
Sbjct  626  GKQTPQCYPSSVTSARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLA  685

Query  450  IYVDLLQGKTKEAVAKLRK  394
            +Y++L  G T+ A+  +++
Sbjct  686  VYLELQNGNTQLALQIIKR  704



>ref|XP_008931797.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Manacus 
vitellinus]
Length=743

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  577  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  634

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  635  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  689

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  690  LQNGNTQLALQIIKR  704



>gb|ENN80040.1| hypothetical protein YQE_03517, partial [Dendroctonus ponderosae]
 gb|ERL88756.1| hypothetical protein D910_06138 [Dendroctonus ponderosae]
Length=663

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = -1

Query  951  CRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCL  772
            C +E Q L+ A+LA  AYV L LGD + AL  A+ LL     S ++  LGN+Y AE L L
Sbjct  480  CTQEIQGLKNAILAATAYVCLCLGDYVTALGFAKDLLAQERISGVHKLLGNMYTAECLVL  539

Query  771  LSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFL  592
              R  EA ++L    + I+ +     QED +    E +V++    G      E+      
Sbjct  540  CDRIPEALDYLDP--NTIQDISFHLPQEDND----ENLVNTRPPLGWFPNNMET------  587

Query  591  KPEEARGILFTNLAAMSAVQGDLDQ  517
                   ++  N+A    ++G LDQ
Sbjct  588  ----VHAVMQYNIAVAKTIRGQLDQ  608



>ref|XP_009084396.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Serinus canaria]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_005519035.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Pseudopodoces humilis]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|XP_009322480.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Pygoscelis 
adeliae]
Length=749

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  523  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  582

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  583  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  640

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  641  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  695

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  696  LQNGNTQLALQIIKR  710



>ref|XP_010560712.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Haliaeetus leucocephalus]
Length=694

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  468  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  527

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  528  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  585

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  586  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  640

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  641  LQNGNTQLALQIIKR  655



>dbj|BAE29186.1| unnamed protein product [Mus musculus]
Length=718

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQMIKR  704



>gb|KFV65664.1| CCR4-NOT transcription complex subunit 10, partial [Picoides 
pubescens]
Length=737

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  511  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  570

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  571  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  628

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  629  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  683

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  684  LQNGNTQLALQIIKR  698



>ref|XP_009633458.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Egretta 
garzetta]
Length=791

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  565  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  624

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  625  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  682

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  683  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  737

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  738  LQNGNTQLALQIIKR  752



>ref|XP_009686198.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Struthio camelus australis]
Length=751

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  525  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  584

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  585  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  642

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  643  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  697

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  698  LQNGNTQLALQIIKR  712



>gb|EDL76985.1| CCR4-NOT transcription complex, subunit 10, isoform CRA_a [Rattus 
norvegicus]
Length=743

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQMIKR  704



>ref|XP_008502597.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Calypte anna]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  578  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  635

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  636  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  690

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  691  LQNGNTQLALQIIKR  705



>ref|NP_001007004.1| CCR4-NOT transcription complex subunit 10 [Rattus norvegicus]
 sp|Q5XIA4.1|CNO10_RAT RecName: Full=CCR4-NOT transcription complex subunit 10 [Rattus 
norvegicus]
 gb|AAH83782.1| CCR4-NOT transcription complex, subunit 10 [Rattus norvegicus]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQMIKR  705



>ref|XP_011594400.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Aquila chrysaetos canadensis]
Length=694

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  468  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  527

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  528  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  585

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  586  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  640

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  641  LQNGNTQLALQIIKR  655



>ref|XP_005348101.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Microtus ochrogaster]
Length=743

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQMIKR  704



>ref|XP_005348100.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Microtus ochrogaster]
Length=744

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQMIKR  705



>ref|XP_005018050.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Anas platyrhynchos]
Length=745

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  519  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  578

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  579  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  636

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  637  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  691

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  692  LQNGNTQLALQIIKR  706



>ref|XP_009286934.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Aptenodytes 
forsteri]
Length=747

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  521  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  580

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  581  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  638

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  639  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  693

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  694  LQNGNTQLALQIIKR  708



>ref|XP_010072903.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Pterocles gutturalis]
Length=736

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  510  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  569

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  570  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  627

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  628  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  682

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  683  LQNGNTQLALQIIKR  697



>ref|XP_010288588.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Phaethon lepturus]
Length=736

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  510  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  569

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  570  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  627

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  628  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  682

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  683  LQNGNTQLALQIIKR  697



>gb|KFU85082.1| CCR4-NOT transcription complex subunit 10, partial [Chaetura 
pelagica]
Length=737

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  511  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  570

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  571  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  628

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  629  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  683

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  684  LQNGNTQLALQIIKR  698



>ref|XP_005423462.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Geospiza 
fortis]
Length=755

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  529  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  588

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  589  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  646

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  647  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  701

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  702  LQNGNTQLALQIIKR  716



>ref|XP_006512462.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Mus musculus]
 gb|EDL09303.1| CCR4-NOT transcription complex, subunit 10, isoform CRA_d [Mus 
musculus]
Length=743

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQMIKR  704



>ref|XP_008850155.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X4 [Nannospalax galili]
Length=717

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 91/192 (47%), Gaps = 24/192 (13%)
 Frame = -1

Query  939  NQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLLSRP  760
            N+    ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YAAEAL  L R 
Sbjct  501  NETCRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRI  560

Query  759  KEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNESQGFVFLKPE-  583
             +A  HL+           P +  DV         D     G +  M  S   V   P+ 
Sbjct  561  SDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAMESSGKRV---PQC  606

Query  582  ------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVDLLQ  430
                   AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++L  
Sbjct  607  YPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAVYLELQN  666

Query  429  GKTKEAVAKLRK  394
            G T+ A+  +++
Sbjct  667  GNTQLALQIIKR  678



>ref|XP_005348099.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Microtus ochrogaster]
Length=803

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  577  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  636

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  637  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  684

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  685  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  742

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  743  LLAVYLELQNGNTQLALQMIKR  764



>ref|XP_003772099.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Sarcophilus 
harrisii]
Length=805

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  579  PPSSPLRKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  638

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  639  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  696

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  697  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEIPPEAILLAVYLE  751

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  752  LQNGNTQLALQIIKR  766



>ref|XP_010305264.1| PREDICTED: CCR4-NOT transcription complex subunit 10, partial 
[Balearica regulorum gibbericeps]
Length=735

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  509  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  568

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  569  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  626

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  627  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  681

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  682  LQNGNTQLALQIIKR  696



>ref|XP_011241357.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Mus musculus]
Length=567

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  341  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  400

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  401  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  448

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  449  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  506

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  507  LLAVYLELQNGNTQLALQMIKR  528



>ref|XP_005041178.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Ficedula 
albicollis]
Length=759

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  533  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  592

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  593  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  650

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  651  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  705

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  706  LQNGNTQLALQIIKR  720



>ref|NP_705813.2| CCR4-NOT transcription complex subunit 10 [Mus musculus]
 sp|Q8BH15.1|CNO10_MOUSE RecName: Full=CCR4-NOT transcription complex subunit 10 [Mus 
musculus]
 gb|AAH39183.1| CCR4-NOT transcription complex, subunit 10 [Mus musculus]
 dbj|BAC26299.1| unnamed protein product [Mus musculus]
Length=744

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQMIKR  705



>emb|CDQ83463.1| unnamed protein product [Oncorhynchus mykiss]
Length=732

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 96/198 (48%), Gaps = 30/198 (15%)
 Frame = -1

Query  948  RKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYAAEALCLL  769
            ++E + L  +LLA  AYV L LGD L AL+ A  LL   + S    FLG++YAAEAL  L
Sbjct  509  KQEVENLRCSLLACSAYVALVLGDNLMALNHAEKLLHQTKLSGSLKFLGHLYAAEALISL  568

Query  768  SRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNG---GSTTMNESQG--  604
             R  EA  HL+           P +  DV       V+ SE+  G   G     ES G  
Sbjct  569  DRISEAIGHLN-----------PENVTDVSMG----VLSSEQDQGPDKGDLEPVESSGKQ  613

Query  603  FVFLKP---EEARGILFTNLAAMSAVQGDLDQahayalaaaAIIPRSTK-----AILTAI  448
                 P     AR I+  NL +   ++ + ++A      AA+++  +TK     AIL A+
Sbjct  614  TPLCYPSTVSSARAIMLFNLGSAYCLRSEYEKARKCLHQAASMV--NTKEIPPEAILLAV  671

Query  447  YVDLLQGKTKEAVAKLRK  394
            Y++L  G T+ A+  +++
Sbjct  672  YLELQNGNTQLALQIIKR  689



>gb|EDL09301.1| CCR4-NOT transcription complex, subunit 10, isoform CRA_b, partial 
[Mus musculus]
Length=799

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  573  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADQLLQQPKLSGSLKFLGHLYA  632

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  633  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  680

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  681  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  738

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  739  LLAVYLELQNGNTQLALQMIKR  760



>ref|XP_004822254.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Mustela 
putorius furo]
Length=777

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (49%), Gaps = 26/203 (13%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  552  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  611

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV       +  +E+  G     NE+
Sbjct  612  AEALISLDRISDAITHLN-----------PENVTDVSL----GISSNEQDQGSDKGENEA  656

Query  609  QGFVFLKPEE--------ARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KA  463
                  +  +        AR ++  NL +   ++ + D+A      AA++I P+    +A
Sbjct  657  MESTGKRAPQCYPSSVTSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEA  716

Query  462  ILTAIYVDLLQGKTKEAVAKLRK  394
            IL A+Y++L  G T+ A+  +++
Sbjct  717  ILLAVYLELQNGNTQLALQIIKR  739



>ref|XP_004774263.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Mustela 
putorius furo]
Length=786

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (49%), Gaps = 26/203 (13%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  561  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  620

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV       +  +E+  G     NE+
Sbjct  621  AEALISLDRISDAITHLN-----------PENVTDVSL----GISSNEQDQGSDKGENEA  665

Query  609  QGFVFLKPEE--------ARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KA  463
                  +  +        AR ++  NL +   ++ + D+A      AA++I P+    +A
Sbjct  666  MESTGKRAPQCYPSSVTSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEA  725

Query  462  ILTAIYVDLLQGKTKEAVAKLRK  394
            IL A+Y++L  G T+ A+  +++
Sbjct  726  ILLAVYLELQNGNTQLALQIIKR  748



>ref|XP_010217630.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Tinamus 
guttatus]
Length=817

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  591  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  650

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  651  AEALISLDRISDAITHLNP--ENVTDVSLGVSSNEQDQGSDKGENEAMESSGKQTPQCYP  708

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  709  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLQQAASLIHPKEIPPEAILLAVYLE  763

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  764  LQNGNTQLALQIIKR  778



>ref|XP_007191588.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X1 [Balaenoptera acutorostrata scammoni]
Length=642

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  417  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  476

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  477  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  524

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  525  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  582

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  583  LLAVYLELQNGNTQLALQIIKR  604



>ref|XP_004315390.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
1 [Tursiops truncatus]
Length=803

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  578  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  637

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  638  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  685

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  686  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  743

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  744  LLAVYLELQNGNTQLALQIIKR  765



>ref|XP_007505291.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X6 [Monodelphis domestica]
Length=773

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  547  PPSSPLRKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  606

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  607  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGPDKGENEAMESSGKQTPQCYP  664

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PR--STKAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  665  SSV-----NSARTMMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEIPPEAILLAVYLE  719

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  720  LQNGNTQLALQIIKR  734



>dbj|BAB15629.1| unnamed protein product [Homo sapiens]
Length=451

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 97/195 (50%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  225  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  284

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G        
Sbjct  285  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYP  342

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  343  SSV-----NSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAILLAVYLE  397

Query  438  LLQGKTKEAVAKLRK  394
            L  G T+ A+  +++
Sbjct  398  LQNGNTQLALQIIKR  412



>ref|XP_009703032.1| PREDICTED: CCR4-NOT transcription complex subunit 10 [Cariama 
cristata]
Length=745

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 96/195 (49%), Gaps = 10/195 (5%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L  ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  519  PPSSPLKKQELENLRCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  578

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+     +  V    S  + +    +   ++ ES+G  T     
Sbjct  579  AEALISLDRISDAITHLNP--ENVTDVSLGISSNEQDQGSDKGENEAMESSGKQTPQCYP  636

Query  609  QGFVFLKPEEARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAILTAIYVD  439
                      AR ++  NL +   ++ + D+A      AA++I P+    +AIL A+Y++
Sbjct  637  SSVT-----SARTMMLFNLGSAYCLRSEYDKARKCLHQAASLIHPKEIPPEAILLAVYLE  691

Query  438  LLQGKTKEAVAKLRK  394
            L  G T  A+  +++
Sbjct  692  LQNGNTHLALQIIKR  706



>ref|XP_004676406.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Condylura cristata]
Length=742

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQIIKR  704



>ref|XP_007946833.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X4 [Orycteropus afer afer]
Length=643

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  417  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  476

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  477  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  524

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  525  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  582

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  583  LLAVYLELQNGNTQLALQIIKR  604



>ref|XP_006159029.1| PREDICTED: CCR4-NOT transcription complex subunit 10-like isoform 
X4 [Tupaia chinensis]
Length=744

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 98/202 (49%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV         D     G +  M ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDVSLGISSNEQDQGSDKGENEAM-ES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVTSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_006200674.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X3 [Vicugna pacos]
Length=742

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQIIKR  704



>ref|XP_004676405.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Condylura cristata]
Length=743

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_004419519.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
2 [Ceratotherium simum simum]
Length=743

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_004409038.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
2 [Odobenus rosmarus divergens]
Length=743

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  518  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  577

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  578  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  625

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  626  SG--KRAPQCYPSSVTSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  683

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  684  LLAVYLELQNGNTQLALQIIKR  705



>ref|XP_010957959.1| PREDICTED: CCR4-NOT transcription complex subunit 10 isoform 
X2 [Camelus bactrianus]
Length=742

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 100/202 (50%), Gaps = 24/202 (12%)
 Frame = -1

Query  969  PDYEDICRKENQMLEQALLADLAYVELELGDPLRALSTARSLLKLIECSKIYTFLGNVYA  790
            P    + ++E + L+ ++LA  AYV L LGD L AL+ A  LL+  + S    FLG++YA
Sbjct  517  PPSSPLRKQELENLKCSILACSAYVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYA  576

Query  789  AEALCLLSRPKEAAEHLSMYLSEIKGVEQPFSQEDVEAWRVEKVVDSEESNGGSTTMNES  610
            AEAL  L R  +A  HL+           P +  DV +  +      + S+ G     ES
Sbjct  577  AEALISLDRISDAITHLN-----------PENVTDV-SLGISSNEQDQGSDKGENEAMES  624

Query  609  QGFVFLKPE-------EARGILFTNLAAMSAVQGDLDQahayalaaaAII-PRST--KAI  460
             G     P+        AR ++  NL +   ++ + D+A      AA++I P+    +AI
Sbjct  625  SG--KRAPQCYPSSVSSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPKEVPPEAI  682

Query  459  LTAIYVDLLQGKTKEAVAKLRK  394
            L A+Y++L  G T+ A+  +++
Sbjct  683  LLAVYLELQNGNTQLALQIIKR  704



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2380164130925