BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig7029

Length=923
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011079115.1|  PREDICTED: phosphoserine aminotransferase 2,...    360   1e-118   Sesamum indicum [beniseed]
ref|XP_006340827.1|  PREDICTED: phosphoserine aminotransferase, c...    359   3e-118   Solanum tuberosum [potatoes]
ref|XP_004232556.1|  PREDICTED: phosphoserine aminotransferase 2,...    358   6e-118   Solanum lycopersicum
ref|XP_011100168.1|  PREDICTED: phosphoserine aminotransferase 2,...    352   1e-116   
ref|XP_010266695.1|  PREDICTED: phosphoserine aminotransferase 1,...    353   6e-116   
gb|EYU30826.1|  hypothetical protein MIMGU_mgv1a006850mg                353   7e-116   Erythranthe guttata [common monkey flower]
ref|XP_003635671.2|  PREDICTED: phosphoserine aminotransferase 2,...    351   3e-115   Vitis vinifera
ref|XP_003520028.1|  PREDICTED: phosphoserine aminotransferase, c...    351   3e-115   Glycine max [soybeans]
ref|XP_003635669.1|  PREDICTED: phosphoserine aminotransferase 2,...    351   4e-115   Vitis vinifera
ref|XP_003537679.1|  PREDICTED: phosphoserine aminotransferase, c...    350   5e-115   Glycine max [soybeans]
gb|KHN00422.1|  Phosphoserine aminotransferase, chloroplastic           342   5e-115   Glycine soja [wild soybean]
ref|XP_004509428.1|  PREDICTED: phosphoserine aminotransferase, c...    350   9e-115   Cicer arietinum [garbanzo]
ref|XP_009792779.1|  PREDICTED: phosphoserine aminotransferase 2,...    349   3e-114   Nicotiana sylvestris
ref|XP_009603772.1|  PREDICTED: phosphoserine aminotransferase 2,...    349   3e-114   Nicotiana tomentosiformis
gb|KHN41833.1|  Phosphoserine aminotransferase, chloroplastic           340   4e-114   Glycine soja [wild soybean]
gb|KHN35969.1|  Phosphoserine aminotransferase, chloroplastic           340   4e-114   Glycine soja [wild soybean]
ref|XP_012065373.1|  PREDICTED: phosphoserine aminotransferase 1,...    348   5e-114   Jatropha curcas
ref|XP_003517140.1|  PREDICTED: phosphoserine aminotransferase, c...    347   6e-114   Glycine max [soybeans]
gb|KJB10382.1|  hypothetical protein B456_001G198400                    347   9e-114   Gossypium raimondii
emb|CDP01807.1|  unnamed protein product                                346   3e-113   Coffea canephora [robusta coffee]
ref|XP_010531005.1|  PREDICTED: phosphoserine aminotransferase 1,...    346   3e-113   Tarenaya hassleriana [spider flower]
ref|XP_009112441.1|  PREDICTED: phosphoserine aminotransferase 1,...    346   3e-113   Brassica rapa
ref|XP_007157987.1|  hypothetical protein PHAVU_002G115000g             345   4e-113   Phaseolus vulgaris [French bean]
ref|XP_004512250.1|  PREDICTED: phosphoserine aminotransferase, c...    345   5e-113   Cicer arietinum [garbanzo]
ref|XP_008392518.1|  PREDICTED: phosphoserine aminotransferase, c...    346   5e-113   
emb|CDY30356.1|  BnaA09g09210D                                          345   6e-113   Brassica napus [oilseed rape]
ref|XP_009344666.1|  PREDICTED: phosphoserine aminotransferase 1,...    345   6e-113   Pyrus x bretschneideri [bai li]
gb|ACU18241.1|  unknown                                                 337   7e-113   Glycine max [soybeans]
ref|XP_008337931.1|  PREDICTED: phosphoserine aminotransferase, c...    345   9e-113   
ref|XP_011461731.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoserin...    345   9e-113   Fragaria vesca subsp. vesca
ref|NP_195288.1|  phosphoserine aminotransferase                        345   9e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91543.1|  phosphoserine aminotransferase                          345   9e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514779.1|  PREDICTED: phosphoserine aminotransferase 2,...    344   1e-112   Camelina sativa [gold-of-pleasure]
gb|KFK40140.1|  hypothetical protein AALP_AA3G335800                    344   2e-112   Arabis alpina [alpine rockcress]
ref|XP_009337103.1|  PREDICTED: phosphoserine aminotransferase 1,...    344   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_009350725.1|  PREDICTED: phosphoserine aminotransferase 1,...    344   3e-112   Pyrus x bretschneideri [bai li]
gb|AGF95094.1|  phosphoserine aminotransferase                          344   3e-112   Prunus persica
ref|XP_007202079.1|  hypothetical protein PRUPE_ppa006013mg             343   3e-112   Prunus persica
ref|XP_007046529.1|  Pyridoxal phosphate (PLP)-dependent transfer...    343   4e-112   
ref|NP_179354.1|  pyridoxal phosphate-dependent transferases supe...    343   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548226.1|  PREDICTED: phosphoserine aminotransferase 1,...    343   4e-112   Tarenaya hassleriana [spider flower]
ref|XP_010432252.1|  PREDICTED: phosphoserine aminotransferase 1,...    343   5e-112   Camelina sativa [gold-of-pleasure]
sp|P52877.1|SERC_SPIOL  RecName: Full=Phosphoserine aminotransfer...    343   5e-112   Spinacia oleracea
gb|AAM64881.1|  phosphoserine aminotransferase                          343   5e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022144.1|  PREDICTED: phosphoserine aminotransferase 2,...    343   6e-112   Populus euphratica
ref|XP_002307204.2|  hypothetical protein POPTR_0005s10290g             343   6e-112   Populus trichocarpa [western balsam poplar]
ref|XP_010446900.1|  PREDICTED: phosphoserine aminotransferase 1,...    343   6e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010437444.1|  PREDICTED: phosphoserine aminotransferase 1,...    342   1e-111   Camelina sativa [gold-of-pleasure]
emb|CDY24817.1|  BnaA08g14930D                                          342   2e-111   Brassica napus [oilseed rape]
ref|XP_002869075.1|  phosphoserine aminotransferase                     342   2e-111   
ref|XP_010467540.1|  PREDICTED: phosphoserine aminotransferase 2,...    342   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_008241967.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoserin...    342   2e-111   Prunus mume [ume]
emb|CDY26817.1|  BnaC09g09440D                                          341   2e-111   Brassica napus [oilseed rape]
ref|XP_010113250.1|  Phosphoserine aminotransferase                     341   3e-111   Morus notabilis
ref|XP_009109285.1|  PREDICTED: phosphoserine aminotransferase 1,...    341   3e-111   Brassica rapa
dbj|BAF00851.1|  putative phosphoserine aminotransferase                341   3e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30206.1|  hypothetical protein AALP_AA7G231900                    340   7e-111   Arabis alpina [alpine rockcress]
ref|XP_002884072.1|  hypothetical protein ARALYDRAFT_900110             340   9e-111   Arabidopsis lyrata subsp. lyrata
emb|CDY41644.1|  BnaC03g62400D                                          340   1e-110   Brassica napus [oilseed rape]
ref|XP_006299001.1|  hypothetical protein CARUB_v10015128mg             339   2e-110   Capsella rubella
ref|XP_006412081.1|  hypothetical protein EUTSA_v10025259mg             339   2e-110   
ref|XP_006285246.1|  hypothetical protein CARUB_v10006606mg             339   2e-110   Capsella rubella
ref|XP_006409274.1|  hypothetical protein EUTSA_v10023021mg             337   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_008448492.1|  PREDICTED: phosphoserine aminotransferase, c...    336   4e-109   Cucumis melo [Oriental melon]
ref|XP_003629163.1|  Phosphoserine aminotransferase                     336   4e-109   Medicago truncatula
dbj|BAH20335.1|  AT4G35630                                              326   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679952.1|  PREDICTED: phosphoserine aminotransferase, c...    334   2e-108   Beta vulgaris subsp. vulgaris [field beet]
emb|CCC55428.1|  phosphoserine aminotransferase                         334   3e-108   Pinus pinaster [cluster pine]
ref|XP_007156227.1|  hypothetical protein PHAVU_003G269100g             333   3e-108   Phaseolus vulgaris [French bean]
gb|EPS60264.1|  hypothetical protein M569_14539                         330   6e-108   Genlisea aurea
ref|XP_004146170.1|  PREDICTED: phosphoserine aminotransferase 2,...    332   8e-108   Cucumis sativus [cucumbers]
ref|XP_006467066.1|  PREDICTED: phosphoserine aminotransferase, c...    332   1e-107   Citrus sinensis [apfelsine]
gb|KDO71443.1|  hypothetical protein CISIN_1g043610mg                   332   2e-107   Citrus sinensis [apfelsine]
ref|XP_006425303.1|  hypothetical protein CICLE_v10025659mg             332   2e-107   Citrus clementina [clementine]
ref|XP_002521703.1|  phosphoserine aminotransferase, putative           331   3e-107   Ricinus communis
gb|ABR18366.1|  unknown                                                 330   5e-107   Picea sitchensis
ref|XP_006837940.1|  PREDICTED: phosphoserine aminotransferase 1,...    329   2e-106   Amborella trichopoda
ref|XP_009395663.1|  PREDICTED: phosphoserine aminotransferase 2,...    326   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396475.1|  PREDICTED: phosphoserine aminotransferase 1,...    325   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932656.1|  PREDICTED: phosphoserine aminotransferase 2,...    320   7e-103   Elaeis guineensis
gb|EAY88614.1|  hypothetical protein OsI_10089                          319   1e-102   Oryza sativa Indica Group [Indian rice]
gb|AAM51827.1|AC105730_1  Putative phosphoserine aminotransferase       318   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651057.1|  PREDICTED: phosphoserine aminotransferase, c...    317   2e-102   Oryza brachyantha
ref|XP_002991216.1|  hypothetical protein SELMODRAFT_133092             318   3e-102   
ref|XP_003558775.1|  PREDICTED: phosphoserine aminotransferase 1,...    316   2e-101   Brachypodium distachyon [annual false brome]
gb|ACF84724.1|  unknown                                                 315   6e-101   Zea mays [maize]
ref|XP_010029593.1|  PREDICTED: phosphoserine aminotransferase 1,...    313   2e-100   Eucalyptus grandis [rose gum]
ref|NP_001151184.1|  phosphoserine aminotransferase 1                   313   3e-100   
ref|XP_008807623.1|  PREDICTED: phosphoserine aminotransferase, c...    313   4e-100   Phoenix dactylifera
ref|XP_008807622.1|  PREDICTED: phosphoserine aminotransferase, c...    310   3e-99    
ref|XP_007202933.1|  hypothetical protein PRUPE_ppa016741mg             301   1e-98    
ref|XP_001765721.1|  predicted protein                                  307   6e-98    
gb|EMT13315.1|  Phosphoserine aminotransferase, chloroplastic           310   3e-94    
ref|XP_002950741.1|  hypothetical protein VOLCADRAFT_81234              275   1e-85    Volvox carteri f. nagariensis
ref|WP_013030193.1|  MFS transporter                                    271   6e-85    Sideroxydans lithotrophicus
ref|XP_001690427.1|  phosphoserine aminotransferase                     270   1e-83    Chlamydomonas reinhardtii
ref|WP_028500150.1|  MFS transporter                                    268   2e-83    Microvirgula
ref|XP_005849811.1|  hypothetical protein CHLNCDRAFT_142929             269   2e-83    Chlorella variabilis
ref|WP_035056842.1|  MFS transporter                                    265   3e-82    Andreprevotia chitinilytica
ref|WP_028446459.1|  MFS transporter                                    261   6e-81    Chitinimonas koreensis
ref|XP_011401170.1|  Phosphoserine aminotransferase, chloroplastic      261   1e-80    Auxenochlorella protothecoides
ref|WP_035384361.1|  MFS transporter                                    260   1e-80    Ferriphaselus sp. R-1
ref|WP_025869594.1|  MFS transporter                                    258   6e-80    Methylobacillus glycogenes
gb|KDD77082.1|  class-V aminotransferase                                258   1e-79    Helicosporidium sp. ATCC 50920
ref|WP_028990081.1|  MFS transporter                                    258   1e-79    Thermithiobacillus tepidarius
ref|WP_013293105.1|  MFS transporter                                    257   2e-79    Gallionella capsiferriformans
ref|WP_028461331.1|  MFS transporter                                    256   5e-79    Nitrosomonas cryotolerans
ref|WP_012638103.1|  MFS transporter                                    255   1e-78    Thioalkalivibrio sulfidiphilus
ref|XP_005646896.1|  phosphoserine aminotransferase                     256   3e-78    Coccomyxa subellipsoidea C-169
ref|WP_007191128.1|  MFS transporter                                    254   3e-78    Thiocapsa marina
ref|WP_018954052.1|  MFS transporter                                    253   6e-78    Thioalkalivibrio sulfidiphilus
ref|WP_027823401.1|  MFS transporter                                    252   2e-77    Laribacter hongkongensis
gb|ABE49955.1|  phosphoserine aminotransferase apoenzyme                251   3e-77    Methylobacillus flagellatus KT
dbj|GAO33827.1|  phosphoserine aminotransferase                         251   4e-77    
ref|WP_012697309.1|  phosphoserine aminotransferase                     251   4e-77    Laribacter hongkongensis
ref|WP_011381489.1|  MFS transporter                                    250   9e-77    Nitrosospira multiformis
ref|WP_028450922.1|  MFS transporter                                    250   1e-76    Chitinibacter tainanensis
ref|WP_025041175.1|  MFS transporter                                    250   1e-76    Nitrosospira briensis
ref|WP_013966810.1|  MFS transporter                                    250   1e-76    Nitrosomonas sp. Is79A3
dbj|GAO36051.1|  MFS transporter                                        249   2e-76    Sulfuricella sp. T08
ref|WP_002706803.1|  MFS transporter                                    249   2e-76    
ref|WP_041102150.1|  MFS transporter                                    249   2e-76    Sulfuritalea hydrogenivorans
dbj|BAO29785.1|  phosphoserine aminotransferase                         249   2e-76    Sulfuritalea hydrogenivorans sk43H
ref|WP_018747599.1|  hypothetical protein                               248   4e-76    Chitiniphilus shinanonensis
ref|WP_043109315.1|  hypothetical protein                               248   4e-76    endosymbiont of unidentified scaly snail isolate Monju
ref|WP_005220268.1|  MFS transporter                                    248   1e-75    Marichromatium purpuratum
ref|WP_018231476.1|  MFS transporter                                    248   1e-75    Thioalkalivibrio thiocyanodenitrificans
ref|WP_022654508.1|  MFS transporter                                    247   1e-75    Aquaspirillum serpens
ref|WP_013261107.1|  MFS transporter                                    246   3e-75    gamma proteobacterium HdN1
ref|XP_002499911.1|  predicted protein                                  248   3e-75    Micromonas commoda
ref|WP_009206184.1|  MFS transporter                                    246   5e-75    Sulfuricella denitrificans
ref|WP_028452427.1|  MFS transporter                                    246   5e-75    Chitinilyticum aquatile
ref|WP_020395885.1|  hypothetical protein                               245   8e-75    Thiolinea disciformis
ref|WP_011110968.1|  phosphoserine aminotransferase                     244   2e-74    Nitrosomonas europaea
ref|WP_028455614.1|  MFS transporter                                    244   3e-74    Chitinilyticum litopenaei
ref|WP_004179773.1|  Phosphoserine aminotransferase                     244   4e-74    Nitrosospira lacus
ref|WP_028311002.1|  MFS transporter                                    243   5e-74    Derxia gummosa
gb|AJP48508.1|  MFS transporter                                         243   8e-74    Rugosibacter aromaticivorans
ref|WP_012824206.1|  MFS transporter                                    243   9e-74    Halothiobacillus neapolitanus
ref|WP_028488900.1|  MFS transporter                                    242   1e-73    Thiothrix lacustris
ref|WP_013647094.1|  MFS transporter                                    242   2e-73    Nitrosomonas sp. AL212
ref|WP_012971183.1|  MFS transporter                                    242   2e-73    Allochromatium vinosum
ref|WP_041512774.1|  MFS transporter                                    242   2e-73    Nitrosospira sp. NpAV
ref|XP_007510965.1|  phosphoserine aminotransferase                     244   2e-73    Bathycoccus prasinos
ref|WP_025281596.1|  MFS transporter                                    241   2e-73    Ectothiorhodospira haloalkaliphila
ref|WP_012348025.1|  MFS transporter                                    241   2e-73    Leptothrix cholodnii
ref|WP_006786484.1|  MFS transporter                                    241   2e-73    Thiorhodospira sibirica
ref|WP_041068347.1|  hypothetical protein                               241   5e-73    Thiolapillus brandeum
ref|WP_026685515.1|  MFS transporter                                    241   7e-73    Azovibrio restrictus
ref|WP_020530574.1|  hypothetical protein                               240   7e-73    Flexithrix dorotheae
ref|WP_013442376.1|  MULTISPECIES: MFS transporter                      239   2e-72    Methylovorus
emb|CEF97174.1|  Phosphoserine aminotransferase                         241   2e-72    Ostreococcus tauri
ref|WP_020508015.1|  MFS transporter                                    239   2e-72    Lamprocystis purpurea
ref|WP_018988948.1|  MFS transporter                                    239   2e-72    Azoarcus toluclasticus
ref|WP_011634622.1|  MFS transporter                                    239   2e-72    Nitrosomonas eutropha
gb|KGM06139.1|  Phosphoserine aminotransferase                          238   2e-72    Methylophaga thiooxydans
ref|WP_027469352.1|  MFS transporter                                    239   2e-72    Deefgea rivuli
ref|XP_001416687.1|  predicted protein                                  240   3e-72    Ostreococcus lucimarinus CCE9901
ref|WP_009550046.1|  MFS transporter                                    239   3e-72    Burkholderiales bacterium JOSHI_001
ref|WP_008735063.1|  MFS transporter                                    238   4e-72    Alcanivorax pacificus
ref|WP_043755222.1|  MFS transporter                                    238   4e-72    Imhoffiella purpurea
ref|WP_036314771.1|  MFS transporter                                    238   4e-72    
ref|WP_028491619.1|  MFS transporter                                    238   5e-72    Thioalkalivibrio sp. ALE19
ref|WP_008292142.1|  MFS transporter                                    238   5e-72    
ref|WP_018935525.1|  MFS transporter                                    238   5e-72    Thioalkalivibrio sp. ALJ24
ref|WP_026353180.1|  MFS transporter                                    238   6e-72    Solimonas variicoloris
ref|WP_019569986.1|  MFS transporter                                    238   6e-72    Thioalkalivibrio sp. ALE11
ref|WP_028782461.1|  MFS transporter                                    238   6e-72    Thalassobacillus devorans
ref|WP_019591413.1|  MFS transporter                                    238   7e-72    Thioalkalivibrio sp. ALE20
ref|WP_028006389.1|  MFS transporter                                    238   8e-72    Solimonas flava
ref|WP_019642831.1|  MFS transporter                                    237   1e-71    Thioalkalivibrio sp. ALSr1
emb|CDH59803.1|  phosphoserine aminotransferase                         238   1e-71    Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_015437146.1|  phosphoserine aminotransferase                     237   1e-71    Azoarcus sp. KH32C
ref|WP_017508295.1|  MFS transporter                                    237   1e-71    beta proteobacterium L13
ref|WP_014995313.1|  MFS transporter                                    237   2e-71    Alcanivorax dieselolei
ref|WP_018076565.1|  MFS transporter                                    236   2e-71    Thiobacillus denitrificans
ref|WP_024328884.1|  MFS transporter                                    236   2e-71    Thioalkalivibrio sp. ALR17-21
ref|WP_019589998.1|  MULTISPECIES: MFS transporter                      236   2e-71    Thioalkalivibrio
ref|WP_019022084.1|  MFS transporter                                    236   2e-71    Thioalkalivibrio sp. ALE23
ref|WP_046113537.1|  MFS transporter                                    236   2e-71    Aquincola tertiaricarbonis
ref|WP_018869444.1|  MFS transporter                                    236   3e-71    Thioalkalivibrio sp. ALgr3
ref|WP_018945974.1|  MFS transporter                                    236   3e-71    Thioalkalivibrio
ref|WP_028251166.1|  MFS transporter                                    236   3e-71    Variovorax sp. URHB0020
ref|WP_022368594.1|  phosphoserine aminotransferase                     236   3e-71    
ref|WP_014778523.1|  MFS transporter                                    236   3e-71    Thiocystis violascens
ref|WP_034286665.1|  MFS transporter                                    236   3e-71    Bacillus sp. 72
ref|WP_006778838.1|  MFS transporter [                                  236   4e-71    Hungatella hathewayi
ref|WP_011713086.1|  MFS transporter                                    236   4e-71    Magnetococcus marinus
gb|AFJ01312.1|  Phosphoserine aminotransferase                          235   5e-71    Methylophaga frappieri
ref|WP_015464490.1|  3-phosphoserine/phosphohydroxythreonine amin...    236   5e-71    Psychromonas sp. CNPT3
ref|WP_022500227.1|  phosphoserine aminotransferase                     236   6e-71    
emb|CDS08854.1|  hypothetical protein LRAMOSA10215                      236   6e-71    Lichtheimia ramosa
ref|WP_041366312.1|  MFS transporter                                    235   6e-71    Methylophaga frappieri
ref|WP_038248091.1|  MFS transporter                                    235   6e-71    Ghiorsea bivora
gb|EEG32017.1|  phosphoserine transaminase [ [                          234   7e-71    [Clostridium] methylpentosum DSM 5476
gb|EHL77690.1|  phosphoserine aminotransferase                          235   8e-71    Bacillus smithii 7_3_47FAA
ref|WP_020561164.1|  hypothetical protein                               235   8e-71    Thiofilum flexile
ref|WP_043116984.1|  hypothetical protein                               235   8e-71    Solemya velum gill symbiont
ref|WP_040341449.1|  MFS transporter                                    235   8e-71    
ref|WP_022255595.1|  phosphoserine aminotransferase                     235   9e-71    
ref|WP_018282158.1|  MFS transporter                                    234   1e-70    
ref|WP_016287510.1|  phosphoserine transaminase                         234   1e-70    Lachnospiraceae bacterium 3-1
ref|WP_040437276.1|  MFS transporter [                                  234   1e-70    [Clostridium] methylpentosum
ref|WP_018507777.1|  MFS transporter                                    234   1e-70    Thiobacillus thioparus
gb|KIL76405.1|  Phosphoserine aminotransferase                          234   1e-70    Bacillus badius
ref|WP_018394690.1|  hypothetical protein                               234   1e-70    Bacillaceae
ref|WP_023415104.1|  MFS transporter                                    235   1e-70    
ref|WP_025562444.1|  3-phosphoserine/phosphohydroxythreonine amin...    234   1e-70    Psychromonas sp. SP041
ref|WP_038281274.1|  MFS transporter [                                  234   2e-70    [Clostridium] celerecrescens
ref|WP_007779651.1|  MFS transporter                                    234   2e-70    Desulfosporosinus youngiae
ref|WP_023354504.1|  phosphoserine transaminase                         234   2e-70    Catonella morbi
ref|WP_017471249.1|  MFS transporter                                    234   2e-70    Amphibacillus jilinensis
ref|WP_019005008.1|  MFS transporter                                    234   2e-70    Cohnella laeviribosi
ref|WP_029132418.1|  hypothetical protein                               234   2e-70    Sedimenticola selenatireducens
ref|WP_041095180.1|  MFS transporter                                    234   2e-70    Bacillus badius
ref|WP_004871798.1|  MFS transporter                                    234   2e-70    Acidithiobacillus caldus
ref|WP_009151577.1|  MFS transporter                                    234   3e-70    Thiorhodovibrio sp. 970
ref|WP_022351754.1|  phosphoserine aminotransferase                     233   3e-70    
ref|WP_022959738.1|  MFS transporter                                    233   3e-70    Spongiibacter tropicus
ref|XP_003055243.1|  predicted protein                                  233   3e-70    Micromonas pusilla CCMP1545
ref|WP_045476811.1|  MFS transporter                                    233   3e-70    Thioploca ingrica
ref|WP_010077007.1|  MFS transporter                                    233   3e-70    Clostridium cellulovorans
ref|XP_004364238.1|  phosphoserine aminotransferase                     233   4e-70    Capsaspora owczarzaki ATCC 30864
ref|WP_044326394.1|  MFS transporter                                    233   4e-70    
ref|WP_035724442.1|  MFS transporter                                    233   5e-70    Gracilibacillus boraciitolerans
ref|WP_019530440.1|  MFS transporter                                    233   5e-70    Dasania marina
ref|WP_027855112.1|  MFS transporter                                    233   5e-70    Marinobacterium litorale
ref|WP_008929886.1|  MFS transporter                                    233   5e-70    Alcanivorax hongdengensis
ref|WP_007861360.1|  MULTISPECIES: MFS transporter                      233   6e-70    Clostridiales
ref|WP_011769516.1|  3-phosphoserine/phosphohydroxythreonine amin...    233   6e-70    Psychromonas ingrahamii
ref|WP_010649862.1|  MFS transporter                                    233   6e-70    Oceanobacillus massiliensis
ref|WP_014707279.1|  MFS transporter                                    233   6e-70    Methylophaga nitratireducenticrescens
ref|WP_016214688.1|  phosphoserine transaminase                         233   6e-70    Eubacterium sp. 14-2
ref|WP_029503297.1|  MFS transporter                                    233   7e-70    Lachnoclostridium phytofermentans
ref|WP_016305645.1|  phosphoserine transaminase                         232   8e-70    Lachnospiraceae bacterium A2
ref|WP_011311461.1|  phosphoserine aminotransferase                     232   9e-70    Thiobacillus denitrificans
ref|WP_019622496.1|  MFS transporter                                    232   9e-70    Amphritea japonica
ref|WP_002585968.1|  MULTISPECIES: MFS transporter                      232   1e-69    [Clostridium] clostridioforme
ref|WP_028535641.1|  MFS transporter                                    232   1e-69    Paludibacterium yongneupense
ref|WP_022201980.1|  phosphoserine aminotransferase 1                   232   1e-69    Clostridiales
ref|WP_010638091.1|  MFS transporter                                    232   1e-69    Acidithiobacillus thiooxidans
ref|WP_019616297.1|  3-phosphoserine/phosphohydroxythreonine amin...    232   1e-69    Psychromonas ossibalaenae
ref|WP_033166073.1|  MFS transporter                                    232   2e-69    Clostridium sp. KNHs205
ref|WP_012474969.1|  MFS transporter                                    231   2e-69    Chlorobium phaeobacteroides
ref|WP_028863377.1|  3-phosphoserine/phosphohydroxythreonine amin...    232   2e-69    Psychromonas aquimarina
ref|WP_021871269.1|  phosphoserine aminotransferase 1                   230   2e-69    
ref|WP_021849773.1|  phosphoserine aminotransferase                     231   2e-69    
ref|WP_015358223.1|  MULTISPECIES: phosphoserine aminotransferase...    231   2e-69    Thermoclostridium stercorarium
ref|WP_026743459.1|  3-phosphoserine/phosphohydroxythreonine amin...    231   2e-69    Lonsdalea quercina
ref|WP_018718595.1|  MFS transporter                                    231   2e-69    Arhodomonas aquaeolei
ref|WP_027872807.1|  MFS transporter                                    231   3e-69    Spongiibacter marinus
ref|WP_019611742.1|  MFS transporter                                    231   3e-69    Thioalkalivibrio sp. AKL7
ref|WP_016281002.1|  phosphoserine transaminase                         231   3e-69    Lachnospiraceae bacterium A4
ref|WP_016389688.1|  MULTISPECIES: 3-phosphoserine/phosphohydroxy...    231   3e-69    Cycloclasticus
ref|WP_007038767.1|  MFS transporter                                    231   3e-69    Thiorhodococcus drewsii
ref|WP_004227251.1|  MFS transporter                                    231   3e-69    Lysinibacillus fusiformis
ref|WP_034836948.1|  MFS transporter [                                  231   4e-69    [Clostridium] cellulosi
ref|WP_018145712.1|  MFS transporter                                    231   4e-69    Thioalkalivibrio sp. AKL6
ref|WP_034432189.1|  MFS transporter                                    231   4e-69    
ref|WP_020932847.1|  Phosphoserine aminotransferase                     230   5e-69    Cycloclasticus zancles
ref|WP_015005493.1|  MFS transporter                                    230   5e-69    Cycloclasticus sp. P1
ref|WP_026340670.1|  MFS transporter                                    230   5e-69    Thioalkalivibrio sp. ALJT
ref|WP_011628673.1|  MFS transporter                                    230   5e-69    Alkalilimnicola ehrlichii
ref|WP_028234887.1|  MFS transporter                                    230   5e-69    Pseudobutyrivibrio sp. MD2005
ref|WP_022996437.1|  MFS transporter                                    230   5e-69    Alcanivorax sp. PN-3
ref|WP_026949179.1|  MFS transporter                                    230   6e-69    Alcanivorax
ref|WP_013274242.1|  MFS transporter [                                  230   6e-69    [Clostridium] saccharolyticum
ref|WP_041703761.1|  MFS transporter                                    230   6e-69    Lachnoclostridium phytofermentans
ref|WP_031568449.1|  MFS transporter                                    230   7e-69    Acidithiobacillus thiooxidans
ref|WP_019141741.1|  MFS transporter                                    230   7e-69    Noviherbaspirillum massiliense
ref|WP_017364281.1|  MFS transporter                                    230   7e-69    Methylococcus capsulatus
ref|WP_025485743.1|  MULTISPECIES: MFS transporter                      230   8e-69    unclassified Clostridiales (miscellaneous)
ref|WP_039028170.1|  MFS transporter                                    226   8e-69    
gb|EHM93445.1|  phosphoserine transaminase                              225   8e-69    Coprobacillus sp. 3_3_56FAA
ref|WP_025231393.1|  MFS transporter                                    230   8e-69    Clostridiales
ref|WP_028248118.1|  MFS transporter                                    229   8e-69    Pseudobutyrivibrio
ref|WP_022517660.1|  phosphoserine aminotransferase                     229   9e-69    
ref|WP_039657461.1|  MFS transporter                                    229   9e-69    Clostridium tyrobutyricum
ref|WP_022986136.1|  MFS transporter                                    229   9e-69    Alcanivorax
ref|WP_022261976.1|  phosphoserine aminotransferase                     229   9e-69    
ref|WP_021109479.1|  phosphoserine transaminase                         229   9e-69    
ref|WP_011236344.1|  phosphoserine aminotransferase                     230   1e-68    
gb|AHM74731.1|  Phosphohydroxythreonine aminotransferase                229   1e-68    
ref|WP_010960696.1|  MFS transporter                                    229   1e-68    
ref|WP_002604619.1|  phosphoserine transaminase [                       229   1e-68    
ref|WP_033850969.1|  3-phosphoserine/phosphohydroxythreonine amin...    229   1e-68    
ref|WP_026740444.1|  3-phosphoserine/phosphohydroxythreonine amin...    229   1e-68    
ref|WP_024327382.1|  MFS transporter                                    229   1e-68    
ref|WP_005004610.1|  MFS transporter                                    229   1e-68    
ref|WP_019851412.1|  MFS transporter                                    229   1e-68    
ref|WP_022123634.1|  phosphoserine aminotransferase                     229   1e-68    
ref|WP_022947853.1|  MFS transporter                                    229   1e-68    
ref|WP_022359874.1|  phosphoserine aminotransferase                     229   1e-68    
ref|WP_018931854.1|  MFS transporter                                    229   1e-68    
ref|WP_024892756.1|  MFS transporter                                    229   1e-68    
ref|WP_022188418.1|  phosphoserine aminotransferase                     229   1e-68    
ref|WP_042819262.1|  3-phosphoserine/phosphohydroxythreonine amin...    229   1e-68    
ref|WP_022056932.1|  phosphoserine aminotransferase                     229   1e-68    
gb|ABX43736.1|  phosphoserine aminotransferase                          230   1e-68    
ref|WP_029920571.1|  MFS transporter                                    229   1e-68    
ref|WP_014901837.1|  MFS transporter                                    229   1e-68    
ref|WP_003463396.1|  3-phosphoserine/phosphohydroxythreonine amin...    229   1e-68    
ref|WP_028243053.1|  MFS transporter                                    229   1e-68    
gb|EGL55000.1|  phosphoserine aminotransferase                          229   1e-68    
gb|EEQ58353.1|  phosphoserine transaminase                              229   1e-68    
ref|WP_045751015.1|  MFS transporter                                    229   2e-68    
ref|WP_043815906.1|  MFS transporter                                    229   2e-68    
ref|WP_014623831.1|  MFS transporter                                    229   2e-68    
ref|WP_016169479.1|  phosphoserine transaminase                         229   2e-68    
ref|WP_024302743.1|  MFS transporter                                    229   2e-68    
ref|WP_014079411.1|  MFS transporter                                    229   2e-68    
ref|WP_035246544.1|  MFS transporter                                    229   2e-68    
ref|WP_028079033.1|  MFS transporter                                    229   2e-68    
ref|WP_014795671.1|  MFS transporter                                    229   2e-68    
ref|WP_007064055.1|  MFS transporter                                    229   2e-68    
ref|WP_018949528.1|  MFS transporter                                    229   2e-68    
ref|WP_015390260.1|  phosphoserine aminotransferase SerC                229   2e-68    
ref|WP_026609131.1|  MFS transporter                                    229   2e-68    
ref|WP_022153863.1|  phosphoserine aminotransferase                     229   2e-68    
ref|WP_016290567.1|  phosphoserine transaminase                         229   2e-68    
ref|WP_024739428.1|  MFS transporter [                                  229   2e-68    
ref|WP_022360972.1|  phosphoserine aminotransferase                     229   2e-68    
ref|WP_011286996.1|  MFS transporter                                    229   2e-68    
ref|WP_040576199.1|  MFS transporter                                    228   2e-68    
ref|WP_024348269.1|  MFS transporter [                                  228   3e-68    
ref|WP_024291830.1|  MULTISPECIES: MFS transporter                      228   3e-68    
ref|WP_018937605.1|  MULTISPECIES: MFS transporter                      228   3e-68    
ref|WP_032078681.1|  MFS transporter                                    228   3e-68    
ref|WP_040893225.1|  MFS transporter [                                  228   3e-68    
ref|WP_014829340.1|  MFS transporter                                    228   3e-68    
gb|EGA93410.1|  phosphoserine aminotransferase [ [                      229   3e-68    
gb|EDN69344.1|  Phosphoserine aminotransferase                          224   3e-68    
ref|WP_014183391.1|  MFS transporter                                    228   3e-68    
gb|EQA04428.1|  phosphoserine aminotransferase                          228   3e-68    
ref|WP_018169753.1|  MULTISPECIES: MFS transporter                      228   3e-68    
ref|WP_009167739.1|  MFS transporter                                    228   3e-68    
ref|WP_009296942.1|  MFS transporter                                    228   3e-68    
ref|WP_021984315.1|  phosphoserine aminotransferase                     228   3e-68    
ref|WP_028869749.1|  3-phosphoserine/phosphohydroxythreonine amin...    228   3e-68    
ref|WP_035309337.1|  MFS transporter                                    228   3e-68    
ref|WP_024732787.1|  MFS transporter                                    228   3e-68    
gb|EEC57842.1|  phosphoserine transaminase [                            229   3e-68    
ref|WP_034598325.1|  MFS transporter                                    228   3e-68    
emb|CBK75787.1|  phosphoserine aminotransferase                         228   3e-68    
ref|WP_041087134.1|  MFS transporter                                    228   3e-68    
ref|WP_019593124.1|  MFS transporter                                    228   3e-68    
ref|WP_014427394.1|  MFS transporter                                    228   4e-68    
ref|WP_019567834.1|  MFS transporter                                    228   4e-68    
ref|WP_031560817.1|  MFS transporter                                    228   4e-68    
ref|WP_045792819.1|  MFS transporter                                    228   4e-68    
ref|WP_044972422.1|  MFS transporter                                    228   4e-68    
ref|WP_027092758.1|  MFS transporter                                    228   4e-68    
ref|WP_022270361.1|  phosphoserine aminotransferase                     228   4e-68    
ref|WP_005355548.1|  MFS transporter [                                  228   4e-68    
ref|WP_025373002.1|  3-phosphoserine/phosphohydroxythreonine amin...    228   4e-68    
ref|WP_006861874.1|  MFS transporter                                    228   5e-68    
ref|WP_009620579.1|  MFS transporter                                    228   5e-68    
ref|WP_043894414.1|  MFS transporter                                    228   5e-68    
ref|WP_022952723.1|  MFS transporter                                    228   5e-68    
ref|WP_031692587.1|  MFS transporter                                    228   5e-68    
ref|WP_022990019.1|  MFS transporter                                    228   5e-68    
ref|WP_021113923.1|  phosphoserine transaminase                         228   5e-68    
emb|CFQ43563.1|  phosphoserine aminotransferase                         228   5e-68    
ref|WP_026143064.1|  MULTISPECIES: MFS transporter                      228   6e-68    
ref|WP_016527986.1|  3-phosphoserine/phosphohydroxythreonine amin...    228   6e-68    
emb|CBK97079.1|  phosphoserine aminotransferase [ [                     228   6e-68    
ref|WP_039238549.1|  MFS transporter                                    228   6e-68    
pdb|3QBO|A  Chain A, Crystal Structure Of Phosphoserine Aminotran...    228   6e-68    
ref|WP_031389762.1|  MFS transporter                                    228   6e-68    
ref|WP_014855399.1|  MFS transporter                                    228   6e-68    
ref|WP_019680974.1|  MFS transporter                                    228   6e-68    
gb|AAS61447.1|  phosphoserine aminotransferase                          226   7e-68    
ref|WP_022403250.1|  phosphoserine aminotransferase                     227   7e-68    
ref|WP_035266433.1|  MFS transporter                                    227   7e-68    
ref|WP_027949034.1|  MFS transporter                                    227   7e-68    
gb|KEA43072.1|  MFS transporter                                         227   7e-68    
ref|WP_022370562.1|  phosphoserine aminotransferase                     227   7e-68    
ref|WP_017001745.1|  MFS transporter                                    227   7e-68    
ref|WP_009252362.1|  MULTISPECIES: MFS transporter                      227   8e-68    
ref|WP_033971600.1|  MFS transporter                                    227   8e-68    
ref|WP_006770649.1|  MULTISPECIES: MFS transporter                      227   8e-68    
ref|WP_036543653.1|  MFS transporter                                    227   8e-68    
ref|WP_008247141.1|  MFS transporter                                    227   8e-68    
ref|WP_025491089.1|  MFS transporter                                    227   8e-68    
ref|WP_044910826.1|  MFS transporter [                                  227   8e-68    
dbj|GAM68263.1|  phosphoserine aminotransferase                         221   9e-68    
ref|WP_031848230.1|  MFS transporter                                    222   9e-68    
ref|WP_021112236.1|  phosphoserine transaminase                         227   9e-68    
ref|WP_038905113.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   9e-68    
ref|WP_016406635.1|  phosphoserine aminotransferase                     227   9e-68    
ref|WP_012585795.1|  MFS transporter                                    227   9e-68    
ref|WP_043746612.1|  MFS transporter                                    227   1e-67    
ref|WP_029194146.1|  MFS transporter                                    227   1e-67    
ref|WP_037300710.1|  MFS transporter                                    227   1e-67    
ref|WP_024914964.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_045224309.1|  MFS transporter                                    227   1e-67    
ref|WP_026889674.1|  MFS transporter                                    227   1e-67    
ref|WP_009113220.1|  3-phosphoserine/phosphohydroxythreonine amin...    227   1e-67    
ref|WP_033153769.1|  MFS transporter                                    227   1e-67    
ref|WP_008422793.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_044933680.1|  MFS transporter                                    227   1e-67    
ref|WP_023081491.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_003111764.1|  MULTISPECIES: phosphoserine aminotransferase       227   1e-67    
ref|WP_023105130.1|  phosphoserine aminotransferase                     227   1e-67    
gb|ERL95636.1|  hypothetical protein D910_00059                         226   1e-67    
ref|WP_023120360.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_021712855.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_004299033.1|  3-phosphoserine/phosphohydroxythreonine amin...    227   1e-67    
gb|AHA16957.1|  Phosphoserine aminotransferase                          227   1e-67    
ref|WP_009857222.1|  MFS transporter                                    227   1e-67    
gb|EGB20060.1|  phosphoserine transaminase [ [                          228   1e-67    
ref|WP_034011784.1|  MFS transporter                                    227   1e-67    
gb|ACY61601.1|  phosphoserine aminotransferase                          226   1e-67    
ref|WP_023084084.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_033862947.1|  phosphoserine aminotransferase                     227   1e-67    
gb|EFQ39579.1|  3-phosphoserine aminotransferase                        227   1e-67    
gb|AEG93900.1|  Candidate phosphoserine aminotransferase                226   1e-67    
ref|WP_038617537.1|  MFS transporter                                    227   1e-67    
dbj|GAA18866.1|  3-phosphoserine aminotransferase                       227   1e-67    
ref|WP_023083662.1|  phosphoserine aminotransferase                     227   1e-67    
ref|WP_021682817.1|  phosphoserine transaminase                         227   1e-67    
ref|WP_018286709.1|  MFS transporter                                    226   1e-67    
ref|WP_015263670.1|  MFS transporter                                    226   1e-67    
ref|WP_024860846.1|  MFS transporter                                    226   1e-67    
ref|WP_029528855.1|  MFS transporter                                    226   1e-67    
ref|WP_010804348.1|  3-phosphoserine/phosphohydroxythreonine amin...    227   1e-67    
ref|WP_026892124.1|  MFS transporter [                                  226   1e-67    
ref|WP_002568086.1|  MULTISPECIES: phosphoserine transaminase           226   1e-67    
ref|WP_033978820.1|  MFS transporter                                    226   1e-67    
ref|WP_027458973.1|  MFS transporter                                    226   1e-67    
ref|WP_011462039.1|  MFS transporter                                    226   1e-67    
ref|WP_012105382.1|  phosphoserine aminotransferase                     226   1e-67    
ref|WP_026182285.1|  MFS transporter                                    226   2e-67    
ref|WP_008952720.1|  MULTISPECIES: MFS transporter                      226   2e-67    
ref|WP_008302395.1|  MFS transporter                                    226   2e-67    
ref|WP_005222827.1|  phosphoserine aminotransferase                     226   2e-67    
emb|CEI08620.1|  Phosphoserine aminotransferase                         227   2e-67    
ref|WP_027641846.1|  MFS transporter [                                  226   2e-67    
ref|WP_041623097.1|  MFS transporter                                    226   2e-67    
ref|WP_009243827.1|  MFS transporter [                                  226   2e-67    
ref|WP_012295210.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_012621683.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   2e-67    
ref|WP_009636642.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   2e-67    
ref|WP_004815057.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_022036845.1|  phosphoserine aminotransferase                     226   2e-67    
emb|CDO82563.1|  phosphoserine aminotransferase                         225   2e-67    
ref|WP_021960671.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_023104574.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_008932231.1|  MFS transporter                                    226   2e-67    
ref|WP_022514733.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_014750461.1|  MFS transporter                                    227   2e-67    
ref|WP_002211326.1|  phosphoserine aminotransferase                     226   2e-67    
gb|KFC96607.1|  phosphoserine aminotransferase                          226   2e-67    
ref|WP_024834955.1|  MFS transporter                                    226   2e-67    
ref|WP_018139263.1|  MULTISPECIES: MFS transporter                      226   2e-67    
ref|WP_034145390.1|  MFS transporter                                    226   2e-67    
ref|WP_005275109.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   2e-67    
ref|WP_012982604.1|  MULTISPECIES: MFS transporter                      226   2e-67    
ref|WP_023403180.1|  phosphoserine aminotransferase                     226   2e-67    
dbj|GAM63023.1|  phosphoserine aminotransferase                         226   2e-67    
ref|WP_040435184.1|  MFS transporter [                                  226   2e-67    
ref|WP_035493784.1|  MFS transporter                                    226   2e-67    
ref|WP_008938044.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   2e-67    
ref|WP_043310844.1|  MFS transporter                                    226   2e-67    
ref|WP_023875075.1|  MFS transporter                                    226   2e-67    
ref|WP_023123815.1|  phosphoserine aminotransferase                     226   2e-67    
ref|WP_005603328.1|  MFS transporter                                    226   2e-67    
ref|WP_004900316.1|  phosphoserine aminotransferase                     226   3e-67    
gb|EDN79076.1|  phosphoserine transaminase                              226   3e-67    
ref|WP_016303111.1|  phosphoserine transaminase                         226   3e-67    
ref|WP_038825135.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   3e-67    
ref|WP_004064044.1|  phosphoserine transaminase                         226   3e-67    
ref|WP_022936490.1|  hypothetical protein                               226   3e-67    
ref|WP_009726781.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   3e-67    
ref|WP_041675610.1|  MFS transporter                                    226   3e-67    
ref|WP_010786804.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   3e-67    
ref|WP_024063675.1|  phosphoserine aminotransferase                     226   3e-67    
ref|WP_045573719.1|  MFS transporter                                    226   3e-67    
gb|EEG83860.1|  phosphoserine transaminase                              226   3e-67    
gb|ADP97125.1|  phosphoserine aminotransferase                          225   3e-67    
ref|WP_035054407.1|  MFS transporter                                    226   3e-67    
ref|WP_036076212.1|  MFS transporter                                    226   3e-67    
gb|EEG73299.1|  phosphoserine transaminase [ [                          225   3e-67    
emb|CDI04425.1|  3-phosphoserine aminotransferase                       226   3e-67    
ref|WP_034233766.1|  MFS transporter                                    226   3e-67    
ref|WP_012884949.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   3e-67    
ref|WP_011192055.1|  phosphoserine aminotransferase                     226   3e-67    
ref|WP_014559027.1|  MFS transporter                                    226   4e-67    
ref|WP_019846571.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   4e-67    
ref|WP_027274513.1|  3-phosphoserine/phosphohydroxythreonine amin...    226   4e-67    
ref|WP_019024270.1|  MULTISPECIES: MFS transporter                      226   4e-67    
ref|WP_021914641.1|  phosphoserine aminotransferase                     225   4e-67    
ref|WP_006716977.1|  MFS transporter                                    225   4e-67    
ref|WP_012139431.1|  3-phosphoserine/phosphohydroxythreonine amin...    225   4e-67    
ref|WP_017926429.1|  MFS transporter                                    225   4e-67    
ref|WP_042546288.1|  3-phosphoserine/phosphohydroxythreonine amin...    225   4e-67    
ref|WP_023111541.1|  phosphoserine aminotransferase                     225   4e-67    
ref|WP_044009006.1|  MFS transporter                                    225   4e-67    
ref|WP_028517258.1|  MFS transporter                                    225   4e-67    
ref|WP_042870235.1|  3-phosphoserine/phosphohydroxythreonine amin...    225   4e-67    



>ref|XP_011079115.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic [Sesamum 
indicum]
Length=433

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVTKFG+IYAGAQKNVGPSGV IVIIR DLIGN+QPITP+MLDYKIH
Sbjct  241  VADMSSNFCSKPVDVTKFGVIYAGAQKNVGPSGVTIVIIRSDLIGNSQPITPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DNNSLYNTPP YGIYMCGLVF DL+AQGGL EVEKKN+KKA ILY+AID S GFYRCPV
Sbjct  301  ADNNSLYNTPPCYGIYMCGLVFRDLIAQGGLSEVEKKNVKKAGILYDAIDGSKGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  EKSVRSLMNVPFTLAKPELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKH  351
            V+FMKDF A+H
Sbjct  421  VSFMKDFQARH  431



>ref|XP_006340827.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Solanum tuberosum]
Length=437

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  246  VADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQESTPVMLDYKIH  305

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA+ILY+AIDSSNGFYRCPV
Sbjct  306  AENNSLYNTPPCYGIYMCGLVFEDLLDQGGLVEVEKKNQKKAQILYDAIDSSNGFYRCPV  365

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EF+K AA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  366  EKSVRSLMNVPFTLAKPELEAEFVKTAAGEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  425

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKHG
Sbjct  426  VAFMKEFQAKHG  437



>ref|XP_004232556.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Solanum lycopersicum]
Length=432

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  241  VADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQESTPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA+ILY+AIDSSNGFYRCPV
Sbjct  301  AENNSLYNTPPCYGIYMCGLVFEDLLDQGGLVEVEKKNQKKAQILYDAIDSSNGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRSLMNVPFTLAKPELE EF+K AA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  DKSVRSLMNVPFTLAKPELEAEFVKTAAGEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKHG
Sbjct  421  VAFMKEFQAKHG  432



>ref|XP_011100168.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like, 
partial [Sesamum indicum]
Length=362

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIR DLIGN QP+TP+MLDYKIH
Sbjct  170  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRSDLIGNAQPVTPVMLDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DNNSLYNTPP YGIYMCGLVFEDL+AQGGL +VEKKN  KA ILY+AID S GFYRCPV
Sbjct  230  ADNNSLYNTPPCYGIYMCGLVFEDLIAQGGLSDVEKKNASKAGILYDAIDGSKGFYRCPV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  290  EKSVRSLMNVPFTLAKPELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  349

Query  383  VAFMKDFMAKH  351
            VAFMKDF A H
Sbjct  350  VAFMKDFQASH  360



>ref|XP_010266695.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Nelumbo nucifera]
Length=429

 Score =   353 bits (906),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN QPITP+MLDYKIH
Sbjct  238  VADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQPITPVMLDYKIH  297

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLLAQGGL E+EKKN KKAEILY+ ID S GFYRCPV
Sbjct  298  AENNSLYNTPPCYGIYMCGLVFEDLLAQGGLVEIEKKNKKKAEILYQTIDESGGFYRCPV  357

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRSLMNVPFTL K +LE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  358  DKSVRSLMNVPFTLEKSDLEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  417

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  418  VAFMKDFQARHA  429



>gb|EYU30826.1| hypothetical protein MIMGU_mgv1a006850mg [Erythranthe guttata]
Length=429

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV I IIR DLIGN QP+TP+MLDYKIH
Sbjct  237  IADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIAIIRSDLIGNCQPVTPVMLDYKIH  296

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+SLYNTPP YGIYMCGLVFEDLLAQGGL EVE+KN+ KA ILY+AID S GFYRCPV
Sbjct  297  ADNDSLYNTPPCYGIYMCGLVFEDLLAQGGLNEVEQKNLNKAGILYDAIDGSKGFYRCPV  356

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  357  EKSVRSLMNVPFTLAKPELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  416

Query  383  VAFMKDFMAKH  351
            VAFM DF A+H
Sbjct  417  VAFMADFQARH  427



>ref|XP_003635671.2| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like, 
partial [Vitis vinifera]
Length=412

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+RKDLIGN Q ITPIM DYKIH
Sbjct  221  IADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIVRKDLIGNAQEITPIMFDYKIH  280

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN+KKA+ILY+AID SNGFYRCPV
Sbjct  281  VENNSLYNTPPCYGIYMCGLVFEDLLAQGGLKEVEKKNIKKAQILYDAIDESNGFYRCPV  340

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K +LE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  341  EKSVRSLMNVPFTLEKSDLEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  400

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  401  VAFMKDFQARHA  412



>ref|XP_003520028.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Glycine max]
Length=427

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIR DLIG+ Q  TPIMLDYKIH
Sbjct  236  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRNDLIGHAQESTPIMLDYKIH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLL QGGLGEVEKKN+KKAE+LY  ID SNGFY+CPV
Sbjct  296  AENNSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVEKKNVKKAEVLYNTIDGSNGFYKCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL KPELEGEFIKEAA   MVQLKGHRSVGGMRASIYNAMPLAGV+KL
Sbjct  356  EKSVRSLMNVPFTLEKPELEGEFIKEAAKENMVQLKGHRSVGGMRASIYNAMPLAGVQKL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|XP_003635669.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Vitis vinifera]
Length=427

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+RKDLIGN Q ITPIM DYKIH
Sbjct  236  IADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIVRKDLIGNAQEITPIMFDYKIH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN+KKA+ILY+AID SNGFYRCPV
Sbjct  296  VENNSLYNTPPCYGIYMCGLVFEDLLAQGGLKEVEKKNIKKAQILYDAIDESNGFYRCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K +LE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  356  EKSVRSLMNVPFTLEKSDLEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|XP_003537679.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Glycine max]
Length=408

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+M DYKIH
Sbjct  217  VADMSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGFTPVMFDYKIH  276

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLL QGGLGEVE+KN KKAEILY AID S GFY+CPV
Sbjct  277  DENNSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVERKNQKKAEILYSAIDGSKGFYKCPV  336

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  337  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  396

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  397  VAFMKDFQARHA  408



>gb|KHN00422.1| Phosphoserine aminotransferase, chloroplastic [Glycine soja]
Length=189

 Score =   342 bits (877),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  914  MSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDN  735
            MSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIR DLIG+ Q  TPIMLDYKIH++N
Sbjct  1    MSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRNDLIGHAQESTPIMLDYKIHAEN  60

Query  734  NSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKS  555
            NSLYNTPP YGIYMCGLVFEDLL QGGLGEVEKKN+KKAE+LY  ID SNGFY+CPVEKS
Sbjct  61   NSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVEKKNVKKAEVLYNTIDGSNGFYKCPVEKS  120

Query  554  VRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  375
            VRSLMNVPFTL KPELEGEFIKEAA   MVQLKGHRSVGGMRASIYNAMPLAGV+KLVAF
Sbjct  121  VRSLMNVPFTLEKPELEGEFIKEAAKENMVQLKGHRSVGGMRASIYNAMPLAGVQKLVAF  180

Query  374  MKDFMAKH  351
            MKDF A+H
Sbjct  181  MKDFQARH  188



>ref|XP_004509428.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Cicer arietinum]
Length=431

 Score =   350 bits (898),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+R DLIGN Q +TP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQGLTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKAEILY+AID SNGF+RCPV
Sbjct  300  AENNSLYNTPPCYGIYMCGLVFEDLLEQGGLVEVEKKNRKKAEILYQAIDESNGFFRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRS MNVPFTL K ELEGEFIKEAA   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSFMNVPFTLEKSELEGEFIKEAAKENMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  420  VAFMKDFQAKHA  431



>ref|XP_009792779.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=437

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  246  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQESTPVMLDYKIH  305

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN KKAEILY AIDSSNGF+RCPV
Sbjct  306  AENNSLYNTPPCYGIYMCGLVFEDLLAQGGLVEVEKKNKKKAEILYNAIDSSNGFFRCPV  365

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EF+K AAA KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  366  EKSVRSLMNVPFTLAKPELEAEFVKAAAAEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  425

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  426  VAFMKDFQAKHA  437



>ref|XP_009603772.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=438

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  247  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQESTPVMLDYKIH  306

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN KKAEILY AIDSSNGF+RCPV
Sbjct  307  AENNSLYNTPPCYGIYMCGLVFEDLLAQGGLVEVEKKNKKKAEILYNAIDSSNGFFRCPV  366

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTLAKPELE EF+K AA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  367  EKSVRSLMNVPFTLAKPELEAEFVKAAAVEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  426

Query  383  VAFMKDFMAKHG  348
            +AFMKDF AKH 
Sbjct  427  IAFMKDFQAKHA  438



>gb|KHN41833.1| Phosphoserine aminotransferase, chloroplastic [Glycine soja]
Length=189

 Score =   340 bits (871),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  914  MSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDN  735
            MSSNFCSKPVDV++FG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+M DYKIH +N
Sbjct  1    MSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGFTPVMFDYKIHDEN  60

Query  734  NSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKS  555
            NSLYNTPP YGIYMCGLVFEDLL QGGLGEVE++N KKAEILY AID S GFY+CPVEKS
Sbjct  61   NSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVERRNKKKAEILYSAIDGSKGFYKCPVEKS  120

Query  554  VRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  375
            VRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF
Sbjct  121  VRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  180

Query  374  MKDFMAKH  351
            MKDF A+H
Sbjct  181  MKDFQARH  188



>gb|KHN35969.1| Phosphoserine aminotransferase, chloroplastic [Glycine soja]
Length=189

 Score =   340 bits (871),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  914  MSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDN  735
            MSSNFCSKPVDV++FG+IYAGAQKNVGPSGV IVIIRKDLIGN Q +TP+M DYKIH +N
Sbjct  1    MSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGVTPVMFDYKIHDEN  60

Query  734  NSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKS  555
            +SLYNTPP YGIYMCGLVFEDLL QGGLGEVE++N KKAEILY AID S GFY+CPVEKS
Sbjct  61   DSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVERRNKKKAEILYSAIDGSKGFYKCPVEKS  120

Query  554  VRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  375
            VRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF
Sbjct  121  VRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  180

Query  374  MKDFMAKH  351
            MKDF A+H
Sbjct  181  MKDFQARH  188



>ref|XP_012065373.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Jatropha curcas]
 gb|KDP43750.1| hypothetical protein JCGZ_22377 [Jatropha curcas]
Length=423

 Score =   348 bits (893),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KF +IYAGAQKNVGPSGV IVIIRKDL+GN Q ITP+MLDYK  
Sbjct  232  VADMSSNFCSKPVDVSKFAVIYAGAQKNVGPSGVTIVIIRKDLLGNAQEITPVMLDYKTQ  291

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+SLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN KKAE+LY AID SNGFYRCPV
Sbjct  292  ADNDSLYNTPPCYGIYMCGLVFEDLLAQGGLHEVEKKNKKKAELLYNAIDESNGFYRCPV  351

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  352  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  411

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  412  VAFMKDFQARHA  423



>ref|XP_003517140.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Glycine max]
Length=413

 Score =   347 bits (891),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV IVIIRKDLIGN Q +TP+M DYKIH
Sbjct  222  VADMSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGVTPVMFDYKIH  281

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP YGIYMCGLVFEDLL QGGLGEVE++N KKAEILY AID S GFY+CPV
Sbjct  282  DENDSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVERRNKKKAEILYSAIDGSKGFYKCPV  341

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  342  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  401

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  402  VAFMKDFQARHA  413



>gb|KJB10382.1| hypothetical protein B456_001G198400 [Gossypium raimondii]
 gb|KJB10383.1| hypothetical protein B456_001G198400 [Gossypium raimondii]
 gb|KJB10384.1| hypothetical protein B456_001G198400 [Gossypium raimondii]
Length=420

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVTKFG+IYAGAQKNVGPSGV IVI+RKDL+GN Q ITP+MLDYKIH
Sbjct  229  VADMSSNFCSKPVDVTKFGLIYAGAQKNVGPSGVCIVIVRKDLLGNAQEITPVMLDYKIH  288

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DNNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA ILY AID S GFYRCPV
Sbjct  289  ADNNSLYNTPPCYGIYMCGLVFEDLLKQGGLEEVEKKNQKKAGILYNAIDESKGFYRCPV  348

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEA   KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  349  EKSVRSLMNVPFTLEKSELEAEFLKEAEKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  408

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  409  VAFMKDFQAKHA  420



>emb|CDP01807.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN QPITP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIIRKDLIGNAQPITPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLLAQGGL EVEKKN KKA+ILY+ ID+SNGFYRCPV
Sbjct  299  AENNSLYNTPPCYGIYMCGLVFEDLLAQGGLVEVEKKNKKKAQILYDTIDASNGFYRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL KPELE +FIKEAA  KM+QLKGHRSVGGMRASIYNAMP AGVEKL
Sbjct  359  EKSVRSLMNVPFTLVKPELEADFIKEAAKEKMLQLKGHRSVGGMRASIYNAMPYAGVEKL  418

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  419  VAFMKDFQARH  429



>ref|XP_010531005.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Tarenaya 
hassleriana]
Length=431

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV +VIIRKDLIGN + ITP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTVVIIRKDLIGNARDITPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN KKA++LY+AID S GFYRCPV
Sbjct  300  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQKKAQLLYDAIDESKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  420  VAFMKDFQAKHA  431



>ref|XP_009112441.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Brassica 
rapa]
Length=415

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q +TP+MLDYKIH
Sbjct  224  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQDVTPVMLDYKIH  283

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLLAQGGL EVEKKN +KA+ILY+AID S GF+RCPV
Sbjct  284  DENSSLYNTPPCFGIYMCGLVFDDLLAQGGLNEVEKKNQRKAKILYDAIDESRGFFRCPV  343

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  344  EKSVRSLMNVPFTLEKAELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  403

Query  383  VAFMKDFMAKHG  348
            VAFMK+F A+H 
Sbjct  404  VAFMKEFQARHA  415



>ref|XP_007157987.1| hypothetical protein PHAVU_002G115000g [Phaseolus vulgaris]
 gb|ESW29981.1| hypothetical protein PHAVU_002G115000g [Phaseolus vulgaris]
Length=411

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+RKDLIGN Q +TP+M DYKIH
Sbjct  220  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIVRKDLIGNAQALTPLMFDYKIH  279

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             DNNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA+ILY AID S GFYRCPV
Sbjct  280  DDNNSLYNTPPCYGIYMCGLVFEDLLEQGGLMEVEKKNKKKADILYNAIDGSKGFYRCPV  339

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGG+RASIYNAMPLAGVEKL
Sbjct  340  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGVRASIYNAMPLAGVEKL  399

Query  383  VAFMKDFMAKHG  348
            VAFMKDF  +H 
Sbjct  400  VAFMKDFQVRHA  411



>ref|XP_004512250.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Cicer arietinum]
Length=425

 Score =   345 bits (886),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  234  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQSFTPVMLDYKIH  293

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLL +GGL EVEK N +KAEIL+ AID S+GFY+CPV
Sbjct  294  DENNSLYNTPPCYGIYMCGLVFEDLLERGGLKEVEKNNKRKAEILFNAIDESSGFYKCPV  353

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  354  EKSVRSLMNVPFTLEKQELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  413

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  414  VAFMKDFQAKHA  425



>ref|XP_008392518.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Malus domestica]
Length=431

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV IVIIRKDLIGN QP+TP+MLDYKIH
Sbjct  240  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQPVTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGL E+EKKN +KA+ LY AID S GFYRCPV
Sbjct  300  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLXEIEKKNKRKADXLYNAIDESKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKXELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  420  VAFMKEFQAKHA  431



>emb|CDY30356.1| BnaA09g09210D [Brassica napus]
Length=405

 Score =   345 bits (884),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q +TP+MLDYKIH
Sbjct  214  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQDVTPVMLDYKIH  273

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLLAQGGL EVEKKN +KA+ILY+AID S GF+RCPV
Sbjct  274  DENSSLYNTPPCFGIYMCGLVFDDLLAQGGLNEVEKKNQRKAKILYDAIDESRGFFRCPV  333

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  334  EKSVRSLMNVPFTLEKAELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  393

Query  383  VAFMKDFMAKHG  348
            VAFMK+F A+H 
Sbjct  394  VAFMKEFQARHA  405



>ref|XP_009344666.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Pyrus 
x bretschneideri]
Length=431

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV I IIRKDLIGN QP+TP+MLDYKIH
Sbjct  240  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIAIIRKDLIGNAQPVTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGL E+EKKN +KA+ILY AID S GFYRCPV
Sbjct  300  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLVEIEKKNKRKADILYNAIDESKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKAELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  420  VAFMKEFQAKHA  431



>gb|ACU18241.1| unknown [Glycine max]
Length=189

 Score =   337 bits (863),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  914  MSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDN  735
            MSSNFCSKPVDV++FG+IYAGAQKNVGPSG  IVIIRKDLIGN Q +TP+M DYKIH +N
Sbjct  1    MSSNFCSKPVDVSRFGVIYAGAQKNVGPSGATIVIIRKDLIGNAQGVTPVMFDYKIHDEN  60

Query  734  NSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKS  555
            +SLYNTPP YGIYMCGLVFEDLL QGGLGEVE++N KKAEILY AID S GFY+CPVEKS
Sbjct  61   DSLYNTPPCYGIYMCGLVFEDLLEQGGLGEVERRNKKKAEILYSAIDGSKGFYKCPVEKS  120

Query  554  VRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  375
            VRSLMNVPFTL K ELEGEFIKEA   KMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF
Sbjct  121  VRSLMNVPFTLEKSELEGEFIKEATKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAF  180

Query  374  MKDFMAKH  351
            MKDF A+H
Sbjct  181  MKDFQARH  188



>ref|XP_008337931.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Malus domestica]
Length=432

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+ FGIIYAGAQKNVGPSGV IVIIRKDLIGN QP+TP+MLDYKIH
Sbjct  241  IADMSSNFCSKPVDVSXFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQPVTPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGL E+EKKN +KA+ILY AID S GFYRCPV
Sbjct  301  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLVEIEKKNKRKADILYNAIDESKGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  EKSVRSLMNVPFTLEKAELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  421  VAFMKEFQAKHA  432



>ref|XP_011461731.1| PREDICTED: LOW QUALITY PROTEIN: phosphoserine aminotransferase 
1, chloroplastic [Fragaria vesca subsp. vesca]
Length=429

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  238  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQEITPVMLDYKIH  297

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLL QGGL  +EKKN KKA++LY AID SNGFYRCPV
Sbjct  298  DENNSLYNTPPCYGIYMCGLVFEDLLEQGGLPGIEKKNKKKADLLYNAIDGSNGFYRCPV  357

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  358  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  417

Query  383  VAFMKDFMAKHG  348
            VAFMK+F A+H 
Sbjct  418  VAFMKEFQARHA  429



>ref|NP_195288.1| phosphoserine aminotransferase [Arabidopsis thaliana]
 sp|Q96255.1|SERB1_ARATH RecName: Full=Phosphoserine aminotransferase 1, chloroplastic; 
Short=AtPSAT1; AltName: Full=Phosphohydroxythreonine aminotransferase; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA13640.1| phosphoserine aminotransferase [Arabidopsis thaliana]
 dbj|BAA24441.1| phosphoserine aminotransferase [Arabidopsis thaliana]
 emb|CAA20033.1| phosphoserine aminotransferase [Arabidopsis thaliana]
 emb|CAB80279.1| phosphoserine aminotransferase [Arabidopsis thaliana]
 gb|ABG25082.1| At4g35630 [Arabidopsis thaliana]
 gb|AEE86542.1| phosphoserine aminotransferase [Arabidopsis thaliana]
Length=430

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ SNGF+RCPV
Sbjct  299  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>gb|AAM91543.1| phosphoserine aminotransferase [Arabidopsis thaliana]
Length=430

 Score =   345 bits (885),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ SNGF+RCPV
Sbjct  299  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>ref|XP_010514779.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Camelina sativa]
Length=426

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  235  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  294

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID S GF+RCPV
Sbjct  295  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPV  354

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  355  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  414

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  415  VAFMKDFQAKHA  426



>gb|KFK40140.1| hypothetical protein AALP_AA3G335800 [Arabis alpina]
Length=421

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  230  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  289

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID SNGF++CPV
Sbjct  290  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESNGFFKCPV  349

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  350  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  409

Query  383  VAFMKDFMAKHG  348
            VAFMK+F A+H 
Sbjct  410  VAFMKEFQARHA  421



>ref|XP_009337103.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Pyrus 
x bretschneideri]
Length=435

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV IVIIRKDLIGN QP+TP+MLDYKI 
Sbjct  244  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIVIIRKDLIGNAQPVTPVMLDYKIQ  303

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGL E+EKKN +KA+ILY AID S GFYRCPV
Sbjct  304  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLVEIEKKNKRKADILYNAIDESKGFYRCPV  363

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  364  EKSVRSLMNVPFTLEKAELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  423

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  424  VAFMKEFQAKHA  435



>ref|XP_009350725.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=431

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV I IIRKDLIGN QP+TP+MLDYKIH
Sbjct  240  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTIAIIRKDLIGNAQPVTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGL E+EKKN +KA+ILY AID S GFYRCPV
Sbjct  300  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLVEIEKKNKRKADILYNAIDESKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKAELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMK+F  KH 
Sbjct  420  VAFMKEFQTKHA  431



>gb|AGF95094.1| phosphoserine aminotransferase [Prunus persica]
Length=430

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN Q ITP+MLD+KIH
Sbjct  239  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQEITPVMLDFKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGLGE+EKKN +KA++LY AID S GFYRCPV
Sbjct  299  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLGEIEKKNKRKADLLYNAIDESKGFYRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            V FMKDF AKH 
Sbjct  419  VDFMKDFQAKHA  430



>ref|XP_007202079.1| hypothetical protein PRUPE_ppa006013mg [Prunus persica]
 gb|EMJ03278.1| hypothetical protein PRUPE_ppa006013mg [Prunus persica]
Length=432

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN Q ITP+MLD+KIH
Sbjct  241  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQEITPVMLDFKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGLGE+EKKN +KA++LY AID S GFYRCPV
Sbjct  301  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLGEIEKKNKRKADLLYNAIDESKGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  EKSVRSLMNVPFTLEKSELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            V FMKDF AKH 
Sbjct  421  VDFMKDFQAKHA  432



>ref|XP_007046529.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOX90686.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=427

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVTKFG+IYAGAQKNVGPSGV IVI+RKDL+GN Q +TP+MLDYKIH
Sbjct  236  VADMSSNFCSKPVDVTKFGLIYAGAQKNVGPSGVCIVIVRKDLLGNAQGVTPVMLDYKIH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN KKA ILY AID S GFYRCPV
Sbjct  296  AENNSLYNTPPCFGIYMCGLVFEDLLKQGGLEEVEKKNQKKAAILYNAIDESKGFYRCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMP+AGVE+L
Sbjct  356  EKSVRSLMNVPFTLEKSELEAEFLKEAAKEKMVQLKGHRSVGGMRASIYNAMPMAGVERL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|NP_179354.1| pyridoxal phosphate-dependent transferases superfamily protein 
[Arabidopsis thaliana]
 sp|Q9SHP0.1|SERB2_ARATH RecName: Full=Phosphoserine aminotransferase 2, chloroplastic; 
Short=AtPSAT2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD32948.1| putative phosphoserine aminotransferase [Arabidopsis thaliana]
 gb|AAY56409.1| At2g17630 [Arabidopsis thaliana]
 gb|ABG25070.1| At2g17630 [Arabidopsis thaliana]
 gb|AEC06659.1| pyridoxal phosphate-dependent transferases superfamily protein 
[Arabidopsis thaliana]
Length=422

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  231  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  290

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID S GF+RCPV
Sbjct  291  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPV  350

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  351  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  410

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  411  VAFMKDFQARHA  422



>ref|XP_010548226.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=431

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVTKFG+IYAGAQKNVGPSGV IVIIRKDLIGN    TP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVTKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAMDFTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN  KA++LY+AID S GFYRCPV
Sbjct  300  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQTKAQLLYDAIDESKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  420  VAFMKDFQARHA  431



>ref|XP_010432252.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Camelina sativa]
Length=432

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IV+IRKDLIGN Q ITP+MLDYKIH
Sbjct  241  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVVIRKDLIGNAQDITPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ S GFYRCPV
Sbjct  301  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESEGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  421  VAFMKDFQAKHA  432



>sp|P52877.1|SERC_SPIOL RecName: Full=Phosphoserine aminotransferase, chloroplastic; 
Short=PSAT; AltName: Full=Phosphohydroxythreonine aminotransferase; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA12206.1| phosphoserine aminotransferase [Spinacia oleracea]
Length=430

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVTKFG+IYAGAQKNVGPSGV IVI+R DLIGN Q +TP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVTKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQKMTPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN  KA++LY+AID SNGFY+CPV
Sbjct  299  ADNKSLYNTPPCYGIYMCGLVFEDLLNQGGLVEVEKKNKAKAQVLYDAIDESNGFYKCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEG+FIKEAA  KMV LKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEGDFIKEAAKEKMVALKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  419  VAFMKEFQAKHA  430



>gb|AAM64881.1| phosphoserine aminotransferase [Arabidopsis thaliana]
Length=430

 Score =   343 bits (880),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ SNGF+RCPV
Sbjct  299  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAF+KDF AKH 
Sbjct  419  VAFIKDFQAKHA  430



>ref|XP_011022144.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Populus euphratica]
Length=427

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG IYAGAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  236  VADMSSNFCSKPVDVSKFGAIYAGAQKNVGPSGVTIVIIRKDLIGNAQGITPVMLDYKIH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP +GIYMCGLVF+DLLAQGGL EVEK+N KK ++LY AID S GFYRCPV
Sbjct  296  AENNSLYNTPPCFGIYMCGLVFDDLLAQGGLKEVEKRNKKKGDLLYNAIDESKGFYRCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRSLMNVPFTL K ELE EFIKEAA  KM+QLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  356  DKSVRSLMNVPFTLEKSELEAEFIKEAANEKMIQLKGHRSVGGMRASIYNAMPLAGVEKL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|XP_002307204.2| hypothetical protein POPTR_0005s10290g [Populus trichocarpa]
 gb|EEE94200.2| hypothetical protein POPTR_0005s10290g [Populus trichocarpa]
Length=426

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  235  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGITPVMLDYKIH  294

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP +GIYMCGLVF+DLLAQGGL EVEK+N KK ++LY  ID S GFYRCPV
Sbjct  295  AENNSLYNTPPCFGIYMCGLVFDDLLAQGGLKEVEKRNKKKGDLLYNTIDESKGFYRCPV  354

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRSLMNVPFTL K ELE EFIKEAA  KM+QLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  355  DKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMIQLKGHRSVGGMRASIYNAMPLAGVEKL  414

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  415  VAFMKDFQARHA  426



>ref|XP_010446900.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Camelina 
sativa]
Length=430

 Score =   343 bits (880),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IV+IRKDLIGN Q ITP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVVIRKDLIGNAQGITPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ S GFYRCPV
Sbjct  299  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESKGFYRCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>ref|XP_010437444.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Camelina sativa]
Length=432

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IV+IRKDLIGN Q ITP+MLDYKIH
Sbjct  241  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVVIRKDLIGNAQGITPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ S GFYRCPV
Sbjct  301  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESEGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  421  VAFMKDFQAKHA  432



>emb|CDY24817.1| BnaA08g14930D [Brassica napus]
Length=434

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  243  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQEITPVMLDYKIH  302

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVE+KN+KKA++LY AI+ S GF++CPV
Sbjct  303  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVERKNVKKADLLYNAIEESKGFFKCPV  362

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  363  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  422

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  423  VAFMKDFQAKHA  434



>ref|XP_002869075.1| phosphoserine aminotransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45334.1| phosphoserine aminotransferase [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVE+KN +KA++LY AI+ SNGF+RCPV
Sbjct  300  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVERKNQRKADLLYNAIEESNGFFRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  420  VAFMKDFQAKHA  431



>ref|XP_010467540.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic [Camelina 
sativa]
Length=426

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  235  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  294

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID S GF+RCPV
Sbjct  295  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPV  354

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  355  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  414

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  415  VAFMKDFQARHA  426



>ref|XP_008241967.1| PREDICTED: LOW QUALITY PROTEIN: phosphoserine aminotransferase, 
chloroplastic-like [Prunus mume]
Length=429

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 174/196 (89%), Gaps = 4/196 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN Q ITP+MLD+KIH
Sbjct  234  IADMSSNFCSKPVDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQEITPVMLDFKIH  293

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N SLYNTPP YGIYMCGLVFEDLL QGGLGE+EKKN +KA++LY AID S GFYRCPV
Sbjct  294  DENKSLYNTPPCYGIYMCGLVFEDLLEQGGLGEIEKKNKRKADLLYNAIDESKGFYRCPV  353

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAG----KMVQLKGHRSVGGMRASIYNAMPLAG  396
            EKSVRSLMNVP TL  PELE EF+KEAA G    KMVQLKGHRSVGGMRASIYNAMPLAG
Sbjct  354  EKSVRSLMNVPVTLESPELEAEFVKEAAKGSAKEKMVQLKGHRSVGGMRASIYNAMPLAG  413

Query  395  VEKLVAFMKDFMAKHG  348
            VEKLVAFMKDF AKH 
Sbjct  414  VEKLVAFMKDFQAKHA  429



>emb|CDY26817.1| BnaC09g09440D [Brassica napus]
Length=420

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + +TP+MLDYKIH
Sbjct  229  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDVTPVMLDYKIH  288

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLLAQGGL EVEKKN +KA+ILY+AID S GF+RCPV
Sbjct  289  DENSSLYNTPPCFGIYMCGLVFDDLLAQGGLKEVEKKNQRKAKILYDAIDESRGFFRCPV  348

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  349  EKSVRSLMNVPFTLEKSELEAEFIKEAAKDKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  408

Query  383  VAFMKDFMAKHG  348
            VAFMK+F A+H 
Sbjct  409  VAFMKEFQARHA  420



>ref|XP_010113250.1| Phosphoserine aminotransferase [Morus notabilis]
 gb|EXC35257.1| Phosphoserine aminotransferase [Morus notabilis]
Length=422

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
             ADMSSNFCSKPV+VTKFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  231  AADMSSNFCSKPVNVTKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQEKTPVMLDYKIH  290

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            SDNNSLYNTPP YGIY+CGLVFEDLL QGGL EVE+KN  KA +LY AID S GFYRCPV
Sbjct  291  SDNNSLYNTPPCYGIYICGLVFEDLLEQGGLEEVERKNKHKANLLYNAIDESKGFYRCPV  350

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EF+KEAA  KM+QLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  351  EKSVRSLMNVPFTLEKSELEAEFVKEAAKEKMLQLKGHRSVGGMRASIYNAMPLAGVEKL  410

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  411  VAFMKDFQARHA  422



>ref|XP_009109285.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Brassica 
rapa]
Length=433

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  242  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQEITPVMLDYKIH  301

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ S GF++CPV
Sbjct  302  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESKGFFKCPV  361

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  362  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  421

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  422  VAFMKDFQAKHA  433



>dbj|BAF00851.1| putative phosphoserine aminotransferase [Arabidopsis thaliana]
Length=422

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  231  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  290

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID S GF+RCP+
Sbjct  291  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPI  350

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIK+AA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  351  EKSVRSLMNVPFTLEKSELEAEFIKKAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  410

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  411  VAFMKDFQARHA  422



>gb|KFK30206.1| hypothetical protein AALP_AA7G231900 [Arabis alpina]
Length=420

 Score =   340 bits (872),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIG+ +  TP+MLDYKIH
Sbjct  229  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGDARDFTPVMLDYKIH  288

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN KKA++LY AI+ SNGF++CPV
Sbjct  289  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQKKADLLYNAIEGSNGFFKCPV  348

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  349  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  408

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKHG
Sbjct  409  VAFMKDFQAKHG  420



>ref|XP_002884072.1| hypothetical protein ARALYDRAFT_900110 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60331.1| hypothetical protein ARALYDRAFT_900110 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   340 bits (871),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  229  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  288

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KA +LY AID S GF+RCPV
Sbjct  289  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAMLLYNAIDESRGFFRCPV  348

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  349  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  408

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  409  VAFMKDFQARHA  420



>emb|CDY41644.1| BnaC03g62400D [Brassica napus]
Length=432

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH
Sbjct  241  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQEITPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVE+KN +KA++LY AI+ S GF++CPV
Sbjct  301  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVERKNQRKADLLYNAIEESKGFFKCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPL+GVEKL
Sbjct  361  EKSVRSLMNVPFTLEKSELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLSGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  421  VAFMKDFQAKHA  432



>ref|XP_006299001.1| hypothetical protein CARUB_v10015128mg [Capsella rubella]
 gb|EOA31899.1| hypothetical protein CARUB_v10015128mg [Capsella rubella]
Length=423

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  232  IADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  291

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL  VEKKN +KAE+LY AID S GF+RCPV
Sbjct  292  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKVVEKKNQRKAELLYNAIDESRGFFRCPV  351

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMP AGVEKL
Sbjct  352  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPFAGVEKL  411

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  412  VAFMKDFQAKHA  423



>ref|XP_006412081.1| hypothetical protein EUTSA_v10025259mg [Eutrema salsugineum]
 gb|ESQ53534.1| hypothetical protein EUTSA_v10025259mg [Eutrema salsugineum]
Length=431

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVE+KN +KA++LY AI+ S GF+RCPV
Sbjct  300  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVERKNQRKADLLYNAIEESKGFFRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  420  VAFMKDFQAKHA  431



>ref|XP_006285246.1| hypothetical protein CARUB_v10006606mg [Capsella rubella]
 gb|EOA18144.1| hypothetical protein CARUB_v10006606mg [Capsella rubella]
Length=431

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q  TP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDTTPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVFEDLL QGGL EVEKKN +KA +LY AI+ S GFYRCPV
Sbjct  300  DENSSLYNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKANLLYNAIEKSKGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE +FIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEADFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  420  VAFMKDFQAKHA  431



>ref|XP_006409274.1| hypothetical protein EUTSA_v10023021mg [Eutrema salsugineum]
 gb|ESQ50727.1| hypothetical protein EUTSA_v10023021mg [Eutrema salsugineum]
Length=427

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSSN CSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN + ITP+MLDYK H
Sbjct  236  IADMSSNCCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKTH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+SLYNTPP +GIYMCGLVF+DLL QGGL EVEKKN +KAE+LY AID S GF+RCPV
Sbjct  296  DENSSLYNTPPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  356  EKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|XP_008448492.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Cucumis melo]
Length=429

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVD++KFGIIYAGAQKNVGPSGV IVIIRKDLIG  Q ITP+MLDYKIH
Sbjct  238  VADMSSNFCSKPVDISKFGIIYAGAQKNVGPSGVTIVIIRKDLIGGAQDITPVMLDYKIH  297

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA+ILYEAID SNGFYRCPV
Sbjct  298  HENNSLYNTPPCYGIYMCGLVFEDLLQQGGLKEVEKKNKKKADILYEAIDQSNGFYRCPV  357

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E+SVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  358  ERSVRSLMNVPFTLEKAELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  417

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  418  VAFMKDFQARHA  429



>ref|XP_003629163.1| Phosphoserine aminotransferase [Medicago truncatula]
 gb|AET03639.1| phosphoserine aminotransferase [Medicago truncatula]
Length=428

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+R DLIGN Q +TP+MLDYKIH
Sbjct  237  VADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQDLTPVMLDYKIH  296

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKAEILY AID SNGF++CPV
Sbjct  297  AENNSLYNTPPCYGIYMCGLVFEDLLEQGGLVEVEKKNKKKAEILYNAIDESNGFFKCPV  356

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  357  EKSVRSLMNVPFTLEKSELEGEFIKEAAKENMVQLKGHRSVGGMRASIYNAMPLAGVEKL  416

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  417  VAFMKNFQAKHA  428



>dbj|BAH20335.1| AT4G35630 [Arabidopsis thaliana]
Length=184

 Score =   326 bits (835),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  899  CSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDNNSLYN  720
            CSKPVDV+KFG+IY GAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKIH +N+SLYN
Sbjct  1    CSKPVDVSKFGVIYGGAQKNVGPSGVTIVIIRKDLIGNAQDITPVMLDYKIHDENSSLYN  60

Query  719  TPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKSVRSLM  540
            TPP +GIYMCGLVFEDLL QGGL EVEKKN +KA++LY AI+ SNGF+RCPVEKSVRSLM
Sbjct  61   TPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGFFRCPVEKSVRSLM  120

Query  539  NVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDFM  360
            NVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDF 
Sbjct  121  NVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDFQ  180

Query  359  AKHG  348
            AKH 
Sbjct  181  AKHA  184



>ref|XP_010679952.1| PREDICTED: phosphoserine aminotransferase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=429

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+R DLIGN Q  TPIMLDYKIH
Sbjct  238  VADMSSNFCSKPVDVSKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQKSTPIMLDYKIH  297

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN  KA+IL++AID S GFY+CPV
Sbjct  298  ADNKSLYNTPPCYGIYMCGLVFEDLLNQGGLVEVEKKNKVKAQILFDAIDESGGFYKCPV  357

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE +FIKEAA  KMV LKGHRSVGGMRASIYNAMPLAGV+KL
Sbjct  358  EKSVRSLMNVPFTLEKSELEADFIKEAAKEKMVALKGHRSVGGMRASIYNAMPLAGVQKL  417

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  418  VAFMKDFQARHA  429



>emb|CCC55428.1| phosphoserine aminotransferase [Pinus pinaster]
Length=433

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGP+GV IVIIR DLIGN Q  TP+MLDYKIH
Sbjct  243  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPAGVTIVIIRNDLIGNAQQSTPLMLDYKIH  302

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N SLYNTPP + IYMCGLVFEDLLAQGGL E+EKKN++KA+ILY+AID+SNGFYRCPV
Sbjct  303  AENKSLYNTPPCFTIYMCGLVFEDLLAQGGLSEIEKKNVQKAKILYDAIDASNGFYRCPV  362

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE +FIK+AA+  M+QLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  363  EKSVRSLMNVPFTLEKSELESDFIKQAASESMLQLKGHRSVGGMRASIYNAMPLAGVEKL  422

Query  383  VAFMKDFMAKH  351
            V+FMK F A H
Sbjct  423  VSFMKVFQANH  433



>ref|XP_007156227.1| hypothetical protein PHAVU_003G269100g [Phaseolus vulgaris]
 gb|ESW28221.1| hypothetical protein PHAVU_003G269100g [Phaseolus vulgaris]
Length=429

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV IVI+R DL+G  Q  TP+MLDYKIH
Sbjct  238  VADMSSNFCSKPVDVSQFGVIYAGAQKNVGPSGVTIVIVRDDLVGRAQGFTPVMLDYKIH  297

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N SLYNTPP YGIYMCGLVF+DLL QGGL EVEKKN+KKAEILY+AID S G+Y+CPV
Sbjct  298  AENMSLYNTPPCYGIYMCGLVFQDLLEQGGLAEVEKKNVKKAEILYDAIDGSKGYYKCPV  357

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEGEFIKEAA   MVQLKGHRSVGG+RASIYNAMPLAGV+KL
Sbjct  358  EKSVRSLMNVPFTLEKSELEGEFIKEAAKENMVQLKGHRSVGGIRASIYNAMPLAGVQKL  417

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  418  VAFMKDFQARHA  429



>gb|EPS60264.1| hypothetical protein M569_14539, partial [Genlisea aurea]
Length=365

 Score =   330 bits (847),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVD+T+FG+IYAGAQKNVGPSGV IVIIR DLIG+ QPITP+MLDYKIH
Sbjct  175  VADMSSNFCSKPVDITRFGVIYAGAQKNVGPSGVTIVIIRSDLIGDAQPITPVMLDYKIH  234

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            SDNNSLYNTPP YGIY+CGLVFEDL++QGGL  VE+KN KKA ILY+AID S  FYRCPV
Sbjct  235  SDNNSLYNTPPCYGIYVCGLVFEDLVSQGGLQAVEEKNAKKAGILYDAIDGSREFYRCPV  294

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E+ VRS MNVPFTL K ELEGEF+KEAA   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  295  ERGVRSRMNVPFTLEKGELEGEFVKEAAKEGMVQLKGHRSVGGMRASIYNAMPLAGVEKL  354

Query  383  VAFMKDFMAKH  351
            V FMKDF  +H
Sbjct  355  VGFMKDFQDRH  365



>ref|XP_004146170.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55616.1| Phosphoserine aminotransferase [Cucumis sativus]
Length=427

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVD++KFGIIYAGAQKNVGPSGV IVIIRKDLIG  Q ITP+MLD+KIH
Sbjct  236  VADMSSNFCSKPVDISKFGIIYAGAQKNVGPSGVTIVIIRKDLIGGAQDITPVMLDFKIH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKA+ILYEAID SNGF+RCPV
Sbjct  296  HENNSLYNTPPCYGIYMCGLVFEDLLQQGGLKEVEKKNKKKADILYEAIDQSNGFFRCPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E+SVRSLMNVPFTL K ELEGEFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  356  ERSVRSLMNVPFTLEKAELEGEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  415

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  416  VAFMKDFQARHA  427



>ref|XP_006467066.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Citrus sinensis]
Length=430

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVT+FG+IYAGAQKNVGPSGV IVI+RKDL+GN Q  TP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVTRFGVIYAGAQKNVGPSGVTIVIVRKDLLGNAQDKTPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP Y IYMCGLVFE LL  GGL EVEK N KKAE+LY  ID SNGFY+CPV
Sbjct  299  DENNSLYNTPPCYCIYMCGLVFEYLLELGGLNEVEKMNRKKAELLYNVIDGSNGFYKCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRS MNVPFTL K +LE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSFMNVPFTLEKSDLEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>gb|KDO71443.1| hypothetical protein CISIN_1g043610mg [Citrus sinensis]
Length=430

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVT+FG+IYAGAQKNVGPSGV IVI+RKDL+GN Q  TP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVTRFGVIYAGAQKNVGPSGVTIVIVRKDLLGNAQDKTPLMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP Y IYMCGLVFE LL  GGL EVEK N KKAE+LY  ID SNGFY+CPV
Sbjct  299  DENNSLYNTPPCYCIYMCGLVFEYLLELGGLNEVEKMNRKKAELLYNVIDGSNGFYKCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRS MNVPFTL K +LE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSFMNVPFTLEKSDLEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>ref|XP_006425303.1| hypothetical protein CICLE_v10025659mg [Citrus clementina]
 gb|ESR38543.1| hypothetical protein CICLE_v10025659mg [Citrus clementina]
Length=430

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDVT+FG+IYAGAQKNVGPSGV IVI+RKDL+GN Q  TP+MLDYKIH
Sbjct  239  VADMSSNFCSKPVDVTRFGVIYAGAQKNVGPSGVTIVIVRKDLLGNAQDKTPVMLDYKIH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +NNSLYNTPP Y IYMCGLVFE LL  GGL EVEK N KKAE+LY  ID SNGFY+CPV
Sbjct  299  DENNSLYNTPPCYCIYMCGLVFEYLLELGGLNEVEKMNRKKAELLYNVIDGSNGFYKCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRS MNVPFTL K +LE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  359  EKSVRSFMNVPFTLEKSDLEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  418

Query  383  VAFMKDFMAKHG  348
            VAFMKDF AKH 
Sbjct  419  VAFMKDFQAKHA  430



>ref|XP_002521703.1| phosphoserine aminotransferase, putative [Ricinus communis]
 gb|EEF40690.1| phosphoserine aminotransferase, putative [Ricinus communis]
Length=432

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKP+DV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN Q +TP+MLDYKIH
Sbjct  241  VADMSSNFCSKPIDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQEMTPVMLDYKIH  300

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             DNNSLYNTPP Y IYMCGLVFEDLLAQGGL EVEKKN KKA++LY AID SNGFYRCPV
Sbjct  301  DDNNSLYNTPPCYCIYMCGLVFEDLLAQGGLKEVEKKNKKKADLLYNAIDESNGFYRCPV  360

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRSLMNVPFTL K +LE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  361  DKSVRSLMNVPFTLEKSDLEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  420

Query  383  VAFMKDFMAKHG  348
            VAFMKDF A+H 
Sbjct  421  VAFMKDFQARHA  432



>gb|ABR18366.1| unknown [Picea sitchensis]
Length=433

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGP+GV IVIIR DLIG+ Q  TP+MLDYKIH
Sbjct  243  VADMSSNFCSKPVDVSKFGLIYAGAQKNVGPAGVTIVIIRNDLIGHAQQSTPLMLDYKIH  302

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N SLYNTPP + IYMCGLVFEDLLAQGGL E+EKKN++KA+ILY+AID+SNGFYRCPV
Sbjct  303  AENKSLYNTPPCFTIYMCGLVFEDLLAQGGLNEIEKKNVQKAKILYDAIDASNGFYRCPV  362

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELE +FIK+AA+  M+QLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  363  EKSVRSLMNVPFTLEKSELESDFIKQAASEGMLQLKGHRSVGGMRASIYNAMPLAGVEKL  422

Query  383  VAFMKDFMAKH  351
            V+FMK F A H
Sbjct  423  VSFMKVFQANH  433



>ref|XP_006837940.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Amborella 
trichopoda]
 gb|ERN00509.1| hypothetical protein AMTR_s00102p00039710 [Amborella trichopoda]
Length=434

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVD++KFG+IYAGAQKNVGPSGV IVIIRKDL+GN Q ITP+MLDYKIH
Sbjct  240  VADMSSNFCSKPVDISKFGVIYAGAQKNVGPSGVTIVIIRKDLLGNAQEITPVMLDYKIH  299

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP Y IY+CGLVFEDL+AQGGL  + KKN++KA ILY+AID S GFYRCPV
Sbjct  300  ADNKSLYNTPPCYAIYICGLVFEDLVAQGGLEAIAKKNLEKASILYDAIDESGGFYRCPV  359

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K ELEG FIK+A +  MV LKGHRSVGG+RASIYNAMPLAGVEKL
Sbjct  360  EKSVRSLMNVPFTLEKSELEGGFIKQAVSQGMVSLKGHRSVGGVRASIYNAMPLAGVEKL  419

Query  383  VAFMKDFMAKHG  348
            VAFMK+F AKH 
Sbjct  420  VAFMKEFKAKHA  431



>ref|XP_009395663.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+RKDLIGN QPITP+MLDYKIH
Sbjct  230  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIVRKDLIGNAQPITPVMLDYKIH  289

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+ SLYNTPP + IY+CGLVF DLL QGGL EVEKKN KKA ILY+AID S+GFY CPV
Sbjct  290  ADSASLYNTPPCFTIYICGLVFADLLEQGGLVEVEKKNAKKAGILYDAIDGSDGFYVCPV  349

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K +LE +FI+EAA   M+QLKGHRSVGG+RASIYNAMPLAGVEKL
Sbjct  350  EKSVRSLMNVPFTLEKTDLEKKFIEEAAKEGMIQLKGHRSVGGVRASIYNAMPLAGVEKL  409

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  410  VAFMKDFQARH  420



>ref|XP_009396475.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=418

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+RKDLIGN QPITP+MLDYKIH
Sbjct  227  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIVRKDLIGNAQPITPVMLDYKIH  286

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+ SLYNTPP + IY+CGLVFEDLL QGGL EVEK N KKA ILY+AID S+GFY CPV
Sbjct  287  ADSASLYNTPPCFAIYICGLVFEDLLEQGGLVEVEKNNTKKAGILYDAIDGSDGFYVCPV  346

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL K +LE +FI+EAA   MVQLKGHRSVGG+RASIYNAMPLAGV KL
Sbjct  347  EKSVRSLMNVPFTLQKSDLEKKFIEEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVGKL  406

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  407  VAFMKDFQARH  417



>ref|XP_010932656.1| PREDICTED: phosphoserine aminotransferase 2, chloroplastic-like 
[Elaeis guineensis]
Length=420

 Score =   320 bits (819),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVI+R+DLIG+ Q ITP+MLDYK H
Sbjct  229  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIVRRDLIGSAQEITPVMLDYKTH  288

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+ SLYNTPP + IYMCGLVFE LL QGGL E+EKKN KKA ILY+ ID S GFY CPV
Sbjct  289  ADSASLYNTPPCFAIYMCGLVFEHLLEQGGLVEIEKKNAKKAGILYDTIDGSGGFYVCPV  348

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMN+PFTL K ELE +FI+EA+   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  349  EKSVRSLMNIPFTLQKSELEKKFIEEASKEGMVQLKGHRSVGGMRASIYNAMPLAGVEKL  408

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  409  VAFMKDFQARH  419



>gb|EAY88614.1| hypothetical protein OsI_10089 [Oryza sativa Indica Group]
Length=424

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDL+G+ QPITP+MLDYK H
Sbjct  232  VADMSSNFCSKPVDVSRFGLIYAGAQKNVGPSGVTIAIVRKDLVGSAQPITPVMLDYKTH  291

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN  KA ILY+AID+S G+Y CPV
Sbjct  292  ADNASLYNTPPCFAIYICGLVFEDLLAQGGLAEVEKKNAHKAGILYDAIDASGGYYICPV  351

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            EKSVRSLMNVPFTLAK  + E +FI EAA   MVQLKGHRSVGG+RASIYNAMPLAGVEK
Sbjct  352  EKSVRSLMNVPFTLAKGGDFEKQFIAEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVEK  411

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  412  LVAFMKDFQARN  423



>gb|AAM51827.1|AC105730_1 Putative phosphoserine aminotransferase [Oryza sativa Japonica 
Group]
 gb|AAN06833.1| Putative phosphoserine aminotransferase [Oryza sativa Japonica 
Group]
 gb|ABF94069.1| Phosphoserine aminotransferase, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ25642.1| hypothetical protein OsJ_09470 [Oryza sativa Japonica Group]
 dbj|BAH00145.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00794.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDL+G+ QPITP+MLDYK H
Sbjct  234  VADMSSNFCSKPVDVSRFGLIYAGAQKNVGPSGVTIAIVRKDLVGSAQPITPVMLDYKTH  293

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN  KA ILY+AID+S G+Y CPV
Sbjct  294  ADNASLYNTPPCFAIYICGLVFEDLLAQGGLAEVEKKNAHKAGILYDAIDASGGYYICPV  353

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            EKSVRSLMNVPFTLAK  + E +FI EAA   MVQLKGHRSVGG+RASIYNAMPLAGVEK
Sbjct  354  EKSVRSLMNVPFTLAKGGDFEKQFIAEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVEK  413

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  414  LVAFMKDFQARN  425



>ref|XP_006651057.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Oryza brachyantha]
Length=376

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 169/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDLIG+ QPITP+MLDYK H
Sbjct  184  VADMSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIAIVRKDLIGSAQPITPVMLDYKTH  243

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN  KA ILY+AID+S G+Y CPV
Sbjct  244  ADNASLYNTPPCFAIYICGLVFEDLLAQGGLAEVEKKNAHKAGILYDAIDASGGYYICPV  303

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            EK VRSLMNVPFTLAK  + E +FI EAA   MVQLKGHRSVGG+RASIYNAMPLAGVEK
Sbjct  304  EKPVRSLMNVPFTLAKGGDFEKQFIAEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVEK  363

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  364  LVAFMKDFQARN  375



>ref|XP_002991216.1| hypothetical protein SELMODRAFT_133092 [Selaginella moellendorffii]
 gb|EFJ07760.1| hypothetical protein SELMODRAFT_133092 [Selaginella moellendorffii]
Length=430

 Score =   318 bits (816),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV I I+RKDL+G  QP TP+MLD+K H
Sbjct  237  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIAIVRKDLVGGAQPTTPVMLDFKTH  296

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IYMCGLVFEDLL QGGL  + +KN  KAEILY AID S+GFY+CPV
Sbjct  297  ADNKSLYNTPPCFAIYMCGLVFEDLLHQGGLEAIARKNNDKAEILYRAIDGSDGFYKCPV  356

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E SVRS+MNVPFT+A PE+E  F+KEAA   MVQLKGHRSVGG+RASIYNAMP AGVEKL
Sbjct  357  EASVRSVMNVPFTMASPEMEAAFVKEAAGKGMVQLKGHRSVGGVRASIYNAMPRAGVEKL  416

Query  383  VAFMKDFMAKH  351
            VA MKDF A+H
Sbjct  417  VALMKDFQARH  427



>ref|XP_003558775.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic-like 
[Brachypodium distachyon]
Length=420

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FGIIYAGAQKNVGPSGV I I+RKDL+GN QPITP+MLDYK H
Sbjct  228  VADMSSNFCSKPVDVSRFGIIYAGAQKNVGPSGVTIAIVRKDLVGNAQPITPVMLDYKTH  287

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN  KA ILY+ ID+S G++ CPV
Sbjct  288  ADNASLYNTPPCFAIYICGLVFEDLLAQGGLAEVEKKNQHKAGILYDTIDASGGYFICPV  347

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            EKSVRSLMNVPFTLAK  + E +FI EAA   M+QLKGHRSVGG+RASIYNAMPL+GVEK
Sbjct  348  EKSVRSLMNVPFTLAKGADFEKQFIAEAAKEGMLQLKGHRSVGGVRASIYNAMPLSGVEK  407

Query  386  LVAFMKDFMAKH  351
            LV FMKDF A++
Sbjct  408  LVTFMKDFQARN  419



>gb|ACF84724.1| unknown [Zea mays]
 tpg|DAA43444.1| TPA: phosphoserine aminotransferase [Zea mays]
Length=425

 Score =   315 bits (806),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDLIG  QPITP+MLD+K H
Sbjct  233  VADMSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIAIVRKDLIGAAQPITPVMLDFKTH  292

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN +KA  LY+ ID+S G+Y CPV
Sbjct  293  ADNASLYNTPPCFAIYVCGLVFEDLLAQGGLAEVEKKNARKAGALYDTIDASGGYYVCPV  352

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +KSVRS MNVPFTLAK P+ E +FI EAA   MVQLKGHRSVGG+RASIYNAMPLAGVEK
Sbjct  353  DKSVRSHMNVPFTLAKGPDFEKQFIAEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVEK  412

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  413  LVAFMKDFQARN  424



>ref|XP_010029593.1| PREDICTED: phosphoserine aminotransferase 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW56510.1| hypothetical protein EUGRSUZ_I02231 [Eucalyptus grandis]
Length=426

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG+IYAGAQKNVGPSGV IVIIRKDLIGN Q ITP+MLDYKI 
Sbjct  235  VADMSSNFCSKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNAQGITPVMLDYKIQ  294

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N SLYNTPP YGIYMCGLVFEDLL QGGL EVEKKN KKAE+LY A D S GFYRCPV
Sbjct  295  AENASLYNTPPCYGIYMCGLVFEDLLEQGGLKEVEKKNKKKAELLYRAFDESKGFYRCPV  354

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E SVRSLMNVPFTL K ELE EFIKEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  355  EPSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  414

Query  383  VAFMKDFMAKHG  348
            VAFM+DF A+H 
Sbjct  415  VAFMRDFQARHA  426



>ref|NP_001151184.1| phosphoserine aminotransferase 1 [Zea mays]
 gb|ACG41901.1| phosphoserine aminotransferase [Zea mays]
Length=425

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDLIG  QP TP+MLD+K H
Sbjct  233  VADMSSNFCSKPVDVSRFGVIYAGAQKNVGPSGVTIAIVRKDLIGAAQPFTPVMLDFKTH  292

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN +KA  LY+ ID+S G+Y CPV
Sbjct  293  ADNASLYNTPPCFAIYVCGLVFEDLLAQGGLAEVEKKNARKAGALYDTIDASGGYYVCPV  352

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +KSVRS MNVPFTLAK P+ E +FI EAA   MVQLKGHRSVGG+RASIYNAMPLAGVEK
Sbjct  353  DKSVRSHMNVPFTLAKGPDFEKQFIAEAAKEGMVQLKGHRSVGGVRASIYNAMPLAGVEK  412

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  413  LVAFMKDFQARN  424



>ref|XP_008807623.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Phoenix dactylifera]
Length=427

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG IYAGAQKNVGPSGV IVI+R+DLIG+ Q ITP+MLDYK H
Sbjct  236  VADMSSNFCSKPVDVSKFGAIYAGAQKNVGPSGVTIVIVRRDLIGSAQEITPVMLDYKTH  295

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+ SLYNTPP + IYMCGLVFE LL QGGL EVEKKN +KA ILY+ ID S GFY  PV
Sbjct  296  ADSASLYNTPPCFAIYMCGLVFEHLLEQGGLAEVEKKNAEKAGILYDTIDGSGGFYISPV  355

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL + EL+ +FI+EAA   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  356  EKSVRSLMNVPFTLQRSELDKKFIEEAAKEGMVQLKGHRSVGGMRASIYNAMPLAGVEKL  415

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  416  VAFMKDFQARH  426



>ref|XP_008807622.1| PREDICTED: phosphoserine aminotransferase, chloroplastic-like 
[Phoenix dactylifera]
Length=419

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+KFG IYAG QKNVGPSGV IVI+R+DLIG+ Q ITP+MLDYK H
Sbjct  228  VADMSSNFCSKPVDVSKFGAIYAGVQKNVGPSGVTIVIVRRDLIGSAQEITPVMLDYKTH  287

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+ SLYNTPP + IYMCGLVFE LL QGGL EVEKKN +KA ILY+ ID S GFY  PV
Sbjct  288  ADSASLYNTPPCFAIYMCGLVFEHLLEQGGLTEVEKKNAEKAGILYDTIDGSGGFYISPV  347

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRSLMNVPFTL + EL+ +FI+EAA   MVQLKGHRSVGGMRASIYNAMPLAGVEKL
Sbjct  348  EKSVRSLMNVPFTLQRSELDKKFIEEAAKEGMVQLKGHRSVGGMRASIYNAMPLAGVEKL  407

Query  383  VAFMKDFMAKH  351
            VAFMKDF A+H
Sbjct  408  VAFMKDFQARH  418



>ref|XP_007202933.1| hypothetical protein PRUPE_ppa016741mg, partial [Prunus persica]
 gb|EMJ04132.1| hypothetical protein PRUPE_ppa016741mg, partial [Prunus persica]
Length=210

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  893  KPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIHSDNNSLYNTP  714
            +PVDV+KFGIIYAGAQKNVGPSGV +VIIRKDLIGN Q ITP+MLD+KIH ++ SLYNTP
Sbjct  39   RPVDVSKFGIIYAGAQKNVGPSGVTVVIIRKDLIGNAQEITPVMLDFKIHDEDKSLYNTP  98

Query  713  PFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPVEKSVRSLMNV  534
            P YGIYMCGLVFEDLL QGGLGE+EKKN +KA++LY AID S GFYRCPVEKSVRSLMNV
Sbjct  99   PCYGIYMCGLVFEDLLEQGGLGEIEKKNKRKADLLYNAIDESKGFYRCPVEKSVRSLMNV  158

Query  533  PFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVA  378
            PFT  K ELE EF+KEAA  KMVQLKGHRSVGGMRASIYNAMPLAGVEKL++
Sbjct  159  PFTFEKSELEAEFVKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLIS  210



>ref|XP_001765721.1| predicted protein [Physcomitrella patens]
 gb|EDQ69560.1| predicted protein [Physcomitrella patens]
Length=430

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SSNFCSKP+DV+KFG+IY G QKN+GP+GV I I+RKDL+G  Q  TP+MLD+K H
Sbjct  239  VADVSSNFCSKPIDVSKFGVIYGGVQKNIGPAGVAIAIVRKDLLGKAQAQTPVMLDFKTH  298

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+SLYNTPP + IY+CGLVFEDLLAQGGL  VEK N++KA+ILY+AIDSSNGFY+CPV
Sbjct  299  ADNDSLYNTPPCFTIYVCGLVFEDLLAQGGLEAVEKSNIEKAQILYDAIDSSNGFYKCPV  358

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKSVRS MNVPFT+  PELE  F+KEAAA  MVQLKGHRSVGG+RASIYNAMP AGVEKL
Sbjct  359  EKSVRSCMNVPFTMGTPELEAAFLKEAAAQGMVQLKGHRSVGGVRASIYNAMPRAGVEKL  418

Query  383  VAFMKDFM  360
            VA MK F 
Sbjct  419  VALMKSFQ  426



>gb|EMT13315.1| Phosphoserine aminotransferase, chloroplastic [Aegilops tauschii]
Length=928

 Score =   310 bits (794),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV++FG+IYAGAQKNVGPSGV I I+RKDL+G+ QPITP+MLDYK H
Sbjct  736  VADMSSNFCSKPVDVSRFGLIYAGAQKNVGPSGVTIAIVRKDLVGSAQPITPVMLDYKTH  795

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN SLYNTPP + IY+CGLVFEDLLAQGGL EVEKKN  KA ILY+ ID+S G++ CPV
Sbjct  796  ADNASLYNTPPCFAIYICGLVFEDLLAQGGLAEVEKKNQHKAGILYDTIDASAGYFVCPV  855

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +K VRSLMNVPFTLAK  + E +FI EAA   M+QLKGHRSVGG+RASIYNAMPL+GVEK
Sbjct  856  DKPVRSLMNVPFTLAKGADSEKQFIAEAAKEGMLQLKGHRSVGGVRASIYNAMPLSGVEK  915

Query  386  LVAFMKDFMAKH  351
            LVAFMKDF A++
Sbjct  916  LVAFMKDFQARN  927



>ref|XP_002950741.1| hypothetical protein VOLCADRAFT_81234 [Volvox carteri f. nagariensis]
 gb|EFJ48056.1| hypothetical protein VOLCADRAFT_81234 [Volvox carteri f. nagariensis]
Length=404

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 160/193 (83%), Gaps = 1/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V+DMSSNF SKP+DV+K+G+IYAGAQKNVGP+GV IVIIR+DLIG+ +P  P MLDYKIH
Sbjct  211  VSDMSSNFISKPLDVSKYGLIYAGAQKNVGPAGVTIVIIREDLIGHCRPEAPTMLDYKIH  270

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+S+YNTPP + IY+CGLVFE LL  GGL  ++K N +KA +LY+AI SSNGFY  PV
Sbjct  271  VENDSMYNTPPCWSIYICGLVFEKLLKLGGLEAMQKLNEEKAAVLYDAIASSNGFYSSPV  330

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            + +VRSLMNVPFT+ ++P+LE  F+KEA    M+QLKGHRSVGGMRASIYNAMP+ GV++
Sbjct  331  DPAVRSLMNVPFTIPSQPDLEKVFVKEAEKAGMLQLKGHRSVGGMRASIYNAMPIEGVQQ  390

Query  386  LVAFMKDFMAKHG  348
            L  FMK+F AKH 
Sbjct  391  LATFMKEFAAKHA  403



>ref|WP_013030193.1| MFS transporter [Sideroxydans lithotrophicus]
 gb|ADE12295.1| phosphoserine aminotransferase [Sideroxydans lithotrophicus ES-1]
Length=360

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+PVDV KFG+IYAGAQKN+GP+G+ +VI+R+DL+G+  P  P MLDYK H
Sbjct  169  VADMSSNILSRPVDVWKFGLIYAGAQKNIGPAGLTLVIVREDLVGHADPRLPTMLDYKTH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP + IYM GLVF+ L   GG+G +E+ N+ KA++LY AID+SNGFY CPV
Sbjct  229  ADNESMYNTPPTFAIYMAGLVFQWLKKNGGIGAMERANIAKADLLYAAIDASNGFYNCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K+ RS MNVPFTL    L+G+F+K+A A  ++QLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  289  NKADRSRMNVPFTLKDANLDGDFLKQADARGLLQLKGHRSVGGMRASIYNAMPLEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V FM +F +KHG
Sbjct  349  VGFMNEFASKHG  360



>ref|XP_001690427.1| phosphoserine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP05686.1| phosphoserine aminotransferase [Chlamydomonas reinhardtii]
Length=405

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V+DMSSNF SKP+DV K+GIIYAGAQKNVGP+GV IVIIR+DLIG+ +   P MLDYKIH
Sbjct  212  VSDMSSNFISKPIDVAKYGIIYAGAQKNVGPAGVTIVIIREDLIGHCRAEAPTMLDYKIH  271

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             +N+S+YNTPP + +Y+CGLVFE L+  GGL  +++ N +KA ILY+AI  S GFY  PV
Sbjct  272  VENDSMYNTPPCWAVYVCGLVFEKLVKLGGLDAMQELNRQKAAILYDAIAESQGFYNSPV  331

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            + +VRSLMNVPFT+ + P+LE +FIKEA    M+QLKGHRSVGGMRASIYNAMP+ GV+K
Sbjct  332  DPAVRSLMNVPFTIPSSPDLEKQFIKEAEKAGMLQLKGHRSVGGMRASIYNAMPIEGVQK  391

Query  386  LVAFMKDFMAKHG  348
            L  FMK+F AKH 
Sbjct  392  LALFMKEFHAKHA  404



>ref|WP_028500150.1| MFS transporter [Microvirgula aerodenitrificans]
Length=359

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+PVDV++FG+I+AGAQKNVGP+G+ +VIIR+DL+G+ +P TP M DY++H
Sbjct  168  VCDMSSDFLSRPVDVSRFGLIFAGAQKNVGPAGLTLVIIREDLLGHVRPGTPTMFDYRVH  227

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y IYM GLVF+ L AQGGL  +  +N +KA +LY+AID+SNGFYRCPV
Sbjct  228  ADADSMYNTPPTYAIYMAGLVFKWLKAQGGLKGIAARNAEKAALLYQAIDASNGFYRCPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RS MNVPF L    LE +F++ AAA  +VQLKGHRSVGGMRASIYNAMPL GV  L
Sbjct  288  DKPYRSQMNVPFRLPSEALEAQFVESAAAAGLVQLKGHRSVGGMRASIYNAMPLEGVRTL  347

Query  383  VAFMKDFMAKHG  348
            V FM DF   +G
Sbjct  348  VRFMNDFARNNG  359



>ref|XP_005849811.1| hypothetical protein CHLNCDRAFT_142929 [Chlorella variabilis]
 gb|EFN57709.1| hypothetical protein CHLNCDRAFT_142929 [Chlorella variabilis]
Length=420

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 156/193 (81%), Gaps = 1/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V+DMSSNFCSKPVDV+K+G+IYAGAQKN+GP+GV IVI+R DLIGN +PITP+MLDY + 
Sbjct  228  VSDMSSNFCSKPVDVSKYGLIYAGAQKNIGPAGVTIVIVRDDLIGNARPITPVMLDYHVQ  287

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + + S+YNTPP + IYMCGL+F  +   GGL  +++ N KKA++LY+AI SSNGFY  PV
Sbjct  288  AGDKSMYNTPPCWAIYMCGLMFAKMRRDGGLMAMQQANEKKAKVLYDAIASSNGFYNSPV  347

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            + + RS MNVPFT+ + P+LE EFI +AA   M+QLKGHRSVGGMRASIYN+MPL GV++
Sbjct  348  DPAARSQMNVPFTIPSNPDLEKEFISQAAKLGMIQLKGHRSVGGMRASIYNSMPLGGVQQ  407

Query  386  LVAFMKDFMAKHG  348
            L +FM  F A+H 
Sbjct  408  LSSFMATFAAQHA  420



>ref|WP_035056842.1| MFS transporter [Andreprevotia chitinilytica]
Length=361

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 154/192 (80%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  SKPVD++KFG+IYAGAQKN+GPSG+ +VI+R+DL+G+ +P TP MLDYK+H
Sbjct  170  VCDMSSNILSKPVDISKFGLIYAGAQKNIGPSGLTLVIVREDLLGHARPGTPTMLDYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  SLYNTPP +GIY+ GLVF+ LLAQGGL  +E++N++KA +LYE IDSS+GFY CPV
Sbjct  230  ADGESLYNTPPTFGIYVAGLVFKWLLAQGGLKGIEQRNIEKASLLYETIDSSSGFYSCPV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPF LA   L+  F++E+ +  ++QLKGHRSVGGMRASIYNAM L GV+ L
Sbjct  290  EKPFRSRMNVPFCLADESLDDAFLEESKSRGLLQLKGHRSVGGMRASIYNAMTLDGVKAL  349

Query  383  VAFMKDFMAKHG  348
              FM+DF    G
Sbjct  350  ADFMRDFARSRG  361



>ref|WP_028446459.1| MFS transporter [Chitinimonas koreensis]
Length=362

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSNF S+PVDV+KFG+IY GAQKN+GP+G+ IVI+R+DL+G   P TP M DYKI 
Sbjct  171  VCDMSSNFLSRPVDVSKFGLIYGGAQKNIGPAGLTIVIVREDLLGQALPGTPTMFDYKIQ  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++ +S+YNTPP + IY+ GLVF+ +  QGGL  +E++N++KA +LYE ID+S GFY CPV
Sbjct  231  AEGDSMYNTPPTFAIYVAGLVFKWMQRQGGLKAIEQRNIEKAALLYETIDTSAGFYACPV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPF LA P L+  F+KEA A  ++QLKGHR++GGMRASIYNAMPL GV+ L
Sbjct  291  EKPFRSRMNVPFRLADPALDEAFVKEARARNLLQLKGHRAMGGMRASIYNAMPLEGVKAL  350

Query  383  VAFMKDFMAKHG  348
              FM+DF   HG
Sbjct  351  TVFMQDFARSHG  362



>ref|XP_011401170.1| Phosphoserine aminotransferase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM28157.1| Phosphoserine aminotransferase, chloroplastic [Auxenochlorella 
protothecoides]
Length=392

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 151/193 (78%), Gaps = 1/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSNFC++PVDV+K+G+IYAGAQKN+GP+GV IVI+R+DL+G  +  TP MLD+ + 
Sbjct  200  VVDMSSNFCARPVDVSKYGVIYAGAQKNIGPAGVTIVIVREDLLGRARASTPAMLDWSVA  259

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + + S+YNTPP + IYMCGLVF  +LA GGL  VE  N KKA+++Y+A+++SNGFY  PV
Sbjct  260  AKDGSMYNTPPCWSIYMCGLVFAHVLANGGLEAVEANNEKKAKLVYDAVEASNGFYASPV  319

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
             +  RSL NVPFT+ + P+LE  FI EAA   MVQLKGHRSVGGMRASIYN MPL GV+ 
Sbjct  320  AREARSLTNVPFTIPSSPDLEKAFIAEAAQAGMVQLKGHRSVGGMRASIYNFMPLEGVQT  379

Query  386  LVAFMKDFMAKHG  348
            L  FM++F A+H 
Sbjct  380  LADFMREFAARHA  392



>ref|WP_035384361.1| MFS transporter [Ferriphaselus sp. R-1]
Length=360

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+GV +VI+R DLIG     TP MLDYK H
Sbjct  169  VADMSSNILSRMLDVSKFGLIYAGAQKNIGPAGVTLVIVRDDLIGQVPTGTPTMLDYKTH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP YGIYM GLVF+ L   GG+  +E+ N+ KA++LY AID+SNGFY CPV
Sbjct  229  ADNESMYNTPPTYGIYMAGLVFQWLKKNGGIAAMEQANIAKADLLYGAIDASNGFYNCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPFTL    L+ EF+K+A    ++QLKGHRSVGGMRASIYNAMPLAGV+ L
Sbjct  289  NLADRSRMNVPFTLKDAALDSEFLKQADQHGLLQLKGHRSVGGMRASIYNAMPLAGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V FM  F  +HG
Sbjct  349  VDFMSQFAKRHG  360



>ref|WP_025869594.1| MFS transporter [Methylobacillus glycogenes]
Length=360

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 155/192 (81%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+  S+PVDV+KFG+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP MLDYKIH
Sbjct  170  VVDMSSHILSRPVDVSKFGLIYAGAQKNIGPAGLTIVIVREDLIGQTLPGTPTMLDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP YGIY+ GLVF+ L AQGGL  +EK+N++KA +LY+ +DSS+ FY  P+
Sbjct  230  ADNDSMYNTPPTYGIYIAGLVFKWLKAQGGLAAIEKRNIEKAALLYDYLDSSD-FYNSPI  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             +  RS MN+PFTL    L+ +F+K+A A  ++QLKGHR +GGMRASIYNAMP+ GV+ L
Sbjct  289  AEENRSRMNIPFTLKDSALDSDFLKQAQARGLLQLKGHRLLGGMRASIYNAMPIEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            +AFM++F   HG
Sbjct  349  LAFMQEFERSHG  360



>gb|KDD77082.1| class-V aminotransferase [Helicosporidium sp. ATCC 50920]
Length=370

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCS PV+V+KFG+IYAGAQKNVGP+G ++VI+RKDL+G  + ITP +L++   
Sbjct  178  VADMSSNFCSAPVEVSKFGLIYAGAQKNVGPAGTVVVIVRKDLVGAARSITPSVLEFGPM  237

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +   S+ NTPP + IY+CGLVFE LLA+GGL  V + N KKA++LY AID SNGFY+ PV
Sbjct  238  AKERSMLNTPPCWSIYVCGLVFEHLLARGGLQAVLEANQKKAQVLYNAIDGSNGFYKSPV  297

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
              + RSLMN PFT+  KPELE  F+ EAAA  MV+LKGHRSVGGMRASIYNAMP+  V+K
Sbjct  298  APAFRSLMNAPFTIPGKPELEAAFVSEAAALGMVELKGHRSVGGMRASIYNAMPIEAVQK  357

Query  386  LVAFMKDFMAKH  351
            L  FM DF  KH
Sbjct  358  LADFMADFAQKH  369



>ref|WP_028990081.1| MFS transporter [Thermithiobacillus tepidarius]
Length=360

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD SS+  SKPVDV+++G+IYAGAQKN+GP+G+ +VI+R+DL+G+    TP MLDYKI 
Sbjct  170  VADASSHILSKPVDVSRYGVIYAGAQKNIGPAGLTVVIVREDLLGHAPSGTPTMLDYKIQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP + IY+ GLVF+ L A+GGL E+E+ N++KA+ LY  I+ SN FY+ PV
Sbjct  230  ADNESMYNTPPTFAIYVAGLVFKWLKAKGGLAEMERINIRKAQKLYGLIE-SNDFYQSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPFTLA+PEL+  F+KEA A  +VQLKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  APANRSRMNVPFTLARPELDEAFLKEAKAHGLVQLKGHRSVGGMRASIYNAMPEAGVDAL  348

Query  383  VAFMKDFMAKHG  348
            VAFM+DF A+HG
Sbjct  349  VAFMQDFAARHG  360



>ref|WP_013293105.1| MFS transporter [Gallionella capsiferriformans]
 gb|ADL55165.1| phosphoserine aminotransferase [Gallionella capsiferriformans 
ES-2]
Length=360

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+K+G+IYAGAQKN+GP+G+ IVI+R+DLIG     TP MLDYK H
Sbjct  169  VADMSSCILSRPIDVSKYGLIYAGAQKNIGPAGLTIVIVREDLIGEVVAGTPTMLDYKTH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP YGIY+ GLVF+ L   GG+  +E+ N+ KA +LY AID+SNGFY CPV
Sbjct  229  ADNDSMYNTPPTYGIYIAGLVFKMLKRNGGIAAMEQTNIAKANLLYAAIDASNGFYNCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MN+PFTL    L+G F+K+A A  ++QLKGHRSVGGMRASIYNAMPLAGV  L
Sbjct  289  AIDNRSRMNIPFTLKDAALDGAFVKQAEARGLLQLKGHRSVGGMRASIYNAMPLAGVAAL  348

Query  383  VAFMKDFMAKHG  348
            V FM +F A +G
Sbjct  349  VEFMNEFAANNG  360



>ref|WP_028461331.1| MFS transporter [Nitrosomonas cryotolerans]
Length=364

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+P+DV  FG+IYAGAQKN+GP+G+ IVIIR+DL+G   P TP M DYK+H
Sbjct  174  VADMSSSMFSRPLDVASFGLIYAGAQKNMGPAGLTIVIIREDLLGMPIPGTPTMFDYKVH  233

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D++S+YNTPP Y +Y+ GLVFE L   GGL  +EK+N+ KA +LY+  D +N FY CPV
Sbjct  234  ADHDSMYNTPPTYALYITGLVFEWLKNLGGLAAIEKRNIAKANLLYDLFD-TNDFYHCPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             KS RS MNVPFTL  P L+ EF+K+A A  ++QLKGHRSVGGMRASIYNAMP+ GV KL
Sbjct  293  TKSDRSHMNVPFTLKNPALDSEFLKQAQAHGLIQLKGHRSVGGMRASIYNAMPIEGVMKL  352

Query  383  VAFMKDFMAKHG  348
            VAFMK+F + H 
Sbjct  353  VAFMKEFASNHA  364



>ref|WP_012638103.1| MFS transporter [Thioalkalivibrio sulfidiphilus]
 gb|ACL72620.1| phosphoserine aminotransferase [Thioalkalivibrio sulfidiphilus 
HL-EbGr7]
Length=360

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV++FG+IYAGAQKN+GP+G+ IVI+R+DLIG T   TP M DYK+H
Sbjct  170  VADMSSTILSRPVDVSRFGLIYAGAQKNIGPAGLTIVIVREDLIGETLAGTPTMFDYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP YG Y+ GLVF+ LL  GGL  + + N +KA  LY+AID S+ FY  PV
Sbjct  230  ADNDSMYNTPPTYGWYLAGLVFQWLLGLGGLKAMAQINERKARKLYDAIDGSD-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            + + RS MNVPFTLA P+L+GEF+KEAAA  +  LKGHRSVGGMRASIYNAMP AGV  L
Sbjct  289  DPACRSWMNVPFTLANPDLDGEFLKEAAALGLTTLKGHRSVGGMRASIYNAMPEAGVSAL  348

Query  383  VAFMKDFMAKHG  348
            V FM DF  + G
Sbjct  349  VDFMADFEQRKG  360



>ref|XP_005646896.1| phosphoserine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE22352.1| phosphoserine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=413

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNFCSKPVDV+K+G+IYAGAQKN+GP+GV++VI+R+DL+G+ +P TP+ LD+K  
Sbjct  224  VADMSSNFCSKPVDVSKYGLIYAGAQKNIGPAGVVVVIVREDLVGSARPETPVTLDFK--  281

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
                S+YNTPP + IY+CGLVF+ LLA GGL  V+  N  KA+++Y+AI+ SNGFY  PV
Sbjct  282  EMEGSMYNTPPCWSIYVCGLVFKHLLAAGGLPGVKANNDTKAKLVYDAIEGSNGFYASPV  341

Query  563  EKSVRSLMNVPFTL-AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            E SVRS MN+PFT+ + P LE  F+ EA+   MVQLKGHRSVGGMRAS+YN+MPL G + 
Sbjct  342  EPSVRSNMNIPFTIPSSPNLEKAFVSEASEQNMVQLKGHRSVGGMRASVYNSMPLEGAKA  401

Query  386  LVAFMKDFMAKH  351
            L AFM+DF ++H
Sbjct  402  LAAFMQDFASRH  413



>ref|WP_007191128.1| MFS transporter [Thiocapsa marina]
 gb|EGV20472.1| Phosphoserine aminotransferase [Thiocapsa marina 5811]
Length=360

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R+DL+G T   TP MLDYK+ 
Sbjct  170  VADMSSTILSRPIDVSRFGLIYAGAQKNIGPAGLTIVIVREDLLGQTLSGTPTMLDYKVQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y  Y+ GLVF+ L   GGL  + K N +KAE+LY+ ID S GF++ PV
Sbjct  230  ADNDSMYNTPPTYAWYLAGLVFDWLKGIGGLEAMGKINARKAELLYKTIDDS-GFFKNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E + RS MNVPFTLA PEL+  FIKEA A  +  LKGHRSVGGMRASIYNAMP  GVE L
Sbjct  289  EPASRSWMNVPFTLANPELDDTFIKEAKAANLTTLKGHRSVGGMRASIYNAMPQDGVEAL  348

Query  383  VAFMKDFMAKHG  348
            V FM++F  KHG
Sbjct  349  VGFMQEFERKHG  360



>ref|WP_018954052.1| MFS transporter [Thioalkalivibrio sp. ALJ17]
Length=360

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV++FG+IYAGAQKN+GP+G+ IVI+R+DLIG T   TP M DYK+H
Sbjct  170  VADMSSTILSRPVDVSRFGLIYAGAQKNIGPAGLTIVIVREDLIGETLAGTPTMFDYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP YG Y+ GLVF+ LL  GGL  + + N +KA  LY+AID S+ FY  PV
Sbjct  230  ADNDSMYNTPPTYGWYLAGLVFQWLLGLGGLKAMAQINERKARKLYDAIDGSD-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            + + RS MNVPFTLA P+L+GEF+KEAAA  +  LKGHRSVGGMRASIYNAMP AGV  L
Sbjct  289  DPACRSWMNVPFTLANPDLDGEFLKEAAALGLTTLKGHRSVGGMRASIYNAMPEAGVSAL  348

Query  383  VAFMKDFMAKHG  348
            V FM DF  +  
Sbjct  349  VDFMADFEQRRA  360



>ref|WP_027823401.1| MFS transporter [Laribacter hongkongensis]
Length=359

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+PVDV++FG+I+AGAQKN+GP+G+ +VI+R+DL+G T P TP M DYKIH
Sbjct  168  VCDMSSDFLSRPVDVSRFGLIFAGAQKNIGPAGLTLVIVREDLLGQTLPGTPTMFDYKIH  227

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y IYM GLVF+ L   GG+  ++ +N +KA +LY  IDSS+GFYRCPV
Sbjct  228  ADADSMYNTPPTYAIYMAGLVFQWLKDNGGVRGIQMRNEEKAGLLYHTIDSSDGFYRCPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNVPF L    LE  F+ EA    ++QLKGHRSVGG+RASIYNAMP  GV+ L
Sbjct  288  DVECRSRMNVPFRLRTEVLEKRFVDEADMAGLLQLKGHRSVGGVRASIYNAMPFEGVKAL  347

Query  383  VAFMKDFMAKHG  348
            VAFM +F  +HG
Sbjct  348  VAFMAEFARRHG  359



>gb|ABE49955.1| phosphoserine aminotransferase apoenzyme [Methylobacillus flagellatus 
KT]
Length=360

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+  S+PVDV+++G+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP M +YK+H
Sbjct  170  VVDMSSHILSRPVDVSQYGLIYAGAQKNIGPAGLTIVIVREDLIGETLPGTPTMFNYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y IY+ GLVF+ L A+GGL  +EK N++K+E+LY+ +DS++ FY  P+
Sbjct  230  ADNESMYNTPPTYSIYIAGLVFKWLKAKGGLAAIEKLNIEKSELLYDYLDSTD-FYNSPI  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MN+PFTL    L+ EF+K+A A  ++QLKGHR +GGMRASIYNAMPLAGV+ L
Sbjct  289  ALENRSRMNIPFTLKDSTLDAEFLKQAQARGLLQLKGHRLLGGMRASIYNAMPLAGVQAL  348

Query  383  VAFMKDFMAKHG  348
            VAFM+DF   HG
Sbjct  349  VAFMQDFERAHG  360



>dbj|GAO33827.1| phosphoserine aminotransferase [Ferriphaselus amnicola]
Length=360

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+G+ +VI+R DLIG     TP MLDYK H
Sbjct  169  VADMSSNILSRVIDVSKFGLIYAGAQKNIGPAGLTLVIVRDDLIGQVPAGTPTMLDYKTH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP + IYM GLVF+ L   GG+  +E+ N+ KA +LY AIDSSNGFY CPV
Sbjct  229  ADNDSMYNTPPTFAIYMAGLVFQWLKKSGGIAAMEQTNILKANLLYAAIDSSNGFYNCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPFTL    L+ +F+K+A A  ++QLKGHRSVGGMRASIYNAM + GV+ L
Sbjct  289  NHADRSRMNVPFTLKDAALDSDFLKQADARGLLQLKGHRSVGGMRASIYNAMTVEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V FM +F   HG
Sbjct  349  VEFMGEFAKSHG  360



>ref|WP_012697309.1| phosphoserine aminotransferase [Laribacter hongkongensis]
 sp|C1D8N3.1|SERC_LARHH RecName: Full=Phosphoserine aminotransferase; AltName: Full=Phosphohydroxythreonine 
aminotransferase; Short=PSAT [Laribacter 
hongkongensis HLHK9]
 gb|ACO74823.1| SerC [Laribacter hongkongensis HLHK9]
Length=359

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+PVDV++FG+I+AGAQKN+GP+G+ +VI+R+DL+G T P TP M DYKIH
Sbjct  168  VCDMSSDFLSRPVDVSRFGLIFAGAQKNIGPAGLTLVIVREDLLGQTLPGTPTMFDYKIH  227

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y IYM GLVF+ L   GG+  ++ +N +KA +LY  IDSS+GFYRCPV
Sbjct  228  ADADSMYNTPPTYAIYMAGLVFQWLKDNGGVRGIQMRNEEKAGLLYHTIDSSDGFYRCPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNVPF L    LE  F+ EA    ++QLKGHRSVGG+RASIYNAMP  GV+ L
Sbjct  288  DVECRSRMNVPFRLRTEVLEKRFVDEADMAGLLQLKGHRSVGGVRASIYNAMPFEGVKAL  347

Query  383  VAFMKDFMAKHG  348
            VAFM +F  +HG
Sbjct  348  VAFMAEFARRHG  359



>ref|WP_011381489.1| MFS transporter [Nitrosospira multiformis]
 gb|ABB75482.1| phosphoserine aminotransferase apoenzyme [Nitrosospira multiformis 
ATCC 25196]
Length=362

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS F S+P+DV++FG+IYAG QKNVGP+G+ IVI+R+DLIG T P TP M DYKIH
Sbjct  172  VADISSAFMSRPLDVSRFGLIYAGTQKNVGPAGLCIVIVREDLIGTTVPGTPTMFDYKIH  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y +Y+ GLV E L  +GGL  +EK N+ KA +LY+ +D+++ FY CPV
Sbjct  232  ADNDSMYNTPPTYAMYITGLVVEWLKQKGGLQAMEKINIAKARLLYDFLDTTD-FYHCPV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTL  P L+ EF+K+A    ++QLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  291  AKPDRSRMNVPFTLKDPGLDEEFLKQARTHGLIQLKGHRSVGGMRASIYNAMPLEGVKVL  350

Query  383  VAFMKDFMAKHG  348
            V FMK+F + H 
Sbjct  351  VEFMKEFASNHA  362



>ref|WP_028450922.1| MFS transporter [Chitinibacter tainanensis]
Length=361

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            + DMSSN  S+PVDV++FG+IYAGAQKN+GPSGV + I+R+DL+G  +P TP ML+Y   
Sbjct  170  ICDMSSNILSRPVDVSQFGMIYAGAQKNMGPSGVAVSIVREDLLGKARPETPTMLNYTTF  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP +GIY+ GLV++ +LAQGGL  +E  N+ KA I+Y AID+S GFYRCP 
Sbjct  230  ADNGSMYNTPPSFGIYVAGLVYKHVLAQGGLAAMEVHNIAKANIVYAAIDASAGFYRCPT  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MN+PFTLA  +L+  F++ A A  ++QLKGHRSVGGMRASIYNAMP+AG + L
Sbjct  290  ALADRSRMNIPFTLADSQLDAAFLQGAEARHLLQLKGHRSVGGMRASIYNAMPVAGCQAL  349

Query  383  VAFMKDFMAKHG  348
              +M++F  +HG
Sbjct  350  ADYMREFAQQHG  361



>ref|WP_025041175.1| MFS transporter [Nitrosospira briensis]
Length=364

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+F S+P+DV +FG+IYAGAQKNVGP+G+ IVI+R DL+G T P TP M DYKIH
Sbjct  174  VADMSSSFMSRPIDVARFGVIYAGAQKNVGPAGLCIVIVRDDLLGQTIPGTPTMFDYKIH  233

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y +Y+ GLV E L   GGL  +EK N+ KA +LY  +D+++ FY CPV
Sbjct  234  ADTDSMYNTPPTYAMYITGLVLEWLKKNGGLAAMEKVNVAKANLLYGLLDTTD-FYHCPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K+ RS MNVPFTL    L+ EF+K+A A  ++QLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  293  AKADRSRMNVPFTLKNAALDDEFLKQAKAHGLIQLKGHRSVGGMRASIYNAMPLEGVKVL  352

Query  383  VAFMKDFMAKHG  348
            V FMK F + H 
Sbjct  353  VEFMKKFASDHA  364



>ref|WP_013966810.1| MFS transporter [Nitrosomonas sp. Is79A3]
 gb|AEJ02583.1| Phosphoserine aminotransferase [Nitrosomonas sp. Is79A3]
Length=363

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+P+DVT+FG+IYAGAQKN+GP+G+ +VI+R+DL+G     TP + DY+IH
Sbjct  173  VADMSSNILSRPLDVTRFGLIYAGAQKNLGPAGLTLVIVREDLLGMPIAGTPTLYDYQIH  232

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + N+S+YNTPP Y +Y+ GLVF  L  QGGL  +EK N+ KA +LY+ +D+++  Y CPV
Sbjct  233  AKNDSMYNTPPTYAMYITGLVFAWLKKQGGLAAMEKINITKANLLYDLLDNTDS-YHCPV  291

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             +S RS MNVPFTL  PEL+GEF+K+A    ++QLKGHRSVGGMRASIYNAMP+ GV KL
Sbjct  292  TQSDRSRMNVPFTLKNPELDGEFLKQAEINGLIQLKGHRSVGGMRASIYNAMPIEGVAKL  351

Query  383  VAFMKDFMAKHG  348
             AFMK+F ++H 
Sbjct  352  AAFMKEFASQHA  363



>dbj|GAO36051.1| MFS transporter [Sulfuricella sp. T08]
Length=360

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S P+DV++FG+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP M DYK+H
Sbjct  170  VADMSSNILSSPLDVSRFGLIYAGAQKNIGPAGLCIVIVREDLIGQTLPGTPTMFDYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D+NS+YNTPP Y  Y+ GLVF+ L   GGL E++K+N  KA +LY  +DSS GFY CPV
Sbjct  230  ADHNSMYNTPPTYSFYIAGLVFKWLKRLGGLAELDKRNNAKAALLYGYLDSS-GFYHCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTL    L+ EF+K++ A  + QLKGHR +GGMRASIYN MPL GV+ L
Sbjct  289  AKGSRSRMNVPFTLKDAALDEEFLKQSKARGLAQLKGHRLLGGMRASIYNPMPLEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V FM++F  KHG
Sbjct  349  VDFMREFEQKHG  360



>ref|WP_002706803.1| MFS transporter [Thiothrix nivea]
 gb|EIJ32839.1| phosphoserine aminotransferase apoenzyme [Thiothrix nivea DSM 
5205]
Length=361

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV++FG+IYAGAQKN+GP+G+ IVI+R+DLIG T   TP M DYKIH
Sbjct  170  VADMSSTILSRPVDVSQFGLIYAGAQKNIGPAGLTIVIVREDLIGETIAGTPAMFDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y  Y+ GLVF+ +  QGGL  +   N +KA+ LY AI++S GFY  PV
Sbjct  230  ADNESMYNTPPTYAWYLAGLVFQWIKQQGGLTGMAAINERKAQKLYAAIEASGGFYNSPV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPFTLA  +L+  F+ EAA   +  LKGHRSVGGMRASIYNAMP AGVE L
Sbjct  290  AADCRSWMNVPFTLANADLDKPFLTEAAQAGLTTLKGHRSVGGMRASIYNAMPEAGVEAL  349

Query  383  VAFMKDFMAKHG  348
            V+FM+DF  K+G
Sbjct  350  VSFMQDFAQKNG  361



>ref|WP_041102150.1| MFS transporter [Sulfuritalea hydrogenivorans]
Length=360

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  SKPVDV+KFG+IYAGAQKN+GP+G+ IVIIR DL+G+ QP  P MLDYK H
Sbjct  170  VCDMSSNILSKPVDVSKFGLIYAGAQKNIGPAGLTIVIIRDDLVGHAQPTPPAMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             D  S+YNTPP Y IY+ GLVF+ L   GG+  +E++N+ KA +LY+ + +++ FYR PV
Sbjct  230  VDAESMYNTPPTYAIYIAGLVFQWLKKNGGVAAMERQNIAKANLLYDYLATTD-FYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTL    L+ EF+K A +  M QLKGHRSVGGMRASIYNAMP+AGVE L
Sbjct  289  RKEDRSRMNVPFTLKDAALDEEFLKGAKSRGMAQLKGHRSVGGMRASIYNAMPVAGVEAL  348

Query  383  VAFMKDFMAKHG  348
            VA+MK+F A+ G
Sbjct  349  VAYMKEFAAQKG  360



>dbj|BAO29785.1| phosphoserine aminotransferase [Sulfuritalea hydrogenivorans 
sk43H]
Length=362

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  SKPVDV+KFG+IYAGAQKN+GP+G+ IVIIR DL+G+ QP  P MLDYK H
Sbjct  172  VCDMSSNILSKPVDVSKFGLIYAGAQKNIGPAGLTIVIIRDDLVGHAQPTPPAMLDYKTH  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             D  S+YNTPP Y IY+ GLVF+ L   GG+  +E++N+ KA +LY+ + +++ FYR PV
Sbjct  232  VDAESMYNTPPTYAIYIAGLVFQWLKKNGGVAAMERQNIAKANLLYDYLATTD-FYRNPV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTL    L+ EF+K A +  M QLKGHRSVGGMRASIYNAMP+AGVE L
Sbjct  291  RKEDRSRMNVPFTLKDAALDEEFLKGAKSRGMAQLKGHRSVGGMRASIYNAMPVAGVEAL  350

Query  383  VAFMKDFMAKHG  348
            VA+MK+F A+ G
Sbjct  351  VAYMKEFAAQKG  362



>ref|WP_018747599.1| hypothetical protein [Chitiniphilus shinanonensis]
Length=356

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 151/192 (79%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  S+P+DV+KFG+IYAGAQKN+GPSG+ +VI+R+DL+G  +  TP MLDY++H
Sbjct  166  VCDMSSNILSRPLDVSKFGLIYAGAQKNIGPSGLTLVIVREDLLGRARAGTPTMLDYQVH  225

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++ +SLYNTPP Y IYM GLVF+ LL +GGL  +E+ N++KA +LYE +D+S GFY CPV
Sbjct  226  AEADSLYNTPPTYAIYMAGLVFKWLLERGGLSGIEQHNIEKASMLYETLDAS-GFYTCPV  284

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E+  RS MNVPF LA   L+  F++ A A  ++QLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  285  ERPYRSRMNVPFRLADERLDDPFLEGAKARGLLQLKGHRSVGGMRASIYNAMPLEGVKAL  344

Query  383  VAFMKDFMAKHG  348
              ++++F+  HG
Sbjct  345  CDYLREFVRTHG  356



>ref|WP_043109315.1| hypothetical protein [endosymbiont of unidentified scaly snail 
isolate Monju]
 dbj|BAN68978.1| phosphoserine aminotransferase [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=360

 Score =   248 bits (634),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+G+ +VI+R+DLIG      P+ML+Y  H
Sbjct  170  VADMSSTILSRPIDVSKFGLIYAGAQKNIGPAGLTLVIVREDLIGQAGEQVPVMLNYATH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N S+YNTPP YG Y+ GLVF+ L AQGGL ++ + N +KA +LY+ ID+S+ FY  PV
Sbjct  230  AENGSMYNTPPTYGWYLAGLVFQWLKAQGGLAKMAEINQRKAALLYDTIDNSD-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK+ RS MNVPFTLA P L+  F++EAAA  +  LKGHRS+GGMRASIYNAMP  GV  L
Sbjct  289  EKAYRSWMNVPFTLADPALDATFLEEAAAAGLKTLKGHRSIGGMRASIYNAMPEEGVRAL  348

Query  383  VAFMKDFMAKHG  348
            V FM DF  +HG
Sbjct  349  VDFMTDFERRHG  360



>ref|WP_005220268.1| MFS transporter [Marichromatium purpuratum]
 gb|AHF03249.1| MFS transporter [Marichromatium purpuratum 984]
Length=361

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R DL+G  Q  TP M DYK+H
Sbjct  171  VADMSSTLLSRPIDVSRFGLIYAGAQKNIGPAGLTIVIVRDDLLGQPQAATPTMFDYKVH  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y  Y+ GLVF+ L   GGLG + + N +KA +LY  ID+S+ FY  PV
Sbjct  231  ADADSMYNTPPTYAWYLAGLVFQWLRENGGLGAMAEINARKAALLYGTIDASD-FYHNPV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNV FTLA P L+G F++EAAA  +  LKGHR VGGMRASIYNAMP +GVE L
Sbjct  290  DPGSRSWMNVTFTLADPALDGRFLEEAAAAGLTALKGHRLVGGMRASIYNAMPESGVEAL  349

Query  383  VAFMKDFMAKHG  348
            VAFM++F  +HG
Sbjct  350  VAFMREFERRHG  361



>ref|WP_018231476.1| MFS transporter [Thioalkalivibrio thiocyanodenitrificans]
Length=360

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV+++G+IYAGAQKN+GP+G+ I I+R+DLIG   P TP M DYK H
Sbjct  170  VADMSSTILSRPVDVSRYGVIYAGAQKNIGPAGLTIAIVREDLIGEVVPSTPTMFDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +++ S+YNTPP YG Y+ GLVF+ LL  GGL  +   N +KAE LY AID S+ FY  PV
Sbjct  230  AESGSMYNTPPTYGWYLAGLVFKWLLGMGGLEAMAGINRRKAEKLYAAIDGSD-FYTNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPFTLA P+L+GEF+KEAAA  +  LKGHRSVGGMRASIYNAMP AGV  L
Sbjct  289  NPACRSWMNVPFTLANPDLDGEFLKEAAALGLTTLKGHRSVGGMRASIYNAMPEAGVSAL  348

Query  383  VAFMKDFMAKHG  348
            V FM DF  + G
Sbjct  349  VDFMADFEQRKG  360



>ref|WP_022654508.1| MFS transporter [Aquaspirillum serpens]
Length=361

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+P+D+ ++G+I+AGAQKN+GP+G+ +VI+R+DL+G   P TP M DY++H
Sbjct  169  VCDMSSDFLSRPIDINRYGLIFAGAQKNIGPAGLTVVIVREDLLGEVSPATPTMFDYRVH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S+YNTPP + IY+ GLVF+ LLAQGG+  +  +N +KA +LY+AI+ S GFY CPV
Sbjct  229  ADAESMYNTPPTFSIYIAGLVFKWLLAQGGIKGIAARNEEKAHLLYQAIEDSAGFYSCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E   RS MNVPF +    L+  F+++AA   +VQLKGHRSVGG+RASIYNAMP+ GV+ L
Sbjct  289  EAPFRSKMNVPFRIHDSALDALFLEQAADRGLVQLKGHRSVGGLRASIYNAMPIDGVKAL  348

Query  383  VAFMKDFMAKH  351
            V+FM DF ++H
Sbjct  349  VSFMHDFASRH  359



>ref|WP_013261107.1| MFS transporter [gamma proteobacterium HdN1]
 emb|CBL44608.1| Phosphoserine aminotransferase [gamma proteobacterium HdN1]
Length=360

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  S+P+DV ++G+IYAGAQKN+GP+G+ + I+R+DL+GN  P TP MLDYK H
Sbjct  170  VVDMSSNILSRPIDVNQYGLIYAGAQKNIGPAGLTVAIVREDLLGNAHPSTPTMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y  Y+ GLVF+ +  QGGLG +EK N  KAE LY  ID+S GFY+ PV
Sbjct  230  ADNGSMYNTPPTYAWYLAGLVFQWIQRQGGLGAIEKLNRAKAEKLYRFIDNS-GFYKNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RSLMNVPFTLA   L+  F++EA    ++ LKGHRSVGGMRASIYNA+P+A V+ L
Sbjct  289  AVANRSLMNVPFTLADASLDKSFLQEAEQRHLLNLKGHRSVGGMRASIYNAVPMAAVDAL  348

Query  383  VAFMKDFMAKHG  348
            + FM DF  + G
Sbjct  349  IDFMTDFQKRRG  360



>ref|XP_002499911.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61169.1| predicted protein [Micromonas sp. RCC299]
Length=397

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN+ SKP+DV K+GIIY G QKN+GP+G+ IVI+R+DLIG T P+ P M DYK+ 
Sbjct  206  VADMSSNYLSKPIDVEKYGIIYGGVQKNIGPAGMAIVIVREDLIGKTHPLCPTMFDYKLM  265

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP + +Y  GLVF+ L+  GGL  VEK N +KA+ILY+AID S+G+Y  PV
Sbjct  266  ADNDSMYNTPPCWTMYTSGLVFKKLIKMGGLEAVEKMNEEKAKILYDAIDGSDGYYNNPV  325

Query  563  EKSVRSLMNVPFTLAKPE-LEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +K  RSLMNVPFTL   E LE +F+KEAAA     LKGHRSVGG RASIYNAMP  GV+ 
Sbjct  326  DKKYRSLMNVPFTLGGGEDLEKKFLKEAAAAGFESLKGHRSVGGARASIYNAMPKEGVQA  385

Query  386  LVAFMKDFMAKH  351
            LV FM DF A +
Sbjct  386  LVDFMADFKAAN  397



>ref|WP_009206184.1| MFS transporter [Sulfuricella denitrificans]
 dbj|BAN34866.1| phosphoserine aminotransferase [Sulfuricella denitrificans skB26]
Length=360

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S P+DV++FG+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP M DYKIH
Sbjct  170  VADMSSNILSGPLDVSRFGLIYAGAQKNIGPAGLCIVIVREDLIGQTLPGTPTMFDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D++S+YNTPP + +Y+ GLVF+ L   GGL E++K+N  KA +LY  +DSS GFY CPV
Sbjct  230  ADHDSMYNTPPTFSLYIAGLVFKWLKRLGGLAEMDKRNNAKAALLYGYLDSS-GFYHCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTL    L+ EF+K++ +  + QLKGHR +GGMRASIYN MPL GV+ L
Sbjct  289  AKDSRSRMNVPFTLKDAALDEEFLKQSQSRGLAQLKGHRLLGGMRASIYNPMPLEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V FM++F  KHG
Sbjct  349  VDFMREFEQKHG  360



>ref|WP_028452427.1| MFS transporter [Chitinilyticum aquatile]
Length=364

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            + DMSSN  S+P+DV+++G+I+AGAQKN+GPSG+ + I+R+DLIG+ +P  P MLD+K H
Sbjct  173  ICDMSSNILSQPLDVSRYGVIFAGAQKNIGPSGMTLAIVREDLIGHARPDVPTMLDFKTH  232

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  SLYNTPP + IY+ GLVF+ L   GGL  + + N  KA ++Y+AID S GFYR PV
Sbjct  233  ADAGSLYNTPPTFAIYVAGLVFKWLQKNGGLEAMARHNAAKAALVYDAIDHSAGFYRAPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPF L    L+ EF+K A A  +VQLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  293  SGACRSRMNVPFWLKDAALDAEFLKGADAAGLVQLKGHRSVGGMRASIYNAMPLEGVQAL  352

Query  383  VAFMKDFMAKHG  348
            VA+M DF  +HG
Sbjct  353  VAYMNDFARRHG  364



>ref|WP_020395885.1| hypothetical protein [Thiothrix disciformis]
Length=360

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+P+DV +FG+IYAGAQKN+GP+G+ I I+R+DL+G   P TP +L+Y+I+
Sbjct  170  VADMSSNILSRPIDVARFGVIYAGAQKNIGPAGLTIAIVREDLLGKADPKTPNILNYQIY  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y  Y+ GLVFE LLAQGGL  +   N +KAE LY AID S+ FY  PV
Sbjct  230  ADNDSMYNTPPTYAWYIAGLVFEWLLAQGGLEAMAVLNERKAEKLYAAIDQSD-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RS MNVPFTL  P+ +  F+K+A    +V LKGHR VGGMRASIYNAMP AGV+ L
Sbjct  289  DKQYRSWMNVPFTLRDPQWDAVFLKQAEEAGLVTLKGHRQVGGMRASIYNAMPEAGVDAL  348

Query  383  VAFMKDFMAKHG  348
            ++FM+ F   HG
Sbjct  349  ISFMQQFEQAHG  360



>ref|WP_011110968.1| phosphoserine aminotransferase [Nitrosomonas europaea]
 sp|Q820S0.1|SERC_NITEU RecName: Full=Phosphoserine aminotransferase; AltName: Full=Phosphohydroxythreonine 
aminotransferase; Short=PSAT [Nitrosomonas 
europaea ATCC 19718]
 emb|CAD84244.1| Aminotransferase class-V:Phosphoserine aminotransferase [Nitrosomonas 
europaea ATCC 19718]
Length=368

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPI--TPIMLDYK  750
            VADMSSNF S+P DV+KFG+IYAGAQKNVGP+G+++VI+R+DL+ +  P+  TP M  YK
Sbjct  177  VADMSSNFLSRPFDVSKFGLIYAGAQKNVGPAGLVVVIVREDLL-DIPPLAGTPAMFRYK  235

Query  749  IHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRC  570
             H+DN S+YNTPP Y IY+ GLV E L  QGGL  +E++N+ KA+++Y+ ID S+ FY C
Sbjct  236  THADNASMYNTPPTYAIYIMGLVMEWLKKQGGLTAIEQRNIAKAKLIYDLIDVSS-FYHC  294

Query  569  PVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVE  390
            PV ++ RS MNVPFTL+ P L+  F+K+A A  ++QLKGHRSVGGMRASIYNAMPL GV+
Sbjct  295  PVNQADRSRMNVPFTLSDPGLDDAFLKQAQAHGLIQLKGHRSVGGMRASIYNAMPLEGVQ  354

Query  389  KLVAFMKDFMAKHG  348
             LV FM++F   H 
Sbjct  355  TLVTFMREFEKNHA  368



>ref|WP_028455614.1| MFS transporter [Chitinilyticum litopenaei]
Length=364

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            + DMSSN  S+P+DV+ +G+IYAGAQKN+GPSG+ I IIR DLIG+ +   P ML+YK H
Sbjct  173  ICDMSSNILSQPLDVSHYGLIYAGAQKNIGPSGMTIAIIRDDLIGHARADVPTMLNYKTH  232

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  SLYNTPP + IY+ GLVF+ L   GGL  + + N  KA ++Y+AID+S+GFYR PV
Sbjct  233  ADAGSLYNTPPSFAIYVAGLVFKWLQKNGGLEAMARHNATKAALVYDAIDNSDGFYRAPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MNVPF L    L+ +F+K A A  +VQLKGHRSVGGMRASIYNAMPL GV+ L
Sbjct  293  SGAARSRMNVPFWLKDAALDADFLKGAEAAGLVQLKGHRSVGGMRASIYNAMPLEGVQAL  352

Query  383  VAFMKDFMAKHG  348
            VA+M DF  +HG
Sbjct  353  VAYMADFARRHG  364



>ref|WP_004179773.1| Phosphoserine aminotransferase [Nitrosospira sp. APG3]
 emb|CCU63400.1| Phosphoserine aminotransferase [Nitrosospira sp. APG3]
Length=364

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS F S+P+D+T+FG+IYAGAQKN GP+G+ +VI+R+DL+G T   TP M DYKIH
Sbjct  174  VADISSTFMSRPLDITRFGLIYAGAQKNFGPAGLTVVIVREDLLGTTLAGTPTMFDYKIH  233

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y +Y+ GLV E L  +GGL  +E+ N+ KA++LY+ +D+++ FY CPV
Sbjct  234  ADNDSMYNTPPTYPMYIAGLVLEWLKKKGGLAAMEQINIAKAKLLYDMLDTTD-FYHCPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             +S RS MNVPFTL    L+  F+K+A +  ++QLKGHRSVGGMRASIYNAMPL GV  L
Sbjct  293  ARSDRSRMNVPFTLKDSALDDAFLKQAKSRGLIQLKGHRSVGGMRASIYNAMPLEGVAVL  352

Query  383  VAFMKDFMAKHG  348
            V FMK+F + H 
Sbjct  353  VEFMKEFASNHA  364



>ref|WP_028311002.1| MFS transporter [Derxia gummosa]
Length=366

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+PVDV+++G+IYAGAQKN+GP+G+ IVI+R DLIG  +P TP M DYK+ 
Sbjct  176  VADMSSHIVSRPVDVSRYGLIYAGAQKNIGPAGITIVIVRDDLIGKARPDTPRMFDYKLM  235

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+SL NTPP +GIY+ GLVF+ L  QGG+  +E+KN+ KAE+LY  +DS + FY  PV
Sbjct  236  ADNHSLLNTPPTFGIYLAGLVFKWLKRQGGVEAIERKNIAKAELLYGYLDSQD-FYYAPV  294

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPF L    L  +F+ E  A  +V LKGH++VGGMRASIYNAMP+ GV+ L
Sbjct  295  EKGSRSRMNVPFRLKDESLNAKFLAETEAAGLVALKGHKAVGGMRASIYNAMPMEGVQAL  354

Query  383  VAFMKDFMAKHG  348
            VAFM+DF A++G
Sbjct  355  VAFMRDFAARNG  366



>gb|AJP48508.1| MFS transporter [Rhodocyclaceae bacterium PG1-Ca6]
Length=364

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  S+PVD++K+G+IYAGAQKN+GP+G+ +VI+R+DLIG   P    MLDYK H
Sbjct  174  VCDMSSNILSQPVDISKYGLIYAGAQKNIGPAGLTLVIVREDLIGQAVPQPQTMLDYKTH  233

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y IY+ GLVF+ L  QGGL  ++K N +KA ILY+ +D S+ FY  PV
Sbjct  234  ADNDSMYNTPPTYAIYIAGLVFQWLKRQGGLTAMQKINAEKAGILYDYLDRSS-FYSNPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RSLMNVPFTL    L+  FIK A A  MVQLKGHRSVGGMRASIYNAMP+ GV+KL
Sbjct  293  RIEDRSLMNVPFTLKDAALDDAFIKGAQAQGMVQLKGHRSVGGMRASIYNAMPIEGVKKL  352

Query  383  VAFMKDFMAKHG  348
            VA+M++F   HG
Sbjct  353  VAYMEEFAITHG  364



>ref|WP_012824206.1| MFS transporter [Halothiobacillus neapolitanus]
 gb|ACX96172.1| phosphoserine aminotransferase [Halothiobacillus neapolitanus 
c2]
Length=363

 Score =   243 bits (619),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV+KFGIIYAGAQKN+GPSG+ I I+R DLIG+     P M DYKIH
Sbjct  172  VADMSSTILSRPVDVSKFGIIYAGAQKNIGPSGLTIAIVRDDLIGHAGADVPAMFDYKIH  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y  Y+ GLVF+ LLA GGL ++++ N +KA  LY AID S GFYR PV
Sbjct  232  ADNGSMYNTPPTYAWYIAGLVFKRLLANGGLEQMKQINERKANKLYAAIDQSGGFYRNPV  291

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MN+PF L    L+  F+ EA    +  L GHRSVGGMRASIYNAMP AG++ L
Sbjct  292  ALNARSWMNIPFILKDDALDKPFLAEADKAGLSALAGHRSVGGMRASIYNAMPEAGIDAL  351

Query  383  VAFMKDFMAKHG  348
            +AFM DF  +HG
Sbjct  352  IAFMHDFAQRHG  363



>ref|WP_028488900.1| MFS transporter [Thiothrix lacustris]
Length=361

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 141/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+G+ IVI+R DLIG T P TP M DYKIH
Sbjct  170  VADMSSTILSRPLDVSKFGLIYAGAQKNIGPAGLTIVIVRDDLIGETLPGTPTMFDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTP  Y  Y+ GLVF+ +  QGGL  +   N +KA+ LY AI++S GFY  PV
Sbjct  230  ADNESMYNTPATYSWYLAGLVFKWIKQQGGLAGMATLNQRKAQKLYTAIETSGGFYHSPV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPF LA  EL+  F+ EAA   ++ LKGHR  GGMRAS+YNAMP AGV+ L
Sbjct  290  APDCRSWMNVPFILANAELDKSFLSEAAQQGLMTLKGHRLFGGMRASLYNAMPEAGVDTL  349

Query  383  VAFMKDFMAKHG  348
            V+FM+DF  K+G
Sbjct  350  VSFMQDFAKKNG  361



>ref|WP_013647094.1| MFS transporter [Nitrosomonas sp. AL212]
 gb|ADZ26034.1| phosphoserine aminotransferase [Nitrosomonas sp. AL212]
Length=363

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+P+D+T+FG+IYAGAQKN+GP+G+ +V++R+DL+G     TP + DY+IH
Sbjct  173  VADMSSDILSRPLDITRFGLIYAGAQKNLGPAGLTLVVVREDLLGQPLTGTPTLYDYQIH  232

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + N+S+YNTPP Y +Y+ GLVF  L  +GGL  +EK N+ KA +LY+ +D  N FY CPV
Sbjct  233  AQNDSMYNTPPTYAMYITGLVFAWLKNKGGLMMMEKINITKANLLYDLLD-HNDFYHCPV  291

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             KS RS MNVPFTL  P L  EF+K+A    ++QLKGHRSVGGMRASIYNAMP+ GV KL
Sbjct  292  AKSDRSRMNVPFTLRNPALNEEFLKQADNNGLIQLKGHRSVGGMRASIYNAMPVEGVTKL  351

Query  383  VAFMKDFMAKHG  348
            VAFM +F ++H 
Sbjct  352  VAFMNEFASQHA  363



>ref|WP_012971183.1| MFS transporter [Allochromatium vinosum]
 gb|ADC62910.1| phosphoserine aminotransferase [Allochromatium vinosum DSM 180]
Length=360

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 5/194 (3%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPI--TPIMLDYK  750
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+G+ IVI+R+DLIG  QPI  TP MLDYK
Sbjct  170  VADMSSTILSRPIDVSKFGLIYAGAQKNIGPAGLTIVIVREDLIG--QPINGTPTMLDYK  227

Query  749  IHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRC  570
            IH+DN+S+YNTPP Y  Y+ GLVF+ L   GGL  +   N +KA  LY+ ID+S+ FY  
Sbjct  228  IHADNDSMYNTPPTYAWYLAGLVFKWLKDMGGLAAMADVNARKARKLYDVIDASS-FYAN  286

Query  569  PVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVE  390
            PV  + RS MNVPFTLA  EL+  F+KEA A  +  LKGHRSVGGMRASIYNAMP AGV+
Sbjct  287  PVAPTDRSWMNVPFTLANAELDEVFLKEAKAAGLTTLKGHRSVGGMRASIYNAMPEAGVD  346

Query  389  KLVAFMKDFMAKHG  348
             LVAFM++F  ++G
Sbjct  347  ALVAFMQEFERRNG  360



>ref|WP_041512774.1| MFS transporter [Nitrosospira sp. NpAV]
 gb|KIO50016.1| MFS transporter [Nitrosospira sp. NpAV]
Length=364

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS F S+P+D+TKFG+IYAGAQKN GP+G+ +VI+R+DL+G+    TP M DYKIH
Sbjct  174  VADISSTFMSRPLDITKFGLIYAGAQKNFGPAGLTVVIVREDLLGSPLAGTPTMFDYKIH  233

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y +Y+ GLV E L  +GGL  +EK N+ KA++LY+ +D+++ FY CPV
Sbjct  234  ADNDSMYNTPPTYPMYIAGLVLEWLKKKGGLPAMEKINIAKAKLLYDFLDTTD-FYHCPV  292

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             KS RS MNVPFTL    L+  F+K+A +  ++QLKGHRSVGGMRASIYNAMPL GV  L
Sbjct  293  AKSDRSRMNVPFTLKDAALDEAFLKQAKSRGLIQLKGHRSVGGMRASIYNAMPLEGVAVL  352

Query  383  VAFMKDFMAKHG  348
            V FMK+F + H 
Sbjct  353  VEFMKEFASHHA  364



>ref|XP_007510965.1| phosphoserine aminotransferase [Bathycoccus prasinos]
 emb|CCO66525.1| phosphoserine aminotransferase [Bathycoccus prasinos]
Length=445

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD SSN+ SKP+DV K+GIIY G QKN+  +G+ I IIR+DLIGN  P TP MLD+  H
Sbjct  253  VADHSSNYLSKPIDVNKYGIIYGGVQKNIACAGMGIAIIREDLIGNAAPNTPTMLDFSTH  312

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S+N S+YNTPP Y  Y+ GLVF  LL++GGL  +EK+N +KA++LY+ ID+S G+Y CP 
Sbjct  313  SENESMYNTPPCYTWYISGLVFAKLLSEGGLSAMEKRNQEKAKVLYDTIDASAGYYNCPT  372

Query  563  EKSVRSLMNVPFTLAK-PELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +   RS+MNVPFTLAK  ++E +F+KEA+      LKGHRSVGG RASIYNAMP  GVE 
Sbjct  373  DLKYRSMMNVPFTLAKGGDVEKQFLKEASDAGFESLKGHRSVGGARASIYNAMPKEGVEA  432

Query  386  LVAFMKDFMAKH  351
            L AFMKDF +++
Sbjct  433  LAAFMKDFQSRN  444



>ref|WP_025281596.1| MFS transporter [Ectothiorhodospira haloalkaliphila]
 gb|AHK79155.1| MFS transporter [Halorhodospira halochloris str. A]
Length=360

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+P+DV+++G+IYAGAQKN+GP+G+ +VI+R DLIGN  P  P +LDYKI 
Sbjct  170  VADMSSNILSRPIDVSRYGVIYAGAQKNIGPAGLTLVIVRDDLIGNPMPGLPSILDYKIQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+ NTPP YG Y+ GLVF+ L   GGL  +E+ N +KAE LY AID+S  FY  PV
Sbjct  230  ADADSMSNTPPTYGWYLAGLVFQWLKELGGLEAMEQINRRKAEKLYTAIDNS-AFYHNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RSLMNVPFTLA  EL+G F+KEA    +  LKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  EVSARSLMNVPFTLADAELDGLFLKEAEQAGLTTLKGHRSVGGMRASIYNAMPEAGVDAL  348

Query  383  VAFMKDF  363
            V FM DF
Sbjct  349  VEFMVDF  355



>ref|WP_012348025.1| MFS transporter [Leptothrix cholodnii]
 gb|ACB35274.1| phosphoserine aminotransferase [Leptothrix cholodnii SP-6]
Length=360

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+PVDV+K+ +IY GAQKN+GP+G+ IVI+R+DL+G   PITP + D+K  
Sbjct  170  VADMSSNLLSRPVDVSKYALIYGGAQKNIGPAGLTIVIVREDLLGQALPITPSVFDFKEQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+ NTPP Y IYM GLVF  + AQGGL  +E  N +KA +LY+ +D+S  F+  PV
Sbjct  230  ADNDSMLNTPPTYAIYMAGLVFNWIKAQGGLVAMEAHNRQKAALLYDFLDASK-FFSSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             ++ RSLMNVPF L    L+ EF+K A A  M+QLKGHRSVGGMRASIYNAMP+ GV+ L
Sbjct  289  ARADRSLMNVPFKLRDESLDAEFLKGAQARGMLQLKGHRSVGGMRASIYNAMPIEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            VA++K+F A+HG
Sbjct  349  VAYLKEFEARHG  360



>ref|WP_006786484.1| MFS transporter [Thiorhodospira sibirica]
 gb|EGZ49602.1| Phosphoserine aminotransferase [Thiorhodospira sibirica ATCC 
700588]
Length=362

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ +VI+R+DL+G   P TP  L+Y++ 
Sbjct  172  VADMSSTILSRPLDVSRFGLIYAGAQKNIGPAGLAVVIVREDLLGQALPATPTFLNYQVQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N+S+YNTPP Y  Y+ GLVF+ L AQGGL  + + N +KA  LY AID S GFY  PV
Sbjct  232  AENDSMYNTPPTYSWYLAGLVFKWLKAQGGLEAMGQINQRKAAKLYAAIDGS-GFYHNPV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MN+PFTLA PEL+GEF+ +A    +V LKGHRSVGGMRASIYNA+P AGV+ L
Sbjct  291  RLDGRSWMNIPFTLANPELDGEFLSQAKQAGLVALKGHRSVGGMRASIYNALPEAGVDAL  350

Query  383  VAFMKDFMAKHG  348
            +AFM +F   HG
Sbjct  351  IAFMAEFERTHG  362



>ref|WP_041068347.1| hypothetical protein [Thiolapillus brandeum]
 dbj|BAO45045.1| phosphoserine aminotransferase [Thiolapillus brandeum]
Length=358

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFGIIYAGAQKNVGP+G+ +VIIR+DLIG+     P M++Y+IH
Sbjct  168  VADMSSTILSRPIDVSKFGIIYAGAQKNVGPAGLTLVIIREDLIGHAPDSCPAMMNYRIH  227

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y  Y+ GLVF+ L   GGL  +   N +KAE LY A+D+S+ FY  PV
Sbjct  228  ADADSMYNTPPTYAWYLAGLVFQWLKNNGGLEAMAVINERKAEELYAAVDASD-FYANPV  286

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNVPFTLA PEL+G+F++EAAA  M  LKGHRSVGGMRASIYNAMP  GV+ L
Sbjct  287  DPECRSWMNVPFTLADPELDGKFLEEAAAKGMKSLKGHRSVGGMRASIYNAMPEEGVQAL  346

Query  383  VAFMKDFMAKHG  348
            + FMKDF  ++ 
Sbjct  347  IEFMKDFEQRNA  358



>ref|WP_026685515.1| MFS transporter [Azovibrio restrictus]
Length=374

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 146/191 (76%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+PVDV+++G+IYAGAQKN+GPSGV +VI+R+DL+G      P ++DY++ 
Sbjct  183  VADMSSHILSRPVDVSRYGLIYAGAQKNIGPSGVTLVIVREDLLGRAPAGIPTVMDYQVM  242

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+ NTPP + IY+ GLVF+ L  QGGL  ++  N +KAE++Y AID+S GFY+ PV
Sbjct  243  ADNGSMLNTPPTFAIYVAGLVFQWLKRQGGLAGMQAINREKAELVYAAIDASQGFYKNPV  302

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MN+PFTLAKPEL+  F+ EA A  ++ LKGH+SVGGMRASIYNAMPL GV  L
Sbjct  303  AADCRSCMNIPFTLAKPELDKPFLAEAQAAGLLGLKGHKSVGGMRASIYNAMPLDGVRAL  362

Query  383  VAFMKDFMAKH  351
            V FM DF AK+
Sbjct  363  VHFMNDFAAKN  373



>ref|WP_020530574.1| hypothetical protein [Flexithrix dorotheae]
Length=359

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+  DV+KFGIIYAGAQKN+GP+G+ IVIIR+DLIG     TP ML+YK H
Sbjct  170  VADMSSNILSQEYDVSKFGIIYAGAQKNIGPAGLTIVIIREDLIGKALDFTPTMLNYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S++NTPP Y IYM GLVFE  L +GGL  +EK N +KA +LY  +DSS+  ++  V
Sbjct  230  ADNDSMFNTPPCYSIYMAGLVFEWALEKGGLKSIEKINKEKAGLLYNYLDSSS-LFKATV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E   RSLMNVPF     EL+ +FI EAAA  +  LKGHRSVGGMRASIYN+MP+ GV+ L
Sbjct  289  EPKFRSLMNVPFVTGNDELDAKFISEAAANNLTTLKGHRSVGGMRASIYNSMPMEGVKAL  348

Query  383  VAFMKDFMAKH  351
            V FMKDF +++
Sbjct  349  VDFMKDFESRN  359



>ref|WP_013442376.1| MULTISPECIES: MFS transporter [Methylovorus]
 gb|ACT50779.1| phosphoserine aminotransferase [Methylovorus glucosetrophus SIP3-4]
 gb|ADQ84754.1| phosphoserine aminotransferase [Methylovorus sp. MP688]
Length=360

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+  S+P+DV+++G+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP MLDYKIH
Sbjct  170  VCDMSSHILSRPIDVSRYGLIYAGAQKNIGPAGLTIVIVREDLIGETLPGTPTMLDYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP YGIY+ GLVF+ L A GGL  +E+ N++KA +LY+ I SS+  Y  P+
Sbjct  230  ADNDSMYNTPPTYGIYIAGLVFKWLKANGGLAAMEQLNIRKAAMLYDYIASSS-LYVSPI  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPFTL    L+ EF+K+A    ++QLKGH+ VGGMRASIYNAMP+ GV+ L
Sbjct  289  APDNRSRMNVPFTLRNTALDAEFLKQAQQRGLLQLKGHKLVGGMRASIYNAMPIEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            V+FM++F    G
Sbjct  349  VSFMQEFERAQG  360



>emb|CEF97174.1| Phosphoserine aminotransferase [Ostreococcus tauri]
Length=411

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN+ SKP+DV+K+G+IY G QKN+GP+G+ I I+R DLIGN +P TP M DYK+ 
Sbjct  219  VADMSSNYLSKPIDVSKYGVIYGGVQKNIGPAGLGICIVRDDLIGNVRPDTPSMFDYKLM  278

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTP  +  Y+ GLVF  L+  GGL  +E++N++KA +LY AIDSS G+Y  PV
Sbjct  279  ADNDSMYNTPSCFTWYVSGLVFAKLIKDGGLEAMEQRNIEKANVLYNAIDSSGGYYVNPV  338

Query  563  EKSVRSLMNVPFTLA-KPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +K  RSLMNVPFTLA   ELE +F+ EA       LKGHRSVGG RASIYNAMP  GVE 
Sbjct  339  DKKYRSLMNVPFTLAGGEELEKKFLAEAKEEGFEALKGHRSVGGARASIYNAMPKEGVEA  398

Query  386  LVAFMKDFMAKH  351
            LV+FMKDF A++
Sbjct  399  LVSFMKDFQARN  410



>ref|WP_020508015.1| MFS transporter [Lamprocystis purpurea]
Length=360

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVD+ +FG+IYAGAQKN+GP+G+ IVI+R+DLIG     TP MLDY+ +
Sbjct  170  VADMSSTLLSRPVDIQRFGLIYAGAQKNIGPAGLTIVIVREDLIGQPLTGTPTMLDYQTY  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y  Y+ GLVF+ L   GGL  +   N +KA+ LY AID+S GFY  PV
Sbjct  230  ADNESMYNTPPTYAWYLAGLVFQWLKGLGGLDAMAVINARKAQHLYAAIDAS-GFYTNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPFTL  P+L+  FIK A A  +  LKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  SPESRSWMNVPFTLPSPDLDDAFIKGAKAAGLTTLKGHRSVGGMRASIYNAMPEAGVQAL  348

Query  383  VAFMKDFMAKHG  348
            VAFM++F  KHG
Sbjct  349  VAFMQEFERKHG  360



>ref|WP_018988948.1| MFS transporter [Azoarcus toluclasticus]
Length=365

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+P DV+++G+IYAGAQKN+GPSG++IVI+R DL+G   P+TP ++DYK+ 
Sbjct  175  VADMSSHILSRPTDVSRYGLIYAGAQKNIGPSGLIIVIVRDDLLGRASPLTPTVMDYKVM  234

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+ NTPP YGIY+ GLVF+ L AQGGL  +E++N++KA +LY+ ID S GFYR  V
Sbjct  235  ADNGSMLNTPPTYGIYVAGLVFQWLKAQGGLAAMERRNIEKAALLYDFIDVS-GFYRNTV  293

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E   RS MNVPF L    L   F+  A A  + QLKGH+SVGGMRASIYNAMP+ GV  L
Sbjct  294  EVGSRSRMNVPFLLRDEALNDAFLAGAKAAGLTQLKGHKSVGGMRASIYNAMPIEGVRAL  353

Query  383  VAFMKDFMAKHG  348
            V +M+ F A+HG
Sbjct  354  VDYMRGFAAQHG  365



>ref|WP_011634622.1| MFS transporter [Nitrosomonas eutropha]
 gb|ABI59816.1| phosphoserine aminotransferase apoenzyme [Nitrosomonas eutropha 
C91]
Length=368

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 147/192 (77%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VADMSSNF S+P DV+KFG+IYAGAQKNVGP+G++IVIIR+DL+     P TP M  YK 
Sbjct  177  VADMSSNFLSRPFDVSKFGLIYAGAQKNVGPAGLVIVIIREDLLAIPPLPRTPTMYRYKT  236

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  S+YNTPP Y IY+ GLV E L  QGGL  +E++N+ KA+++Y+ ID+S+ FY CP
Sbjct  237  HADQASMYNTPPTYAIYIMGLVMEWLKKQGGLVAIEQRNIAKAKLIYDLIDASS-FYHCP  295

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V +S RS MN+PFTL+   L+  F+K+A A  ++QLKGHRSVGGMRASIYNAMPL GV+ 
Sbjct  296  VSRSDRSRMNIPFTLSDSGLDEVFLKQAQAHGLLQLKGHRSVGGMRASIYNAMPLEGVQT  355

Query  386  LVAFMKDFMAKH  351
            L  FM++F   H
Sbjct  356  LATFMREFEKNH  367



>gb|KGM06139.1| Phosphoserine aminotransferase [Methylophaga thiooxydans]
Length=342

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV++FG+IYAGAQKN+GP+G+ IVIIRKDL+G+  P TP ML+Y+ H
Sbjct  152  VADLSSTILSRPIDVSRFGMIYAGAQKNIGPAGLCIVIIRKDLMGDVLPGTPTMLNYQTH  211

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S++NTP  Y  Y+ GLVFE L  QGGL  + + N +KA+ LY+ IDSS  FY  PV
Sbjct  212  ADNDSMFNTPATYSWYLAGLVFEWLKQQGGLAAMAEINKRKADKLYQVIDSSE-FYANPV  270

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RS MNVPFTLA  +L+  F+++AA   ++ LKGHR VGGMRASIYNAMP +GV+ L
Sbjct  271  DKRYRSWMNVPFTLADDKLDKVFVQQAAQQHLLTLKGHRDVGGMRASIYNAMPESGVDAL  330

Query  383  VAFMKDFMAKHG  348
            +AFM +F  +HG
Sbjct  331  IAFMNEFERQHG  342



>ref|WP_027469352.1| MFS transporter [Deefgea rivuli]
Length=361

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            + DMSSN  S+PV+V +FG+IYAGAQKN+GPSGV + I+R+DL+G  +  TP ML+YK +
Sbjct  170  ICDMSSNILSRPVNVNQFGMIYAGAQKNMGPSGVAMSIVREDLLGKARSDTPTMLNYKTY  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP +GIY+ GL+F+ +L QGGL  +E+KN+ KA ++Y AID+SNGFY CP 
Sbjct  230  ADNGSMYNTPPSFGIYVAGLIFKYVLKQGGLAAMEQKNIAKANVIYSAIDASNGFYHCPT  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MN+PFTLA   L+ EF+  A A  ++QLKGHRSVGGMRASIYNAM L G + L
Sbjct  290  AAANRSRMNIPFTLADSNLDKEFLAGAEARHLLQLKGHRSVGGMRASIYNAMSLQGCQVL  349

Query  383  VAFMKDFMAKHG  348
              +M +F    G
Sbjct  350  ADYMNEFARTKG  361



>ref|XP_001416687.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94980.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=394

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN+ SKP++V K+GIIY G QKN+GP+G+ I I+R+DL+GNT+  TP M DYK+ 
Sbjct  202  VADMSSNYLSKPIEVEKYGIIYGGVQKNIGPAGMGIAIVREDLMGNTRADTPSMFDYKLM  261

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +  Y+ GLVF  LL  GGL  +E++N++KA +LY AID S G+Y  PV
Sbjct  262  ADNDSMYNTPPCFTWYVSGLVFAKLLKDGGLKAMEQRNIEKANVLYGAIDGSGGYYVSPV  321

Query  563  EKSVRSLMNVPFTLA-KPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +   RSLMNVPFTLA   ELE +F+ EA A     LKGHRSVGG RASIYNAMP  GVE 
Sbjct  322  DTKYRSLMNVPFTLAGGEELEKKFLAEAKAEGFEALKGHRSVGGARASIYNAMPKEGVEA  381

Query  386  LVAFMKDFMAKH  351
            LV+FMKDF A++
Sbjct  382  LVSFMKDFQARN  393



>ref|WP_009550046.1| MFS transporter [Burkholderiales bacterium JOSHI_001]
 gb|EHR70910.1| phosphoserine aminotransferase [Burkholderiales bacterium JOSHI_001]
Length=360

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SSN  S+P+DVTK+G++Y GAQKN+GP+G+ IVI+R DLIG      P   DYK  
Sbjct  170  VADVSSNILSRPMDVTKYGLLYGGAQKNIGPAGLTIVIVRDDLIGQAMACCPTAFDYKQV  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y IY+ GLVF+ +  +GGL  +E  N KKA ILY+ +DS+ GFY  P+
Sbjct  230  ADNDSMYNTPPTYAIYIAGLVFQWIKQRGGLVAMEAHNRKKAAILYDYLDST-GFYSNPI  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KS RSLMNVPF L   +L+  F+K A A  MVQLKGHRSVGGMRASIYNAMP+ GV+ L
Sbjct  289  DKSARSLMNVPFKLKDEKLDEAFLKGAQARGMVQLKGHRSVGGMRASIYNAMPIEGVQAL  348

Query  383  VAFMKDFMAKHG  348
            VA+MK+F A HG
Sbjct  349  VAYMKEFEASHG  360



>ref|WP_008735063.1| MFS transporter [Alcanivorax pacificus]
 gb|AJD48559.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Alcanivorax 
pacificus W11-5]
Length=359

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+       P ML YK+H
Sbjct  169  VADLSSTILSRPLDVSKFGLIYAGAQKNIGPAGVCVVIVRKDLLERAGDQVPTMLRYKVH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N S+YNTPP Y  Y+ GLVF+ L AQGGL  +E+ N +KAE LY  ID+S GFY  PV
Sbjct  229  AENGSMYNTPPTYAWYLAGLVFKWLKAQGGLTAMEQLNRRKAEKLYGYIDAS-GFYSNPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPF LA  + +  F+KEA A  ++ LKGHRSVGGMRASIYNA+P A V+ L
Sbjct  288  EKHSRSWMNVPFVLADEQFDKPFLKEADAAGLLNLKGHRSVGGMRASIYNAVPEAAVDAL  347

Query  383  VAFMKDFMAKHG  348
            + FMKDF  +HG
Sbjct  348  IDFMKDFAQRHG  359



>ref|WP_043755222.1| MFS transporter [Thiorhodococcus sp. AK35]
 gb|EXJ14330.1| Phosphoserine aminotransferase [Thiorhodococcus sp. AK35]
Length=360

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 5/194 (3%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPI--TPIMLDYK  750
            VADMSS   S+PVDV+K+G+IYAGAQKN+GP+G+ IVI+R+DLIG  QPI  TP MLDYK
Sbjct  170  VADMSSTLLSRPVDVSKYGLIYAGAQKNIGPAGLTIVIVREDLIG--QPIAGTPTMLDYK  227

Query  749  IHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRC  570
            + +D +S+YNTPP Y  Y+ GLVF+ L  +GGL  + + N +KA+ LY+ ID+S  FY  
Sbjct  228  VQADGDSMYNTPPTYAWYLAGLVFQWLKDKGGLEAMAEINARKAKRLYDIIDAS-AFYNN  286

Query  569  PVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVE  390
            PV+   RS MNVPFTLA PEL+  F+KEA +  +  LKGHRSVGGMRASIYNAMP  GVE
Sbjct  287  PVDPQARSWMNVPFTLANPELDDRFLKEAKSAGLTTLKGHRSVGGMRASIYNAMPEEGVE  346

Query  389  KLVAFMKDFMAKHG  348
             LVAFM++F    G
Sbjct  347  ALVAFMQEFERTQG  360



>ref|WP_036314771.1| MFS transporter [Methylophaga thiooxydans]
Length=360

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV++FG+IYAGAQKN+GP+G+ IVIIRKDL+G+  P TP ML+Y+ H
Sbjct  170  VADLSSTILSRPIDVSRFGMIYAGAQKNIGPAGLCIVIIRKDLMGDVLPGTPTMLNYQTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S++NTP  Y  Y+ GLVFE L  QGGL  + + N +KA+ LY+ IDSS  FY  PV
Sbjct  230  ADNDSMFNTPATYSWYLAGLVFEWLKQQGGLAAMAEINKRKADKLYQVIDSSE-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RS MNVPFTLA  +L+  F+++AA   ++ LKGHR VGGMRASIYNAMP +GV+ L
Sbjct  289  DKRYRSWMNVPFTLADDKLDKVFVQQAAQQHLLTLKGHRDVGGMRASIYNAMPESGVDAL  348

Query  383  VAFMKDFMAKHG  348
            +AFM +F  +HG
Sbjct  349  IAFMNEFERQHG  360



>ref|WP_028491619.1| MFS transporter [Thioalkalivibrio sp. ALE19]
Length=360

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKSAVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KAE LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKAEKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSRMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_008292142.1| MFS transporter [Methylophaga thiooxydans]
 gb|EEF78603.1| phosphoserine aminotransferase [Methylophaga thiooxydans DMS010]
Length=348

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV++FG+IYAGAQKN+GP+G+ IVIIRKDL+G+  P TP ML+Y+ H
Sbjct  158  VADLSSTILSRPIDVSRFGMIYAGAQKNIGPAGLCIVIIRKDLMGDVLPGTPTMLNYQTH  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S++NTP  Y  Y+ GLVFE L  QGGL  + + N +KA+ LY+ IDSS  FY  PV
Sbjct  218  ADNDSMFNTPATYSWYLAGLVFEWLKQQGGLAAMAEINKRKADKLYQVIDSSE-FYANPV  276

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTLA  +L+  F+++AA   ++ LKGHR VGGMRASIYNAMP +GV+ L
Sbjct  277  NKRYRSWMNVPFTLADDKLDKVFVQQAAQQHLLTLKGHRDVGGMRASIYNAMPESGVDAL  336

Query  383  VAFMKDFMAKHG  348
            +AFM +F  +HG
Sbjct  337  IAFMNEFERQHG  348



>ref|WP_018935525.1| MFS transporter [Thioalkalivibrio sp. ALJ24]
Length=360

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLDREKSAVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KAE LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKAEKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            + S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  DPSARSWMNVPFILADDALDGPFLKEAEAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_026353180.1| MFS transporter [Solimonas variicoloris]
Length=360

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+P DVTK+G+IYAGAQKN+GP+GV IVI+R DLIG T P TP + DYK  
Sbjct  170  VADMSSNMLSRPFDVTKYGLIYAGAQKNIGPAGVTIVIVRDDLIGQTLPNTPGIFDYKQM  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S+ NTPP +  Y+ GLVF+ + A GGL  + ++N KKAE+LY  IDS + FYR PV
Sbjct  230  ADAESMLNTPPCFAWYVSGLVFKWIKAHGGLAGIGERNAKKAELLYAYIDSQD-FYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K+ RS MNVPFTLA PEL+ EF+K A A  +  LKGHRSVGGMRASIYNAM L GV++L
Sbjct  289  AKADRSRMNVPFTLANPELDAEFLKGAKAADLSGLKGHRSVGGMRASIYNAMTLEGVQQL  348

Query  383  VAFMKDFMAKHG  348
            V +MK+F    G
Sbjct  349  VDYMKEFARTRG  360



>ref|WP_019569986.1| MFS transporter [Thioalkalivibrio sp. ALE11]
Length=360

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KAE LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKAEKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_028782461.1| MFS transporter [Thalassobacillus devorans]
Length=360

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+G+ +VI+R+DLIGN Q   P+MLDYK H
Sbjct  170  VADMSSNILSEQMDVSKFGVIYAGAQKNIGPAGLTVVIVREDLIGNAQESCPVMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            SD  SLYNTPP YGIYM  LVFE L   GG+ E+EK N +KA+ILY+ ++ S   +  PV
Sbjct  230  SDKGSLYNTPPTYGIYMAKLVFEWLKDLGGVKEMEKINREKAQILYDYVEESE-LFSSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK+ RSLMN+PF     +L   F+KEA    +  LKGHRSVGGMRASIYNAMP+ GV  L
Sbjct  289  EKNSRSLMNIPFVSPSDDLNAAFVKEAKEAGLETLKGHRSVGGMRASIYNAMPVDGVLSL  348

Query  383  VAFMKDFMAKH  351
            VAFMK F +K 
Sbjct  349  VAFMKKFESKQ  359



>ref|WP_019591413.1| MFS transporter [Thioalkalivibrio sp. ALE20]
Length=360

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KAE LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKAEKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_028006389.1| MFS transporter [Solimonas flava]
Length=360

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+P DVTK+G+IYAGAQKN+GP+GV IVI+R DLIG T P TP + DYK  
Sbjct  170  VADMSSNMLSRPFDVTKYGLIYAGAQKNIGPAGVTIVIVRDDLIGQTLPNTPGIFDYKQM  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S+ NTPP +  Y+ GLVF+ + A GGL  + ++N KKAE+LY  IDS + FYR PV
Sbjct  230  ADAESMLNTPPCFAWYVSGLVFKWIKAHGGLAGIGERNAKKAELLYAYIDSQD-FYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K+ RS MNVPFTLA PEL+ EF+K A A  +  LKGHRSVGGMRASIYNAM L GV++L
Sbjct  289  AKADRSRMNVPFTLANPELDAEFLKGAKAADLSGLKGHRSVGGMRASIYNAMTLEGVQQL  348

Query  383  VAFMKDFMAKHG  348
            V +MK+F    G
Sbjct  349  VDYMKEFARTRG  360



>ref|WP_019642831.1| MFS transporter [Thioalkalivibrio sp. ALSr1]
Length=360

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPVDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKSKVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>emb|CDH59803.1| phosphoserine aminotransferase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=387

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 145/194 (75%), Gaps = 4/194 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG---NTQPITPIMLDY  753
            VADMSSNF S+PVDV+K+G+IY GAQKN+GP+GV +VIIRKDLI    N  P+ P+MLDY
Sbjct  193  VADMSSNFLSRPVDVSKYGVIYGGAQKNLGPAGVTLVIIRKDLIPASLNDPPVRPLMLDY  252

Query  752  KIHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYR  573
            +  +DN+SLYNTPP + IYM GL  E +L  GGL  ++K+N  KA+ LYEAIDS +  ++
Sbjct  253  RTLADNDSLYNTPPTFAIYMVGLTLEWILQNGGLEGMQKRNKAKADKLYEAIDSLS-LFK  311

Query  572  CPVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGV  393
             PV+K  RS MNV FT+  PELE EF+K A    MVQLKGHRS GG+R+SIYNAMP   V
Sbjct  312  SPVDKQCRSRMNVVFTMNSPELEKEFLKGAEERNMVQLKGHRSTGGIRSSIYNAMPQEHV  371

Query  392  EKLVAFMKDFMAKH  351
            EKL+ +MK F  +H
Sbjct  372  EKLIEYMKQFQQEH  385



>ref|WP_015437146.1| phosphoserine aminotransferase [Azoarcus sp. KH32C]
 dbj|BAL25844.1| phosphoserine aminotransferase [Azoarcus sp. KH32C]
Length=367

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  S+ +DV+++G+IYAGAQKNVGPSG++IVI+R+DLIG+  P+TP ++DYK+ 
Sbjct  177  VADMSSHILSRSIDVSRYGLIYAGAQKNVGPSGLVIVIVREDLIGHAHPMTPAVMDYKVM  236

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+ NTPP Y IY+ GLVF+ L AQGGL  +E +N++KA++LY  +D S+ FY   V
Sbjct  237  ADNGSMLNTPPTYAIYIAGLVFQWLKAQGGLAGIEAQNIEKADLLYRFLDDSD-FYENRV  295

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              + RS MN+PF L    L   F+ EA A  + QLKGH+SVGGMRASIYNAMP+AGV  L
Sbjct  296  AVASRSRMNIPFLLRSEALNDAFLAEAKAAGLTQLKGHKSVGGMRASIYNAMPIAGVRAL  355

Query  383  VAFMKDFMAKHG  348
            V FM+DF  +HG
Sbjct  356  VEFMQDFARRHG  367



>ref|WP_017508295.1| MFS transporter [beta proteobacterium L13]
Length=361

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+ +DV+KFG+IYAGAQKN+GPSG+ +VI+R+DL+G  QP TP ML+Y++H
Sbjct  170  VCDMSSDFLSREIDVSKFGLIYAGAQKNIGPSGLTVVIVREDLLGRAQPQTPTMLNYQVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTP  Y IY+ GLVF+ L  QGG+  +  +N +KA +LY AIDSSNGFY   +
Sbjct  230  ADADSMYNTPATYPIYIAGLVFKWLKTQGGIKGMAARNEEKAGLLYHAIDSSNGFYYSHI  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNV F L    LE  F+ EA    +VQLKGHRSVGGMRASIYNAMP+ GV+ L
Sbjct  290  DAPYRSKMNVVFRLKDEALEDLFLSEAKKNGLVQLKGHRSVGGMRASIYNAMPIEGVKAL  349

Query  383  VAFMKDFMAKHG  348
            V FM DF  +HG
Sbjct  350  VHFMLDFARQHG  361



>ref|WP_014995313.1| MFS transporter [Alcanivorax dieselolei]
 gb|AFT71247.1| Phosphoserine aminotransferase 2 [Alcanivorax dieselolei B5]
Length=359

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV +FG+IYAGAQKN+GP+G+ +VI+R+DL+G      P ML+Y+IH
Sbjct  169  VADMSSTILSRPLDVNRFGLIYAGAQKNIGPAGITLVIVRRDLLGRAGASVPAMLNYQIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +  Y+ GLVF+ L  QGGL  +   N +KA+ LY+ ID+S GFY  PV
Sbjct  229  ADNDSMYNTPPTFAWYLAGLVFQWLKDQGGLTAMAAINERKAKRLYDFIDAS-GFYSNPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK+ RS MNVPF LA  +L+ +F+ EA A  +  LKGHRSVGGMRASIYNA+P A VE L
Sbjct  288  EKADRSRMNVPFVLANSDLDKDFLDEAGAAGLHNLKGHRSVGGMRASIYNAVPEAAVEAL  347

Query  383  VAFMKDFMAKHG  348
            VAFM DF  +HG
Sbjct  348  VAFMADFEKRHG  359



>ref|WP_018076565.1| MFS transporter [Thiobacillus denitrificans]
Length=359

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+G+ IVI+R DLIG T   TP M DYKIH
Sbjct  169  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGLTIVIVRDDLIGETVKGTPTMFDYKIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTP  + +Y  GLVF+ L A+GGL  +EK N +KA +LY+ +D+++ FY  PV
Sbjct  229  ADNDSMYNTPATFAMYTAGLVFKWLKARGGLAAMEKTNREKAGLLYDTLDATD-FYASPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RSLMN+PFTL    L+  F+K A    ++QLKGHRSVGGMRASIYNAMPL GV  L
Sbjct  288  AKENRSLMNIPFTLKDAALDEAFLKLAKERGLLQLKGHRSVGGMRASIYNAMPLEGVRAL  347

Query  383  VAFMKDFMAKHG  348
            V  M++F   HG
Sbjct  348  VDCMREFEKSHG  359



>ref|WP_024328884.1| MFS transporter [Thioalkalivibrio sp. ALR17-21]
Length=360

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_019589998.1| MULTISPECIES: MFS transporter [Thioalkalivibrio]
Length=360

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_019022084.1| MFS transporter [Thioalkalivibrio sp. ALE23]
Length=360

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLERDKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_046113537.1| MFS transporter [Aquincola tertiaricarbonis]
Length=360

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNF SKPVDV+++G+IY GAQKN+GP+G+ +VI+R DL+G   PITP + DYK  
Sbjct  170  VADMSSNFLSKPVDVSRYGLIYGGAQKNIGPAGLTLVIVRDDLLGGALPITPQVFDYKHL  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+ NTPP Y IY+ GLVF+ + AQGGL  + + N  KA +LY AID+S GFY  PV
Sbjct  230  ADNDSMINTPPTYAIYIAGLVFKWIKAQGGLEGMARLNQAKASLLYGAIDAS-GFYTSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             +  RSLMNVPF L+ P L+  F+K A A  MVQLKGHR VGGMRASIYNA+PL  V+ L
Sbjct  289  AREDRSLMNVPFRLSDPSLDAAFLKGAEARGMVQLKGHRVVGGMRASIYNAVPLEAVQAL  348

Query  383  VAFMKDFMAKHG  348
            V +MK+F A+ G
Sbjct  349  VDYMKEFEAEKG  360



>ref|WP_018869444.1| MFS transporter [Thioalkalivibrio sp. ALgr3]
Length=360

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_018945974.1| MFS transporter [Thioalkalivibrio sp. AKL17]
Length=360

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+RKDL+   +   P +LD+K+ 
Sbjct  170  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPAGVTVVIVRKDLLEREKGQVPAVLDWKLQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +G Y  GLVFE LL QGGL ++ + N +KA+ LY  ID+S  FYR PV
Sbjct  230  ADNDSMYNTPPTFGWYFAGLVFEWLLEQGGLEKMAEINQRKADKLYRFIDNS-AFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPF LA   L+G F+KEA A  +  LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  289  EPSARSWMNVPFILADDSLDGPFLKEADAAGLSSLKGHRSVGGMRASIYNAVPEEAVDAL  348

Query  383  VAFMKDFMAKH  351
            + FM DF  +H
Sbjct  349  IEFMADFEERH  359



>ref|WP_028251166.1| MFS transporter [Variovorax sp. URHB0020]
Length=360

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSNF S+PVDV+++G+IY GAQKNVGP+G+ +VI+R DLIG   P+TP   DYKI 
Sbjct  170  VADMSSNFMSRPVDVSRYGLIYGGAQKNVGPAGLTLVIVRDDLIGQALPVTPSAFDYKIQ  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++N+S++NTPP Y IY+ GLVF  + AQGGL  +E  N KKA +LY+ +++++ FY  PV
Sbjct  230  AENDSMFNTPPTYAIYIAGLVFNWIKAQGGLKAMEAHNRKKAAVLYDHLETTSFFYN-PV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             +  RSLMNVPF L    L+  F+K A A  M+QLKGHRSVGGMRASIYNAMP+ GV  L
Sbjct  289  ARDDRSLMNVPFKLRDESLDEAFLKGAQARGMLQLKGHRSVGGMRASIYNAMPIEGVVAL  348

Query  383  VAFMKDFMAKHG  348
            V +MK+F   HG
Sbjct  349  VEYMKEFEVSHG  360



>ref|WP_022368594.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:882]
 emb|CDD64141.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:882]
Length=360

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDVTK+G+IY G QKN+GP+GV+IVIIR+DLI  +  P TP ML YKI
Sbjct  169  VADVSSCFLSEPVDVTKYGVIYGGVQKNIGPAGVVIVIIREDLITEDVLPGTPTMLRYKI  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN SLYNTPP YGIY+CG VF+ L  QGGL  ++++N KKA+ILY+ +D S  F    
Sbjct  229  HADNGSLYNTPPAYGIYICGKVFKWLKKQGGLAAMKERNEKKAKILYDFLDQSKLFKGTV  288

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEAAA   V LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  289  VPKD-RSLMNVPFVTGNEELDAKFVKEAAAAGFVNLKGHRTVGGMRASIYNAMPIEGVEK  347

Query  386  LVAFMKDF  363
            LV FMK F
Sbjct  348  LVEFMKKF  355



>ref|WP_014778523.1| MFS transporter [Thiocystis violascens]
 gb|AFL74072.1| phosphoserine aminotransferase apoenzyme [Thiocystis violascens 
DSM 198]
Length=360

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 146/194 (75%), Gaps = 5/194 (3%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPI--TPIMLDYK  750
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R+DL+G  QPI  TP M DYK
Sbjct  170  VADMSSTLLSRPIDVSRFGLIYAGAQKNIGPAGLTIVIVREDLLG--QPIAGTPTMFDYK  227

Query  749  IHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRC  570
            IH+DN+S+YNTP  Y  Y+ GLVF+ L   GGL  +   N +KA++LY+ ID+S+ FY  
Sbjct  228  IHADNDSMYNTPATYAWYLAGLVFKWLKDLGGLDAMAVINARKAKLLYDTIDASS-FYAN  286

Query  569  PVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVE  390
            PV+   RS MNVPFTLA  +L+  F+KEA A  +  LKGHRSVGGMRASIYNAMP  GV+
Sbjct  287  PVQPDSRSWMNVPFTLASSDLDETFLKEAKAANLTTLKGHRSVGGMRASIYNAMPEEGVQ  346

Query  389  KLVAFMKDFMAKHG  348
             LVAFM++F  +H 
Sbjct  347  ALVAFMQEFERRHA  360



>ref|WP_034286665.1| MFS transporter [Bacillus sp. 72]
Length=365

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KF +IYAGAQKN+GP+G+ +VIIR+DLIG      P+MLDYK H
Sbjct  170  VADMSSNILSEEIDVSKFALIYAGAQKNIGPAGLTLVIIREDLIGKAGESVPVMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S++ SLYNTPP +G+Y+  LVFE L  +GG+  +EK N  KA +LY+ +++S  F+R PV
Sbjct  230  SESGSLYNTPPTFGVYVAKLVFEWLEERGGIAAMEKINRDKAALLYDYLETST-FFRSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RSLMN+PF     EL+  F+KEA A  +  LKGHRSVGGMRAS+YNA+P+AGVE L
Sbjct  289  QKEDRSLMNIPFVSPSDELDALFVKEAKAAGLETLKGHRSVGGMRASVYNALPVAGVETL  348

Query  383  VAFMKDFMAKH  351
            VAFMK+F   H
Sbjct  349  VAFMKEFEQTH  359



>ref|WP_006778838.1| MFS transporter [[Clostridium] hathewayi]
 gb|EHI61237.1| phosphoserine aminotransferase [ [[Clostridium] hathewayi WAL-18680]
Length=361

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 144/192 (75%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDVTK+GIIY G QKN+GP+GV+IVIIR+DLI  +  P TP ML YK 
Sbjct  169  VADVSSCFLSEPVDVTKYGIIYGGVQKNIGPAGVVIVIIREDLITEDVLPGTPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN SLYNTPP YGIY+CG VF+ L  +GGL  +++ N KKA ILY+ +DSS  F +  
Sbjct  229  HADNKSLYNTPPAYGIYICGKVFKWLKNRGGLAAMKEYNEKKAAILYDFLDSSEMF-KGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            VEK  RSLMNVPF     EL+  F+KEA A     LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  288  VEKKDRSLMNVPFVTGDEELDALFVKEAKAAGFENLKGHRTVGGMRASIYNAMPIEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LVAFMK+F   H
Sbjct  348  LVAFMKEFEEAH  359



>ref|WP_011713086.1| MFS transporter [Magnetococcus marinus]
 gb|ABK43933.1| phosphoserine aminotransferase apoenzyme [Magnetococcus marinus 
MC-1]
Length=361

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSSN  S+PVDV+K+GIIYAGAQKN+GPSGV +VI+R+DL+G    + P+MLDYK+ 
Sbjct  172  VGDMSSNILSRPVDVSKYGIIYAGAQKNLGPSGVTLVIVREDLLGRRSNL-PVMLDYKVQ  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +++ S++NTPP Y IY+ GLV + + AQGG+  +E +N+ KA +LY+AID    FY CP 
Sbjct  231  AESESMHNTPPTYAIYILGLVLKWVKAQGGVAGMEAQNIAKAALLYKAIDEM-AFYSCPT  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNVPF L+   L   F+ EA    +V LKGHRSVGGMRAS+YNAMPLAGVE L
Sbjct  290  QVESRSRMNVPFILSDDRLNESFLSEAKKADLVTLKGHRSVGGMRASLYNAMPLAGVEAL  349

Query  383  VAFMKDFMAKHG  348
            VAFM DF  +HG
Sbjct  350  VAFMGDFAKRHG  361



>gb|AFJ01312.1| Phosphoserine aminotransferase [Methylophaga frappieri]
Length=348

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV +FG+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP M DY+IH
Sbjct  158  VADMSSTLLSRPIDVNRFGLIYAGAQKNIGPAGLCIVIVRRDLIGKTLPGTPTMFDYQIH  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
              N+S+YNTP  Y  Y+ GLVF+ L  QGGL  + + N +KA  LY AID S+ FY  PV
Sbjct  218  DKNDSMYNTPATYSWYLAGLVFQWLKQQGGLQAMAEINSRKAAKLYAAIDGSD-FYANPV  276

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKS RS MN+PFTL   EL+  F++ +AA  ++ LKGHR +GGMRASIYNAMP AGV++L
Sbjct  277  EKSSRSWMNIPFTLVNSELDKTFLQMSAAAGLLTLKGHRDLGGMRASIYNAMPEAGVDRL  336

Query  383  VAFMKDFMAKHG  348
            + FM +F  + G
Sbjct  337  IDFMMEFERRFG  348



>ref|WP_015464490.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
sp. CNPT3]
 gb|AGH80609.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
sp. CNPT3]
Length=362

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+G+ IVI+R+DLIG+ +   P + DY+I 
Sbjct  172  VADMSSTILSRPIDVSKFGLIYAGAQKNIGPAGLAIVIVREDLIGHARRAIPSIFDYEIQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + +NS+YNTPP Y  Y+ GLVF+ L AQGGL EVEK+N++KA +LY  IDSSN FY   +
Sbjct  232  AKSNSMYNTPPTYSWYLAGLVFKWLKAQGGLVEVEKRNIEKASLLYSFIDSSN-FYENNI  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRS MN+PFTL    L   F+  + A  ++ LKGH+SVGGMRAS+YNAMPLAGV+ L
Sbjct  291  DKSVRSRMNIPFTLVDESLNSAFLSASKAAGLLTLKGHKSVGGMRASVYNAMPLAGVQAL  350

Query  383  VAFMKDF  363
            V FM DF
Sbjct  351  VKFMADF  357



>ref|WP_022500227.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:95]
 emb|CDF07170.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:95]
Length=384

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 147/192 (77%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDVT++G+IY G QKN+GP+GV+IVIIR+DLI  +T P TP ML YKI
Sbjct  193  VADVSSCFLSEPVDVTRYGVIYGGVQKNIGPAGVVIVIIREDLITEDTLPGTPTMLKYKI  252

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN+SLYNTPP YGIY+CG VF+ L   GGL ++++ N KKA+ILY+ +D S   ++  
Sbjct  253  HADNDSLYNTPPAYGIYICGKVFKWLKKMGGLEKMKEINEKKAKILYDYLDESK-LFKGT  311

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA       LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  312  VRKEDRSLMNVPFVTGSEELDAKFVKEAKEAGFENLKGHRTVGGMRASIYNAMPIEGVEK  371

Query  386  LVAFMKDFMAKH  351
            LV FMKDF AK+
Sbjct  372  LVEFMKDFEAKN  383



>emb|CDS08854.1| hypothetical protein LRAMOSA10215 [Absidia idahoensis var. thermophila]
Length=387

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG---NTQPITPIMLDY  753
            VADMSSNF S+PVDV+K+G+IY GAQKN+GP+GV +VIIRKDLI    N  P+ P+MLDY
Sbjct  193  VADMSSNFLSRPVDVSKYGVIYGGAQKNLGPAGVTLVIIRKDLIPASLNDPPMRPLMLDY  252

Query  752  KIHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYR  573
            +  +DN+SLYNTPP + IYM  L  E +L  GGL  ++K+N  KA+ LYEAIDS +  ++
Sbjct  253  RTLADNDSLYNTPPTFAIYMVSLTLEWILQHGGLEGMQKRNKTKADKLYEAIDSLS-LFK  311

Query  572  CPVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGV  393
             PV+K  RS MNV FT+  PELE EF+K A    MVQLKGHRS GG+R+SIYNAMP   V
Sbjct  312  SPVDKQCRSRMNVVFTMESPELEKEFLKGAEERNMVQLKGHRSTGGIRSSIYNAMPQEHV  371

Query  392  EKLVAFMKDFMAKHG  348
            EKL+ +MK F  +H 
Sbjct  372  EKLIEYMKQFQQEHS  386



>ref|WP_041366312.1| MFS transporter [Methylophaga frappieri]
Length=359

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV +FG+IYAGAQKN+GP+G+ IVI+R+DLIG T P TP M DY+IH
Sbjct  169  VADMSSTLLSRPIDVNRFGLIYAGAQKNIGPAGLCIVIVRRDLIGKTLPGTPTMFDYQIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
              N+S+YNTP  Y  Y+ GLVF+ L  QGGL  + + N +KA  LY AID S+ FY  PV
Sbjct  229  DKNDSMYNTPATYSWYLAGLVFQWLKQQGGLQAMAEINSRKAAKLYAAIDGSD-FYANPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EKS RS MN+PFTL   EL+  F++ +AA  ++ LKGHR +GGMRASIYNAMP AGV++L
Sbjct  288  EKSSRSWMNIPFTLVNSELDKTFLQMSAAAGLLTLKGHRDLGGMRASIYNAMPEAGVDRL  347

Query  383  VAFMKDFMAKHG  348
            + FM +F  + G
Sbjct  348  IDFMMEFERRFG  359



>ref|WP_038248091.1| MFS transporter [Zetaproteobacteria bacterium TAG-1]
Length=361

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KF +IYAGAQKN+GP+G+ IVIIR+DL+G     TP M++YKIH
Sbjct  170  VADMSSTILSRPIDVSKFAMIYAGAQKNIGPAGLCIVIIREDLLGKASAQTPAMMNYKIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP Y  YM GLVFE + AQGGL  + + N +KA  LY AID S GFY  PV
Sbjct  230  ADNGSMYNTPPTYSWYMAGLVFEWIQAQGGLKAMGEINGRKAAKLYAAIDDS-GFYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RS MNVPFTLA  +L+  F++ AA   ++ LKGHRSVGGMRASIYNAMP  GV+ L
Sbjct  289  AKQHRSWMNVPFTLANADLDAVFLEGAAEQGLITLKGHRSVGGMRASIYNAMPEEGVDAL  348

Query  383  VAFMKDFMAKH  351
            VA+M+ F AKH
Sbjct  349  VAYMQSF-AKH  358



>gb|EEG32017.1| phosphoserine transaminase [ [[Clostridium] methylpentosum DSM 
5476]
Length=349

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV+KFG++YAGAQKN+GP+G+ +VIIR+DLIGN + ITP+M +Y+ H
Sbjct  158  VADISSCVLSEPLDVSKFGLLYAGAQKNMGPAGLTVVIIREDLIGNARDITPVMFNYQTH  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQ-GGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            +DN S+YNTPP Y IY+CGLV E +  Q GGL ++++ N+KKA +LY+ +DSS   ++  
Sbjct  218  ADNGSMYNTPPTYAIYICGLVLEWIKTQIGGLEKMKEINVKKASLLYDFLDSST-LFKGT  276

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            VEK  RSLMN+PF     EL+ +F+ E+ A   V LKGHRSVGGMRASIYNAMP+ GVEK
Sbjct  277  VEKDSRSLMNIPFVTGDEELDKKFVAESKAAGFVNLKGHRSVGGMRASIYNAMPIEGVEK  336

Query  386  LVAFMKDFMAKH  351
            LV FMK F A++
Sbjct  337  LVEFMKKFEAEN  348



>gb|EHL77690.1| phosphoserine aminotransferase [Bacillus smithii 7_3_47FAA]
Length=369

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  ++  DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIGN     P+ML+Y+ H
Sbjct  170  VADMSSNILAQEYDVSKFGLIYAGAQKNIGPAGLTVVIIREDLIGNAPENCPVMLNYQTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            SD  SLYNTPP + IY+  LVFE L   GG+  +EK N +KA++LYE +D S  F+  PV
Sbjct  230  SDKGSLYNTPPTFSIYVAKLVFEWLKELGGVSVMEKINREKAQLLYEFLDQSELFH-SPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RSLMN+PFTL   EL  +FIKEA A  +  LKGHR+VGGMRASIYNAMP+ GV+KL
Sbjct  289  EKESRSLMNIPFTLPSEELNTQFIKEAKAQGLETLKGHRTVGGMRASIYNAMPIEGVKKL  348

Query  383  VAFMKDFMAK  354
            V FMK F AK
Sbjct  349  VEFMKSFEAK  358



>ref|WP_020561164.1| hypothetical protein [Thiothrix flexilis]
Length=360

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  SKP+DV++FG+IYAGAQKN+GP+G+ +VI+R+DLIG     TP MLDYK++
Sbjct  170  VADMSSDILSKPIDVSRFGLIYAGAQKNIGPAGITVVIVREDLIGKAVANTPSMLDYKVY  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +++ S+YNTPP Y  Y+ GLVF+ L  +GGL  + + N  KA++LY+AID+S+ FY CPV
Sbjct  230  AESESMYNTPPTYAWYLAGLVFKWLKRKGGLAAMAEFNELKAKVLYDAIDASS-FYHCPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RS MNVPFTLA  EL+  F+ E+A   ++ LKGHR VGGMRASIYNAM + GV  L
Sbjct  289  DKRYRSTMNVPFTLANSELDKVFLAESAKAGLMSLKGHRVVGGMRASIYNAMSIEGVSAL  348

Query  383  VAFMKDFMAKHG  348
              FM++F  +HG
Sbjct  349  AQFMREFERQHG  360



>ref|WP_043116984.1| hypothetical protein [Solemya velum gill symbiont]
 gb|KHF24751.1| phosphoserine aminotransferase apoenzyme [Solemya velum gill 
symbiont]
Length=360

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSS   S+P+DV+++G+IYAGAQKN+GP+G+ I IIR DLIG+    TP M  Y  H
Sbjct  170  IADMSSTILSRPIDVSRYGMIYAGAQKNIGPAGLTIAIIRDDLIGDALESTPSMFRYATH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             DN+S+YNTPP YG Y+ GLVF+ L   GGL  +   N  KA++LY+A+D S+ FY  PV
Sbjct  230  VDNDSMYNTPPTYGWYLAGLVFKWLKGLGGLEAMAGINQAKAQLLYDAVDGSD-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPFTLA P+L+ EF+K A    ++ LKGHRSVGGMRASIYNAMP  GVE+L
Sbjct  289  EKESRSWMNVPFTLANPDLDAEFLKGAQEVGLMTLKGHRSVGGMRASIYNAMPREGVERL  348

Query  383  VAFMKDFMAKHG  348
            V +M++F +K+G
Sbjct  349  VEYMQEFESKNG  360



>ref|WP_040341449.1| MFS transporter, partial [Bacillus smithii]
Length=358

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  ++  DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIGN     P+ML+Y+ H
Sbjct  170  VADMSSNILAQEYDVSKFGLIYAGAQKNIGPAGLTVVIIREDLIGNAPENCPVMLNYQTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            SD  SLYNTPP + IY+  LVFE L   GG+  +EK N +KA++LYE +D S  F+  PV
Sbjct  230  SDKGSLYNTPPTFSIYVAKLVFEWLKELGGVSVMEKINREKAQLLYEFLDQSELFH-SPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RSLMN+PFTL   EL  +FIKEA A  +  LKGHR+VGGMRASIYNAMP+ GV+KL
Sbjct  289  EKESRSLMNIPFTLPSEELNTQFIKEAKAQGLETLKGHRTVGGMRASIYNAMPIEGVKKL  348

Query  383  VAFMKDFMAK  354
            V FMK F AK
Sbjct  349  VEFMKSFEAK  358



>ref|WP_022255595.1| phosphoserine aminotransferase [Clostridium sp. CAG:505]
 emb|CDC26249.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:466]
 emb|CDD60873.1| phosphoserine aminotransferase [Clostridium sp. CAG:505]
Length=360

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+  S+ +D+TKFG+++AGAQKN+GP+GV +VIIR+DL+GN    TP ML Y IH
Sbjct  170  VGDMSSSILSEEIDITKFGLLFAGAQKNLGPAGVTVVIIREDLLGNAMDFTPTMLKYDIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + NNSLYNTPP YGIY  G VFE + AQGG+  ++K+N +KA +LY+ +DSS   +R  V
Sbjct  230  AKNNSLYNTPPTYGIYFMGRVFEWVKAQGGVAAMQKRNEEKAALLYDFLDSS-ALFRGTV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RSLMNVPF L   EL  +FIKEA     V LKGHR+VGGMRASIYNAMP  GVE L
Sbjct  289  QKKDRSLMNVPFVLPTEELNAKFIKEAGEKGFVNLKGHRTVGGMRASIYNAMPKEGVEAL  348

Query  383  VAFMKDF  363
            VAFMK F
Sbjct  349  VAFMKQF  355



>ref|WP_018282158.1| MFS transporter [zeta proteobacterium SCGC AB-137-C09]
Length=360

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 140/191 (73%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KF +IYAGAQKN+GP+G+ IVIIR DL+G     TP M +Y  H
Sbjct  170  VADMSSTILSRPIDVSKFAMIYAGAQKNIGPAGLTIVIIRDDLLGKASAQTPAMFNYSTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTP  Y  Y+ GLVF  +  QGGL  +   N +KA+ LY AIDSS+ FY  PV
Sbjct  230  ADNDSMYNTPATYSWYIAGLVFAWIKDQGGLTAIADVNKRKADKLYAAIDSSD-FYGSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K+ RS MNVPFTLA  +L+G+F+K AA   +V LKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  AKNGRSWMNVPFTLANADLDGDFLKGAAEHGLVTLKGHRSVGGMRASIYNAMPEAGVDAL  348

Query  383  VAFMKDFMAKH  351
            VA+M +F   H
Sbjct  349  VAYMHEFAQSH  359



>ref|WP_016287510.1| phosphoserine transaminase [Lachnospiraceae bacterium 3-1]
 gb|EOS24060.1| phosphoserine transaminase [Lachnospiraceae bacterium 3-1]
Length=359

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDV+K+GIIY G QKN+GP+GV+IVIIR+DLI  +T P TP ML YK 
Sbjct  169  VADVSSCFLSEPVDVSKYGIIYGGVQKNIGPAGVVIVIIREDLITEDTLPGTPTMLKYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D +SLYNTPP YGIY+CG VF+ L  QGGL  +++ N +KA+ILY+ +D S  F R  
Sbjct  229  HADADSLYNTPPAYGIYICGKVFQWLKKQGGLAAMKQHNEEKAKILYDFLDESKMF-RGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA A   V LKGHR+VGGMRASIYNAMP  GVEK
Sbjct  288  VRKEDRSLMNVPFVTGDKELDAKFVKEAEAAGFVNLKGHRTVGGMRASIYNAMPKEGVEK  347

Query  386  LVAFMKDF  363
            LVAFMK F
Sbjct  348  LVAFMKKF  355



>ref|WP_040437276.1| MFS transporter [[Clostridium] methylpentosum]
Length=361

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SS   S+P+DV+KFG++YAGAQKN+GP+G+ +VIIR+DLIGN + ITP+M +Y+ H
Sbjct  170  VADISSCVLSEPLDVSKFGLLYAGAQKNMGPAGLTVVIIREDLIGNARDITPVMFNYQTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQ-GGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            +DN S+YNTPP Y IY+CGLV E +  Q GGL ++++ N+KKA +LY+ +DSS   ++  
Sbjct  230  ADNGSMYNTPPTYAIYICGLVLEWIKTQIGGLEKMKEINVKKASLLYDFLDSST-LFKGT  288

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            VEK  RSLMN+PF     EL+ +F+ E+ A   V LKGHRSVGGMRASIYNAMP+ GVEK
Sbjct  289  VEKDSRSLMNIPFVTGDEELDKKFVAESKAAGFVNLKGHRSVGGMRASIYNAMPIEGVEK  348

Query  386  LVAFMKDFMAKH  351
            LV FMK F A++
Sbjct  349  LVEFMKKFEAEN  360



>ref|WP_018507777.1| MFS transporter [Thiobacillus thioparus]
Length=359

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R DLIG T   TP M DYKIH
Sbjct  169  VADMSSTILSRPIDVSRFGLIYAGAQKNIGPAGLTIVIVRDDLIGETLKGTPTMFDYKIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTP  + +Y  GLVF+ L  +GGL  +EK N +KA +LY+ +D+++ FY  PV
Sbjct  229  ADNDSMYNTPATFAMYTAGLVFKWLKVRGGLAAMEKTNREKASLLYDYLDATD-FYASPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RSLMNVPFTL    L+  F+K A    ++QLKGHRSVGGMRASIYNAMP+ GV  L
Sbjct  288  AKDNRSLMNVPFTLKDSTLDEAFLKLAKERSLLQLKGHRSVGGMRASIYNAMPIEGVRAL  347

Query  383  VAFMKDFMAKHG  348
            V  M++F   HG
Sbjct  348  VDCMREFEKSHG  359



>gb|KIL76405.1| Phosphoserine aminotransferase [Bacillus badius]
 gb|KIL78521.1| Phosphoserine aminotransferase [Bacillus badius]
Length=349

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIG+     P MLDYK H
Sbjct  158  VADMSSNILSEEIDVSKFGLIYAGAQKNIGPAGLTVVIIREDLIGHAPESCPTMLDYKTH  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S++ SLYNTPP YGIYM  LVFE L   GGL E+EK N KKAE+LY  +  S   ++ PV
Sbjct  218  SESGSLYNTPPTYGIYMAKLVFEWLKELGGLKEMEKINRKKAELLYGFLGQS-AMFQSPV  276

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            ++  RS+MN+PF     EL+  F+KEA    +  LKGHRSVGGMRASIYNAMP+ GVE L
Sbjct  277  QEDSRSIMNIPFVSPSAELDAAFVKEAKEAGLETLKGHRSVGGMRASIYNAMPVEGVEAL  336

Query  383  VAFMKDFMAKHG  348
            V FMK F  KH 
Sbjct  337  VEFMKHFEEKHA  348



>ref|WP_018394690.1| hypothetical protein [Bacillus sp. 37MA]
Length=365

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 144/191 (75%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KF +IYAGAQKN+GP+G+ +VIIR+DLIG      P+MLDYK H
Sbjct  170  VADMSSNILSEEIDVSKFALIYAGAQKNIGPAGLTLVIIREDLIGKAGESVPVMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S++ SLYNTPP +G+Y+  LVFE L  +GG+  +EK N  KA +LY+ +++S  F+R PV
Sbjct  230  SESGSLYNTPPTFGVYVAKLVFEWLEERGGIAAMEKINRDKAALLYDYLETST-FFRSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RSLMN+PF     EL+  F+KEA A  +  LKGHRSVGGMRAS+YNA+P+AGVE L
Sbjct  289  QKEDRSLMNIPFVSPSDELDALFVKEAKAVGLETLKGHRSVGGMRASVYNALPVAGVEAL  348

Query  383  VAFMKDFMAKH  351
            VAFMK+F   H
Sbjct  349  VAFMKEFEQTH  359



>ref|WP_023415104.1| MFS transporter [uncultured Thiohalocapsa sp. PB-PSB1]
 gb|ESQ08785.1| MFS transporter [uncultured Thiohalocapsa sp. PB-PSB1]
Length=380

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R DLIG  +  TP M DYKIH
Sbjct  190  VADMSSTLLSRPIDVSRFGLIYAGAQKNIGPAGLTIVIVRDDLIGQPRNGTPAMFDYKIH  249

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y  Y+ GLVF+ L   GGL  + + N +KA+ LY AID+S+ FY  PV
Sbjct  250  ADNDSMYNTPPTYAWYLAGLVFQWLKDLGGLAVMAEINQRKADKLYAAIDASD-FYTNPV  308

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E + RS MNVPFTLA   L+ +F+  A +  ++ LKGHRSVGGMRASIYNAMP AG++ L
Sbjct  309  EVASRSWMNVPFTLADAALDEDFLGGAKSAGLLTLKGHRSVGGMRASIYNAMPEAGIDAL  368

Query  383  VAFMKDFMAKHG  348
            +A+M +F   HG
Sbjct  369  IAYMAEFERTHG  380



>ref|WP_025562444.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
sp. SP041]
Length=362

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GPSG+ IVI+R DLIG+ +   P + DY++ 
Sbjct  172  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPSGLSIVIVRDDLIGHARQTIPSIFDYQVQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y  Y+ GLVF+ LLAQGG+  VEK N+ KAE+LY AIDSS+ FY   V
Sbjct  232  TDFDSMYNTPPTYSWYLAGLVFKWLLAQGGIAAVEKNNIAKAELLYNAIDSSS-FYSNNV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            + SVRS MN+PFTLA   L   F+ E+ A  +V LKGH+ VGGMRASIYNAMP+ GV+ L
Sbjct  291  DASVRSRMNIPFTLADDSLNETFLSESKAAGLVTLKGHKLVGGMRASIYNAMPIEGVQAL  350

Query  383  VAFMKDFMAKHG  348
            V FM  F  K+ 
Sbjct  351  VDFMAVFEKKYA  362



>ref|WP_038281274.1| MFS transporter [[Clostridium] celerecrescens]
 gb|KEZ89873.1| MFS transporter [ [[Clostridium] celerecrescens]
Length=361

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+P+D++K+G+I+AGAQKNVGP+GV+I IIR+DLI  +  P TP ML YK 
Sbjct  169  VADLSSCFLSEPIDISKYGLIFAGAQKNVGPAGVVIAIIREDLITEDVLPGTPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  SLYNTPP YGIY+CG VF+ L  +GGL  +++ N KKA ILY+ +D S  F    
Sbjct  229  HADEKSLYNTPPAYGIYICGKVFKWLKNRGGLEAMKEFNEKKAAILYDYLDQSQMFTGTV  288

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            VEK  RSLMNVPF     EL+  F+KE+ A     LKGHRSVGGMRASIYNAMP+ GVEK
Sbjct  289  VEKD-RSLMNVPFVTGNEELDALFVKESKAAGFENLKGHRSVGGMRASIYNAMPIEGVEK  347

Query  386  LVAFMKDFMAKHG  348
            LVAFMKDF  KHG
Sbjct  348  LVAFMKDFETKHG  360



>ref|WP_007779651.1| MFS transporter [Desulfosporosinus youngiae]
 gb|EHQ87966.1| phosphoserine aminotransferase [Desulfosporosinus youngiae DSM 
17734]
Length=360

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 146/192 (76%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VADMSS+  S+PVDVTK+G+I+AGAQKN+GP+GV++VIIR+DLI  +  P TP ML YK 
Sbjct  169  VADMSSDILSEPVDVTKYGLIFAGAQKNIGPAGVVVVIIREDLITEDVLPGTPTMLKYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN SLYNTPP YGIY+CG VF+ +  QGGL  ++K+N++KA ILY+ +DSS  F R  
Sbjct  229  HADNKSLYNTPPAYGIYICGKVFKWVQNQGGLEAMQKRNVEKAAILYDYLDSSKMF-RGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +FIKEA A     LKGHR+VGGMRASIYNAMP  GV+ 
Sbjct  288  VVKQDRSLMNVPFVTGSEELDAKFIKEAKAAGFENLKGHRTVGGMRASIYNAMPRQGVQA  347

Query  386  LVAFMKDFMAKH  351
            LV FMK F A++
Sbjct  348  LVEFMKKFEAEN  359



>ref|WP_023354504.1| phosphoserine transaminase [Catonella morbi]
 gb|ESL02762.1| phosphoserine transaminase [Catonella morbi ATCC 51271]
Length=361

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 144/192 (75%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDV+K+GIIY G QKNVGP+G +IVIIR+DLI  +  P TP M+ YK 
Sbjct  169  VADVSSCFLSEPVDVSKYGIIYGGVQKNVGPAGAVIVIIREDLITEDVLPGTPTMMKYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN SLYNTPP YGIY+CG VF+ L AQGGL  +++KN KKA+ILY  +D+S   +   
Sbjct  229  HADNKSLYNTPPAYGIYVCGKVFKWLKAQGGLSVMKEKNEKKADILYNFLDNSK-LFNGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +FIKEA     V LKGHR+VGGMRASIYNAMPL GVEK
Sbjct  288  VRKEDRSLMNVPFITGNDELDAKFIKEATEAGFVNLKGHRTVGGMRASIYNAMPLEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LV FMK F A++
Sbjct  348  LVEFMKKFEAEN  359



>ref|WP_017471249.1| MFS transporter [Amphibacillus jilinensis]
Length=359

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S P+DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIG+     P MLDYK  
Sbjct  167  VADMSSNILSTPIDVSKFGLIYAGAQKNIGPAGMTLVIIREDLIGHASDAVPTMLDYKTQ  226

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D++SLYNTPP + IY+  LVFE L A+GGL E+EK+N  KA +LY+A+D S  FY  P+
Sbjct  227  TDSSSLYNTPPTFAIYVAKLVFEWLKARGGLTEMEKQNRDKAALLYQALDQSELFY-API  285

Query  563  EKSVRSLMNVPFTL--AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVE  390
             K  RSLMNVPF       ELE  FIKEA A  +  LKGHRSVGGMRASIYNAMP  GVE
Sbjct  286  NKEDRSLMNVPFVSVDGDKELEATFIKEAQAYGLETLKGHRSVGGMRASIYNAMPYEGVE  345

Query  389  KLVAFMKDF  363
             LV F+K F
Sbjct  346  ALVEFIKSF  354



>ref|WP_019005008.1| MFS transporter [Cohnella laeviribosi]
Length=362

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+   +P++V+KFG+IYAGAQKN+GPSGV IVIIR+DLIGN     P ML Y  H
Sbjct  171  VADMSSDILCRPLNVSKFGLIYAGAQKNLGPSGVTIVIIREDLIGNPSMPVPTMLRYDTH  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + N+SLYNTPP + IYM  LV + + AQGG   VEK N  KA++LYEAID S GFYR   
Sbjct  231  AKNDSLYNTPPTFAIYMTNLVLKWVKAQGGAAAVEKANRAKAKLLYEAIDQSGGFYRGFA  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS+MNV F +A  ELE  F+KE+ A   V LKGHRSVGG+RASIYNA+PLA V+ L
Sbjct  291  DPGSRSIMNVTFRMASEELEKLFVKESEAEGFVGLKGHRSVGGLRASIYNAVPLASVQAL  350

Query  383  VAFMKDFMAKHG  348
            V FM +F  +HG
Sbjct  351  VEFMAEFKRRHG  362



>ref|WP_029132418.1| hypothetical protein [Sedimenticola selenatireducens]
Length=359

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V D SS   S+PVDV+K+G+IYAGAQKN+GP+G+ +VI+R DL+G T   TP M DY+I 
Sbjct  169  VGDFSSTILSRPVDVSKYGVIYAGAQKNIGPAGLTVVIVRDDLVGETVAGTPAMFDYQIQ  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S+YNTPP YG Y+ GLVF+ L   GGL  + + N +KA  LY AID S GFY  PV
Sbjct  229  ADGESMYNTPPTYGWYLAGLVFQWLKRNGGLTAMAETNQRKAAALYAAIDGS-GFYNNPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MNVPFTLA   L+ +F+ EA    +V LKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  288  ELSCRSWMNVPFTLADAGLDAKFLTEAKEAGLVTLKGHRSVGGMRASIYNAMPEAGVQAL  347

Query  383  VAFMKDFMAKHG  348
            + FM DF  ++G
Sbjct  348  IDFMADFEKRNG  359



>ref|WP_041095180.1| MFS transporter [Bacillus badius]
Length=361

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIG+     P MLDYK H
Sbjct  170  VADMSSNILSEEIDVSKFGLIYAGAQKNIGPAGLTVVIIREDLIGHAPESCPTMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S++ SLYNTPP YGIYM  LVFE L   GGL E+EK N KKAE+LY  +  S   ++ PV
Sbjct  230  SESGSLYNTPPTYGIYMAKLVFEWLKELGGLKEMEKINRKKAELLYGFLGQS-AMFQSPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            ++  RS+MN+PF     EL+  F+KEA    +  LKGHRSVGGMRASIYNAMP+ GVE L
Sbjct  289  QEDSRSIMNIPFVSPSAELDAAFVKEAKEAGLETLKGHRSVGGMRASIYNAMPVEGVEAL  348

Query  383  VAFMKDFMAKHG  348
            V FMK F  KH 
Sbjct  349  VEFMKHFEEKHA  360



>ref|WP_004871798.1| MFS transporter [Acidithiobacillus caldus]
 gb|AEK58036.1| Phosphoserine aminotransferase [Acidithiobacillus caldus SM-1]
 gb|AIA55023.1| Phosphoserine aminotransferase [Acidithiobacillus caldus ATCC 
51756]
Length=360

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V+D SS+  S+P+ V +FG+IYAGAQKNVGP+G+ +VI+R+DL+G   P TP MLDY +H
Sbjct  169  VSDASSHLLSRPLPVERFGLIYAGAQKNVGPAGLTLVIVREDLLGRADPHTPTMLDYAVH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +  +S+YNTP  + IY+ GLVF+ L   GGL  +EK NM KAE LY AID S GFYR  V
Sbjct  229  AREHSMYNTPATFAIYVAGLVFQWLKDLGGLTAMEKINMAKAERLYGAIDDSGGFYRNSV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPF L    L+  F++EA A  ++QLKGHR +GGMRASIYNAMPL GVE L
Sbjct  289  APRNRSRMNVPFFLHDAALDPLFLEEAQAAGLLQLKGHRLLGGMRASIYNAMPLEGVETL  348

Query  383  VAFMKDFMAKHG  348
            VAF++DF A+HG
Sbjct  349  VAFLRDFAARHG  360



>ref|WP_009151577.1| MFS transporter [Thiorhodovibrio sp. 970]
 gb|EIC19348.1| phosphoserine aminotransferase [Thiorhodovibrio sp. 970]
Length=360

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GP+G+ IVI+R DLIG T P TP M DY IH
Sbjct  170  VADMSSTLLSRPLDVSRFGLIYAGAQKNIGPAGLTIVILRADLIGETLPGTPAMFDYGIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            + N+S+YNTPP Y  Y+ GLVF  L   GGL  + + N +KA  LY AID S  FY  PV
Sbjct  230  AKNDSMYNTPPTYAWYLAGLVFAWLKELGGLEAMAEINRRKAAKLYAAIDDSK-FYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E   RS MNVPFTLA P L+G+F+  A    ++ LKGHRSVGGMRASIYNAMP AGVE L
Sbjct  289  ELRARSWMNVPFTLADPNLDGDFLAGAKDAGLLTLKGHRSVGGMRASIYNAMPEAGVEAL  348

Query  383  VAFMKDFMAKHG  348
            V FM++F    G
Sbjct  349  VDFMREFERTRG  360



>ref|WP_022351754.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:534]
 emb|CDD46077.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:534]
Length=360

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 146/193 (76%), Gaps = 2/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDVTK+G+IY G QKN+GP+GV+IVIIR+DLI  +T P TP ML YKI
Sbjct  169  VADVSSCFLSEPVDVTKYGVIYGGVQKNIGPAGVVIVIIREDLITEDTLPGTPTMLKYKI  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  SLYNTPP YGIY+CG VF+ L  +GGL  +++ N KKA+ILY+ +D S   ++  
Sbjct  229  HADAQSLYNTPPAYGIYICGKVFKWLKKRGGLEAMKEYNEKKAKILYDFLDESK-LFKGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA       LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  288  VRKEDRSLMNVPFVTGDEELDAKFVKEAKEAGFENLKGHRTVGGMRASIYNAMPIEGVEK  347

Query  386  LVAFMKDFMAKHG  348
            LVAFMK+F  K+G
Sbjct  348  LVAFMKEFEKKNG  360



>ref|WP_022959738.1| MFS transporter [Spongiibacter tropicus]
Length=359

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV KFG+IYAGAQKN+GP+G+ IVI+RKDL+G  +  TP MLDYK  
Sbjct  169  VADMSSTILSRPIDVNKFGVIYAGAQKNIGPAGLTIVIVRKDLLGKARAATPTMLDYKTA  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP    Y+ GLVF+ L AQGGL  VE+ N +KAE LY  ID+S GFY  PV
Sbjct  229  ADNDSMYNTPPTLAWYLSGLVFKWLKAQGGLDAVEQINRRKAEKLYGYIDAS-GFYSNPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E + RSLMN+PF LA   L+  F+  A    ++ LKGHRSVGGMRASIYNA+P A V+ L
Sbjct  288  EVASRSLMNIPFVLADSSLDKAFLAGADEAGLLNLKGHRSVGGMRASIYNAVPEAAVDAL  347

Query  383  VAFMKDFMAKHG  348
            + +MKDF   +G
Sbjct  348  IDYMKDFAKGNG  359



>ref|XP_003055243.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60495.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=349

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN+ SKP+DV K+G+IY G QKN+GP+G+ IVI+R DLIG      P M DY++ 
Sbjct  158  VADMSSNYLSKPIDVKKYGVIYGGVQKNIGPAGMAIVIVRDDLIGEVADACPTMFDYQLM  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTPP + +Y  GLVF+ LL  GGL  VEK N++KA +LY+AID S+G+Y  PV
Sbjct  218  ADNESMYNTPPCWTMYTSGLVFKKLLKMGGLEAVEKMNIEKAAMLYDAIDGSDGYYVSPV  277

Query  563  EKSVRSLMNVPFTLAKPE-LEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            +K  RSLMNVPFTL   E LE +F+KEA A  +  LKGHRSVGG RASIYNAMP+ GV+ 
Sbjct  278  DKKYRSLMNVPFTLGGGEDLEKKFLKEANAAGLESLKGHRSVGGARASIYNAMPMEGVKT  337

Query  386  LVAFMKDF  363
            LV FM +F
Sbjct  338  LVDFMAEF  345



>ref|WP_045476811.1| MFS transporter [Thioploca ingrica]
 dbj|BAP57356.1| phosphoserine aminotransferase [Thioploca ingrica]
Length=360

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 138/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+K+G+IYAGAQKN+GP+G+ IVI+R+DL  N  P TP ML YK H
Sbjct  170  VADMSSTILSRPLDVSKYGLIYAGAQKNIGPAGLTIVIVREDLTDNAMPGTPTMLMYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
             DN S+YNTPP Y  Y+ GLVF+ L  QGGL  + ++N +KA +LY AID S  FY  PV
Sbjct  230  LDNQSMYNTPPTYAWYIAGLVFKWLKDQGGLAAMGERNQRKAAMLYAAIDQSE-FYGNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
                RS MNVPFT+  P+LE  F+ EA    +V L GHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  ALPYRSWMNVPFTIKNPDLEKTFLAEAKTAGLVSLAGHRSVGGMRASIYNAMPEAGVQAL  348

Query  383  VAFMKDFMAKHG  348
            + FM DF  ++G
Sbjct  349  IEFMNDFAKRNG  360



>ref|WP_010077007.1| MFS transporter [Clostridium cellulovorans]
 gb|ADL51772.1| phosphoserine aminotransferase [Clostridium cellulovorans 743B]
Length=360

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 148/192 (77%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS   S+PVDVTK+G+I+AG QKN+GP+GV+I IIR+DLI  +T P TP ML YKI
Sbjct  169  VADLSSCILSEPVDVTKYGLIFAGVQKNIGPAGVVIAIIREDLITEDTLPGTPTMLQYKI  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN+SLYNTPP YGIY+CG VF+ LL  GGL ++++ N +KA ILY+ +DSS  F +  
Sbjct  229  HADNDSLYNTPPAYGIYICGKVFKHLLNLGGLEKMKEINERKAAILYDFLDSSEMF-KGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA A     LKGHRSVGGMRASIYNAMP+ GVEK
Sbjct  288  VIKEDRSLMNVPFVTGNDELDAKFVKEAKAAGFENLKGHRSVGGMRASIYNAMPMEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LV FMK+F A++
Sbjct  348  LVDFMKNFEAEN  359



>ref|XP_004364238.1| phosphoserine aminotransferase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE92422.1| phosphoserine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=369

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 145/194 (75%), Gaps = 3/194 (2%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQ-PITPIMLDYKI  747
            V DMSSN  S+PVDV K+G+I+AGAQKNVGPSGV +VIIR DL+   Q P TPIML YK+
Sbjct  174  VCDMSSNILSRPVDVAKYGLIFAGAQKNVGPSGVTLVIIRSDLLDVKQHPATPIMLGYKL  233

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
             ++NNSLYNTPP + IY+CGLVFE L A GG+ E+  +N +K++ LY AID+SNGF+  P
Sbjct  234  MAENNSLYNTPPTFAIYICGLVFEHLKALGGIAEMNARNDRKSQALYAAIDNSNGFFTSP  293

Query  566  VEKSVRSLMNVPFTL--AKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGV  393
            V  + RS MNVPF +      LE +F+KEA A  M+QLKGHRSVGG+RASIYNA+    V
Sbjct  294  VVPAYRSRMNVPFRIRGGDDALENKFLKEAEAQNMIQLKGHRSVGGIRASIYNAISEDNV  353

Query  392  EKLVAFMKDFMAKH  351
             +LVAFM  F+A +
Sbjct  354  TQLVAFMNKFLAAN  367



>ref|WP_044326394.1| MFS transporter [Methylophaga nitratireducenticrescens]
Length=348

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSS   S+PVDV +FG+IYAGAQKN+GP+G+ IVI+RKDLIG T P TP+M DYKIH
Sbjct  158  IADMSSTILSRPVDVNRFGLIYAGAQKNIGPAGLCIVIVRKDLIGKTLPGTPVMFDYKIH  217

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTP  Y  Y+ GLVF+ L  +GGL  + + N +KA  LY  ID S+ FY  PV
Sbjct  218  ADNGSMYNTPATYSWYLAGLVFQWLKQKGGLQGMAEINQRKAAKLYATIDGSD-FYANPV  276

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MN+PFTLA  +L+ +F+ +AA   ++ LKGHR +GGMRASIYNAMP AGV+KL
Sbjct  277  DIRYRSWMNIPFTLANSDLDKQFLADAAKEGLLTLKGHRDLGGMRASIYNAMPEAGVDKL  336

Query  383  VAFMKDFMAKHG  348
            + FM +F  + G
Sbjct  337  IGFMSEFERRFG  348



>ref|WP_035724442.1| MFS transporter [Gracilibacillus boraciitolerans]
 dbj|GAE93974.1| phosphoserine aminotransferase [Gracilibacillus boraciitolerans 
JCM 21714]
Length=359

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 143/191 (75%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DVTKFG+IYAGAQKN+GP+G+ +VI+R+DLIGN     P MLDY+ H
Sbjct  169  VADMSSNILSEEMDVTKFGVIYAGAQKNIGPAGLTVVIVREDLIGNATEHCPTMLDYQTH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S++ SLYNTPP YG+YM  LVFE +   GGL  ++ +N KKA ILY+ I  S+ FY  PV
Sbjct  229  SESGSLYNTPPTYGVYMAKLVFEWVKELGGLKGIQARNEKKAGILYDYIAQSD-FYASPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            ++  RS+MN+PF +   +L+ EF+KEA A  +  LKGHRSVGGMRASIYN MP+ GVE L
Sbjct  288  KEDSRSIMNIPFIIPGRDLDDEFVKEAQAEGLETLKGHRSVGGMRASIYNPMPVEGVEAL  347

Query  383  VAFMKDFMAKH  351
            ++FMK F  KH
Sbjct  348  ISFMKKFEQKH  358



>ref|WP_019530440.1| MFS transporter [Dasania marina]
Length=359

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV KFG+IYAGAQKN+GP+G+ +VI+RKDL+GN     P MLDYK  
Sbjct  169  VADMSSTILSRPIDVNKFGVIYAGAQKNIGPAGLTMVIVRKDLMGNASNYCPTMLDYKTA  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y +Y+ GLVF  L  QGGL  +E+ N +KAE LY  ID+S GFY  PV
Sbjct  229  ADNDSMYNTPPTYSLYLAGLVFAWLKEQGGLAAMEQLNRRKAEKLYGYIDNS-GFYANPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E S RS MN+PFTLA  + +  F+ EA    ++ LKGHRSVGGMRASIYNA+P   V+ L
Sbjct  288  EISSRSSMNIPFTLASADFDKAFLAEADEIGLLNLKGHRSVGGMRASIYNAVPEEAVDTL  347

Query  383  VAFMKDFMAKHG  348
            + FMKDF  ++G
Sbjct  348  INFMKDFAQRNG  359



>ref|WP_027855112.1| MFS transporter [Marinobacterium litorale]
Length=360

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS+  ++P+DV+++G+IYAGAQKN+GP+G+ +VI+R DLIG T   TP M DYK+H
Sbjct  170  VADMSSDILARPIDVSRYGLIYAGAQKNIGPAGLTLVIVRDDLIGETVAGTPTMFDYKVH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+ NTPP +  YM GLVF+ L AQGG+  + + N +KAE LY AID S GFY  P+
Sbjct  230  ADADSMNNTPPTFAWYMTGLVFKWLKAQGGVEAIAQINQRKAEKLYAAIDGS-GFYNNPI  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            ++  RS+MNVPFTLA   L+  F+ EA A  ++ LKGHRSVGGMRASIYNA+P A V+ L
Sbjct  289  DRPNRSIMNVPFTLADSNLDSRFLDEAQAAGLLNLKGHRSVGGMRASIYNAVPEASVDAL  348

Query  383  VAFMKDFMAKHG  348
            +AFM++F  + G
Sbjct  349  IAFMQEFERRCG  360



>ref|WP_008929886.1| MFS transporter [Alcanivorax hongdengensis]
 gb|EKF73479.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Alcanivorax 
hongdengensis A-11-3]
Length=360

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV +FG+IYAGAQKN+GP+G+ +VI+RKDL+G      P ML+Y+IH
Sbjct  170  VADMSSTILSRPVDVNRFGLIYAGAQKNIGPAGLTLVIVRKDLLGRAADSVPAMLNYQIH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP Y  Y+ GLVF+ L  QGG+G + + N +KAE LY  ID+S+ FY  PV
Sbjct  230  ADNDSMYNTPPTYAWYLAGLVFQWLKKQGGVGSMAQINQRKAEKLYGFIDNSD-FYSNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNVPF LA   L+  F+ +A    ++ LKGHRSVGGMRASIYNA+P A V+ L
Sbjct  289  EKISRSWMNVPFVLADDSLDKAFLAQAEQAGLLNLKGHRSVGGMRASIYNAVPEAAVDAL  348

Query  383  VAFMKDFMAKHG  348
            +AFM DF  ++G
Sbjct  349  IAFMADFEKRNG  360



>ref|WP_007861360.1| MULTISPECIES: MFS transporter [Clostridiales]
 gb|EHE99349.1| phosphoserine aminotransferase [ [[Clostridium] citroniae WAL-17108]
 gb|KJJ70453.1| phosphoserine aminotransferase [Clostridium sp. FS41]
Length=363

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD SS F S+PVDVTK+G+I+AGAQKNVGP+G +IVI+R+DL+  +    TP ML YK 
Sbjct  169  VADQSSCFLSEPVDVTKYGLIFAGAQKNVGPAGTVIVIVREDLVSEDVLEGTPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H D  SLYNTPP YGIYMCG VF+ L A+GGL  +++ N KKAEILY+ +D S  F +  
Sbjct  229  HVDAESLYNTPPTYGIYMCGKVFKWLKAKGGLEAMKEYNEKKAEILYDFLDQSRMF-KGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            VEK  RSLMNVPF     EL+  F+KE+ A     LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  288  VEKKDRSLMNVPFVTGNDELDALFVKESKAAGFENLKGHRTVGGMRASIYNAMPMEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LVAFM DF  KH
Sbjct  348  LVAFMADFEEKH  359



>ref|WP_011769516.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
ingrahamii]
 gb|ABM02953.1| phosphoserine aminotransferase apoenzyme [Psychromonas ingrahamii 
37]
Length=362

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GPSG+ IVI+R DLIG  + + P + DYK+ 
Sbjct  172  VADMSSTILSRPIDVSKFGVIYAGAQKNIGPSGLAIVIVRDDLIGKARKVIPSIFDYKVQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S++NTPP Y  Y+ GLVF+ L  QGGL E+EKKN+ KAE+LY  IDSS   YR  +
Sbjct  232  ADAGSMFNTPPTYSWYLAGLVFKWLKEQGGLVEIEKKNIAKAELLYNFIDSSK-LYRNNI  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRS MN+PF LA   L   F+KE+    ++ LKGHR+VGGMRASIYNAMP+ GV+ L
Sbjct  291  DKSVRSRMNIPFQLADENLNALFLKESKDANLLTLKGHRAVGGMRASIYNAMPIEGVQAL  350

Query  383  VAFMKDFMAKHG  348
            V FM  F A + 
Sbjct  351  VDFMAKFEANYA  362



>ref|WP_010649862.1| MFS transporter [Oceanobacillus massiliensis]
Length=366

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 141/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+ +DV+KFG+IYAGAQKN+GP+G+ +VIIR+DLIG  Q   P MLDYK H
Sbjct  170  VADMSSNILSEEIDVSKFGLIYAGAQKNIGPAGLTVVIIREDLIGKAQESCPTMLDYKTH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            S + SLYNTPP YG+YM  LVFE L   GGL E+ + N +KA++LY  ++ SN F   PV
Sbjct  230  SASGSLYNTPPTYGVYMAKLVFEWLTDLGGLKEMGRINREKAQMLYRTLEESNMF-ESPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +++ RS+MNVPF     EL+  F+KEA A  +  LKGHRSVGGMRASIYNAMP+ GV++L
Sbjct  289  KENSRSMMNVPFVSDSAELDAAFVKEAQAQGLETLKGHRSVGGMRASIYNAMPVEGVQQL  348

Query  383  VAFMKDFMAKH  351
            + FMK F   H
Sbjct  349  IEFMKSFEKSH  359



>ref|WP_014707279.1| MFS transporter [Methylophaga nitratireducenticrescens]
 gb|AFI84911.1| Phosphoserine aminotransferase [Methylophaga nitratireducenticrescens]
Length=359

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            +ADMSS   S+PVDV +FG+IYAGAQKN+GP+G+ IVI+RKDLIG T P TP+M DYKIH
Sbjct  169  IADMSSTILSRPVDVNRFGLIYAGAQKNIGPAGLCIVIVRKDLIGKTLPGTPVMFDYKIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTP  Y  Y+ GLVF+ L  +GGL  + + N +KA  LY  ID S+ FY  PV
Sbjct  229  ADNGSMYNTPATYSWYLAGLVFQWLKQKGGLQGMAEINQRKAAKLYATIDGSD-FYANPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MN+PFTLA  +L+ +F+ +AA   ++ LKGHR +GGMRASIYNAMP AGV+KL
Sbjct  288  DIRYRSWMNIPFTLANSDLDKQFLADAAKEGLLTLKGHRDLGGMRASIYNAMPEAGVDKL  347

Query  383  VAFMKDFMAKHG  348
            + FM +F  + G
Sbjct  348  IGFMSEFERRFG  359



>ref|WP_016214688.1| phosphoserine transaminase [Eubacterium sp. 14-2]
 gb|EOT27549.1| phosphoserine transaminase [Eubacterium sp. 14-2]
Length=359

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDV+K+GIIY G QKN+GP+GV+IVIIR+DLI  +T P TP ML YK 
Sbjct  169  VADVSSCFLSEPVDVSKYGIIYGGVQKNIGPAGVVIVIIREDLITEDTLPGTPTMLKYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  SLYNTPP YGIY+CG VF+ L  QGGL  ++ +N +KA+ILY+ +DSS  F +  
Sbjct  229  HADAESLYNTPPAYGIYICGKVFQWLKKQGGLDAMKARNEEKAKILYDFLDSSTMF-KGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     +L+ +F+KEA A   V LKGHR+VGGMRASIYNAMP  GVEK
Sbjct  288  VRKEDRSLMNVPFVTGNKDLDAKFVKEAEAAGFVNLKGHRTVGGMRASIYNAMPKEGVEK  347

Query  386  LVAFMKDF  363
            LVAFMK F
Sbjct  348  LVAFMKKF  355



>ref|WP_029503297.1| MFS transporter [Lachnoclostridium phytofermentans]
Length=360

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDVTK+G+IY G QKN+GP+GV+IVIIR+DLI  +T P TP M  YKI
Sbjct  169  VADVSSCFLSEPVDVTKYGLIYGGVQKNIGPAGVVIVIIREDLITEDTLPGTPTMFQYKI  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H DN S+YNTPP YGIY+CG VF+ L   GGL  ++  N KKA+ILY+ +D S  F +  
Sbjct  229  HVDNQSMYNTPPAYGIYICGKVFKWLKKIGGLEAMKVHNEKKAQILYDFLDQSKMF-KGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA A   V LKGHR+VGGMRASIYNAMP+ GVEK
Sbjct  288  VVKEDRSLMNVPFVTGSEELDAKFVKEAKAAGFVNLKGHRTVGGMRASIYNAMPIEGVEK  347

Query  386  LVAFMKDFMAKHG  348
            LVAFMK+F  K+ 
Sbjct  348  LVAFMKEFEEKNA  360



>ref|WP_016305645.1| phosphoserine transaminase [Lachnospiraceae bacterium A2]
 gb|EOS45644.1| phosphoserine transaminase [Lachnospiraceae bacterium A2]
Length=360

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 144/188 (77%), Gaps = 2/188 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDV+K+GIIY G QKN+GP+GV+IV+IR+DLI  +T P TP ML YK 
Sbjct  169  VADVSSCFLSEPVDVSKYGIIYGGVQKNIGPAGVVIVVIREDLITEDTLPGTPTMLKYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D +SLYNTPP YGIY+CG VF+ L  QGGL  +++ N +KA+ILY+ +D S+ F R  
Sbjct  229  HADADSLYNTPPAYGIYICGKVFQWLKKQGGLTAMKQHNEEKAKILYDFLDGSSMF-RGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA A   V LKGHR+VGGMRASIYNAMP  GVE+
Sbjct  288  VRKEDRSLMNVPFVTGDKELDAKFVKEAEAAGFVNLKGHRTVGGMRASIYNAMPKEGVEQ  347

Query  386  LVAFMKDF  363
            LVAFMK F
Sbjct  348  LVAFMKKF  355



>ref|WP_011311461.1| phosphoserine aminotransferase [Thiobacillus denitrificans]
 sp|Q3SK88.1|SERC_THIDA RecName: Full=Phosphoserine aminotransferase; AltName: Full=Phosphohydroxythreonine 
aminotransferase; Short=PSAT [Thiobacillus 
denitrificans ATCC 25259]
 gb|AAZ96902.1| phosphoserine aminotransferase [Thiobacillus denitrificans ATCC 
25259]
Length=359

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
             ADMSS   S+P+DV+K+G+IYAGAQKN+GP+G+ IVI+R+DL+G T   TP M DYKIH
Sbjct  169  AADMSSTILSRPIDVSKYGVIYAGAQKNIGPAGLTIVIVREDLMGETVAGTPTMFDYKIH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN S+YNTP  + +Y  GLVF+ L A+GGL  +EK N +KA +LYEA+D+++ FY  PV
Sbjct  229  ADNESMYNTPATFAMYTAGLVFKWLKARGGLAGMEKINREKAALLYEALDATD-FYASPV  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             K  RSLMNVPFTL    L+  F+K A    ++QLKGHRSVGGMRASIYNAMP  GV+ L
Sbjct  288  AKDNRSLMNVPFTLKDAALDEAFLKGAKERGLLQLKGHRSVGGMRASIYNAMPTEGVKAL  347

Query  383  VAFMKDFMAKHG  348
            V ++  F   HG
Sbjct  348  VDYLHAFEKNHG  359



>ref|WP_019622496.1| MFS transporter [Amphritea japonica]
Length=360

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD+SSN  S+P+DV++FG+IYAGAQKN+GP+G+ +VI+R+DL+G+T P TP + DYK+ 
Sbjct  170  VADLSSNILSRPIDVSRFGMIYAGAQKNIGPAGLTVVIVREDLLGDTLPGTPSLYDYKMT  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D  S+ NTPP YG Y+ GLVF+ L AQGG+  + + N +KAE LY AID  N FY  PV
Sbjct  230  ADAGSMVNTPPTYGWYLAGLVFKWLKAQGGVEAISEINRRKAEKLYAAID-ENPFYSNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              +VRS MNVPF L   +L+ +F+ EA A  ++ L GHRSVGGMRASIYNA+P AGV+ L
Sbjct  289  AHNVRSWMNVPFILDNADLDKQFLVEAEALGLLNLPGHRSVGGMRASIYNAVPEAGVDAL  348

Query  383  VAFMKDFMAKHG  348
            +AFM+DF  +HG
Sbjct  349  IAFMQDFSQRHG  360



>ref|WP_002585968.1| MULTISPECIES: MFS transporter [Clostridiales]
 gb|EHG32485.1| phosphoserine aminotransferase [ [[Clostridium] clostridioforme 
2_1_49FAA]
 gb|ENY96586.1| phosphoserine transaminase [ [[Clostridium] clostridioforme CM201]
 gb|ENZ06368.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90B1]
 gb|ENZ20173.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90A8]
 gb|ENZ26778.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90A1]
 gb|ENZ27803.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90A3]
 gb|ENZ66003.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90A6]
 gb|ENZ66939.1| phosphoserine transaminase [ [[Clostridium] clostridioforme 90A4]
 emb|CDF23947.1| phosphoserine aminotransferase 1 [Clostridium clostridioforme 
CAG:511]
Length=361

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD SS F S+PVDVTK+G+I+AGAQKNVGP+G +IVI+R+DL+  +  P TP ML YK 
Sbjct  169  VADQSSCFLSEPVDVTKYGLIFAGAQKNVGPAGTVIVIVREDLVTEDVLPGTPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  SLYNTPP YGIYMCG VF+ L A+GGL  +++ N KKAEILY+ +D+S   ++  
Sbjct  229  HADAESLYNTPPTYGIYMCGKVFKWLKARGGLAAMKEYNEKKAEILYDFLDASQ-LFKGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+  F+KE+ A     LKGHR+VGGMRASIYNAMP  GVEK
Sbjct  288  VVKKDRSLMNVPFVTGDEELDALFVKESKAAGFENLKGHRTVGGMRASIYNAMPAEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LV FM DF  KH
Sbjct  348  LVEFMADFEKKH  359



>ref|WP_028535641.1| MFS transporter [Paludibacterium yongneupense]
Length=360

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V DMSS+F S+ VDV+KFG+IYAGAQKN+GPSG+ +V++R+DL+G+ +P TP ML+Y++H
Sbjct  169  VCDMSSDFLSREVDVSKFGLIYAGAQKNIGPSGLTLVVVREDLLGHARPETPTMLNYQVH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTP  + IY+ GLVF+ L  +GG+  V  +N +KA +LY AIDSS GFY   V
Sbjct  229  ADADSMYNTPSTFPIYIAGLVFKWLKERGGIKGVAARNTEKAGLLYHAIDSSEGFYYSHV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            EK  RS MNV F L    LE  F+ EA    ++QLKGHRS GG+RASIYNAMP+ GV+ L
Sbjct  289  EKPFRSQMNVVFRLRDDALEDSFLSEARKNGLIQLKGHRSFGGLRASIYNAMPIEGVKAL  348

Query  383  VAFMKDFMAKH  351
            V FM+DF  +H
Sbjct  349  VHFMQDFARQH  359



>ref|WP_022201980.1| phosphoserine aminotransferase 1 [Clostridium clostridioforme 
CAG:132]
 emb|CDB62097.1| phosphoserine aminotransferase 1 [Clostridium clostridioforme 
CAG:132]
Length=361

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 142/192 (74%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD SS F S+PVDVTK+G+I+AGAQKNVGP+G +IVI+R+DL+  +  P TP ML YK 
Sbjct  169  VADQSSCFLSEPVDVTKYGLIFAGAQKNVGPAGTVIVIVREDLVTEDVLPGTPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+D  SLYNTPP YGIYMCG VF+ L A+GGL  +++ N KKAEILY+ +D+S   ++  
Sbjct  229  HADAESLYNTPPTYGIYMCGKVFKWLKARGGLAAMKEYNEKKAEILYDFLDASQ-LFKGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+  F+KE+ A     LKGHR+VGGMRASIYNAMP  GVEK
Sbjct  288  VVKKDRSLMNVPFVTGDEELDALFVKESKAAGFENLKGHRTVGGMRASIYNAMPAEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LV FM DF  KH
Sbjct  348  LVEFMADFEKKH  359



>ref|WP_010638091.1| MFS transporter [Acidithiobacillus thiooxidans]
Length=362

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            V+D SS+  S+PVDV++FG+IYAGAQKN+GP+G+ +VI+R+DL+G+    TP MLDY + 
Sbjct  171  VSDASSHILSRPVDVSRFGLIYAGAQKNIGPAGLTLVIVREDLLGHAPANTPTMLDYAVQ  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +   S++NTPP + IY+ GLVF+ L   GGL  + ++N +KA +LY+AID S GFY  P+
Sbjct  231  AKEGSMHNTPPTFAIYVAGLVFKWLKKTGGLQAMAERNARKASLLYQAIDGSEGFYTNPI  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            E+  RS MNVPFTL    L+  F++EA    ++QLKGHR +GGMRASIYNAMP AGV+ L
Sbjct  291  EQRNRSWMNVPFTLKNANLDKAFLQEAELQHLLQLKGHRLLGGMRASIYNAMPEAGVQAL  350

Query  383  VAFMKDFMAKH  351
            V FM+DF  KH
Sbjct  351  VDFMRDFARKH  361



>ref|WP_019616297.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
ossibalaenae]
Length=362

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDV+KFG+IYAGAQKN+GPSG+ IVI+R DLIG  +   P +LDYK+ 
Sbjct  172  VADMSSTILSRPVDVSKFGLIYAGAQKNIGPSGLSIVIVRDDLIGKARQAIPSILDYKVQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y  Y+ GLVF+ L  QGGL EVEKKN+ KA +LY  ID+S+ FY   V
Sbjct  232  ADADSMYNTPPTYAWYLAGLVFKWLKEQGGLAEVEKKNIAKAALLYNFIDNSS-FYANYV  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRS MN+PFTL    L   F+KE+ A  ++ LKGH+ VGGMRASIYNAMP+ GV+ L
Sbjct  291  DKSVRSRMNIPFTLENDSLNETFLKESKAAGLLTLKGHKLVGGMRASIYNAMPIEGVQAL  350

Query  383  VAFMKDFMAKHG  348
            V FM  F  K+ 
Sbjct  351  VDFMSAFEKKYA  362



>ref|WP_033166073.1| MFS transporter [Clostridium sp. KNHs205]
Length=361

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 145/192 (76%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIG-NTQPITPIMLDYKI  747
            VAD+SS F S+PVDV+K+G+IY G QKNVGP+GV+IVIIR+DLI  +T P TP ML YKI
Sbjct  169  VADVSSCFLSEPVDVSKYGLIYGGVQKNVGPAGVVIVIIREDLITEDTLPGTPTMLKYKI  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
            H+DN SLYNTPP YGIY+CG VF+ L   GGL  +++ N KKA +LY+ +D S   ++  
Sbjct  229  HADNESLYNTPPAYGIYICGKVFKWLKKLGGLEAMKELNEKKAAVLYDYLDESK-LFKGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMNVPF     EL+ +F+KEA A     LKGHRSVGGMRASIYNAMP+ GV+K
Sbjct  288  VVKEDRSLMNVPFVTGDEELDAKFVKEAKAAGFENLKGHRSVGGMRASIYNAMPIEGVQK  347

Query  386  LVAFMKDFMAKH  351
            LV FMKDF A++
Sbjct  348  LVEFMKDFEARN  359



>ref|WP_012474969.1| MFS transporter [Chlorobium phaeobacteroides]
 gb|ACE04491.1| phosphoserine aminotransferase [Chlorobium phaeobacteroides BS1]
Length=360

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV++FG+IYAGAQKN+GPSG+ IVI+R+DLIGN     P M DY  H
Sbjct  170  VADMSSTILSRPIDVSRFGLIYAGAQKNIGPSGLTIVILREDLIGNPADGIPTMFDYATH  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++ +S+YNTPP Y  Y+ GLVFE +  QGGL  + + N +KA  LY  ID+S GFY  PV
Sbjct  230  ANADSMYNTPPTYNWYIAGLVFEWIKDQGGLSSIAEVNQRKAAKLYTVIDNS-GFYANPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
             ++ RS MN+PFTLA P L+ EF+  A    ++ LKGHRSVGGMRASIYNAMP  GV+ L
Sbjct  289  AENARSWMNIPFTLADPGLDAEFLSGATKRGLLTLKGHRSVGGMRASIYNAMPEEGVDTL  348

Query  383  VAFMKDFMAKHG  348
            +++M++F  +HG
Sbjct  349  ISYMQEFEKQHG  360



>ref|WP_028863377.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Psychromonas 
aquimarina]
Length=362

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+PVDVTKFG+IYAGAQKN+GPSG+ IVI+R DLIG  +   P +LDYK+ 
Sbjct  172  VADMSSTILSRPVDVTKFGLIYAGAQKNIGPSGLSIVIVRDDLIGQARQAIPSILDYKVQ  231

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +D +S+YNTPP Y  Y+ GLVF+ L  QGGL  VEKKN+ KA++LY  ID+S+ FY   +
Sbjct  232  ADADSMYNTPPTYAWYLAGLVFKWLKEQGGLAAVEKKNIAKADLLYNFIDNSD-FYANNI  290

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +KSVRS MN+PF LA   L   F+KE+ A  ++ LKGH+ VGGMRASIYNAMP+ GV+ L
Sbjct  291  DKSVRSRMNIPFILANDSLNETFLKESKAAGLLTLKGHKLVGGMRASIYNAMPIEGVQAL  350

Query  383  VAFMKDFMAKHG  348
            V FM  F  K+ 
Sbjct  351  VDFMAAFEKKYA  362



>ref|WP_021871269.1| phosphoserine aminotransferase 1 [Clostridium sp. CAG:7]
 emb|CCY43363.1| phosphoserine aminotransferase 1 [Clostridium sp. CAG:7]
Length=327

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 146/194 (75%), Gaps = 6/194 (3%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPI---TPIMLDY  753
            VAD SS F S+PVDV+K+G+I+AGAQKNVGP+G +IVIIR+DLI  T+ +   TP ML Y
Sbjct  136  VADQSSCFLSEPVDVSKYGLIFAGAQKNVGPAGTVIVIIREDLI--TEDVLEGTPTMLRY  193

Query  752  KIHSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYR  573
            KIH+D  SLYNTPP YGIYMCG VF+ L A+GGL E++K N +KA+ILY+ +D S   ++
Sbjct  194  KIHADAKSLYNTPPTYGIYMCGKVFKWLKAKGGLEEMKKINEEKAKILYDFLDESK-LFK  252

Query  572  CPVEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGV  393
              V K  RS+MNVPF     EL+  F+KE+ A  +  LKGHR+VGGMRASIYNAMP AGV
Sbjct  253  GTVVKKDRSIMNVPFITGNEELDALFVKESKAAGLENLKGHRTVGGMRASIYNAMPKAGV  312

Query  392  EKLVAFMKDFMAKH  351
            EKLV FM DF  KH
Sbjct  313  EKLVEFMADFEKKH  326



>ref|WP_021849773.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:791]
 emb|CCX63489.1| phosphoserine aminotransferase [Firmicutes bacterium CAG:791]
Length=359

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 143/192 (74%), Gaps = 2/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQP-ITPIMLDYKI  747
            VAD+SSNF S+P+DV ++G+ + G QKNVGP+GV+I +IR+DLI +  P   P ML YK 
Sbjct  169  VADVSSNFLSRPIDVNQYGMFFGGVQKNVGPAGVVIAVIREDLIRDDLPDYVPTMLRYKT  228

Query  746  HSDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCP  567
             +D +SLYNTPP Y IY+CGLVF+ L+ QGGL  + + N +KA I Y+ +D S   ++  
Sbjct  229  QADKDSLYNTPPCYNIYICGLVFKWLMKQGGLSGIARYNEEKAAIFYDYLDESK-LFKGT  287

Query  566  VEKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEK  387
            V K  RSLMN PF    P+L+ EF+KEAAA  +V LKGHR+VGGMRAS+YNAMP+ GVEK
Sbjct  288  VRKQDRSLMNAPFVTGDPDLDAEFVKEAAANGLVSLKGHRTVGGMRASMYNAMPIEGVEK  347

Query  386  LVAFMKDFMAKH  351
            LV+FMK+F AKH
Sbjct  348  LVSFMKEFEAKH  359



>ref|WP_015358223.1| MULTISPECIES: phosphoserine aminotransferase SerC [Ruminiclostridium]
 gb|AGC67531.1| phosphoserine aminotransferase SerC [ [[Clostridium] stercorarium 
subsp. stercorarium DSM 8532]
 gb|AGI38582.1| phosphoserine aminotransferase [ [[Clostridium] stercorarium 
subsp. stercorarium DSM 8532]
Length=362

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 147/191 (77%), Gaps = 1/191 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSSN  S+  DVTKFG+I+AGAQKN+GP+GV++VI+R+DLI    P  P ML YK+H
Sbjct  169  VADMSSNILSEVYDVTKFGLIFAGAQKNMGPAGVVVVIVREDLIAEVNPEVPTMLQYKVH  228

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++NNSL+NTPP Y IY+CGLVF+ L   GG+ E++K N +KA+ILY+ ID+SN F +   
Sbjct  229  AENNSLFNTPPCYSIYVCGLVFQWLKKLGGVPEMQKINEEKAKILYDFIDNSNMF-KGTA  287

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +K  RSLMNV F     +L+ +F+KEA    +V LKGHRSVGGMRASIYNAMP+ GV+KL
Sbjct  288  KKEDRSLMNVTFITGNKDLDAKFVKEAEEHGLVNLKGHRSVGGMRASIYNAMPVEGVKKL  347

Query  383  VAFMKDFMAKH  351
            V FMK+F A++
Sbjct  348  VEFMKEFEARN  358



>ref|WP_026743459.1| 3-phosphoserine/phosphohydroxythreonine aminotransferase [Lonsdalea 
quercina]
Length=361

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VAD SS+  S+ +DVT++G+IYAGAQKN+GP+G+ +VI+R DL+G ++   P MLDYKI 
Sbjct  171  VADYSSSILSRAIDVTRYGVIYAGAQKNIGPAGLTLVIVRDDLLGKSRRELPSMLDYKIL  230

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            +DN+S+YNTPP +  Y+ GLVF+ L AQGGL E+EKKN  KAE+LY AID S+ FY   V
Sbjct  231  ADNDSMYNTPPTFAWYLSGLVFKWLKAQGGLVEMEKKNQAKAELLYSAIDRSD-FYSNDV  289

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
              S RS MNVPF LA   L+  F++EA +  +  LKGHR+VGGMRASIYNAMPL GV+ L
Sbjct  290  AASNRSRMNVPFLLADAALDSVFLQEAQSAGLHALKGHRAVGGMRASIYNAMPLEGVKAL  349

Query  383  VAFMKDFMAKHG  348
              FM DF  +HG
Sbjct  350  TEFMADFERRHG  361



>ref|WP_018718595.1| MFS transporter [Arhodomonas aquaeolei]
Length=360

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  923  VADMSSNFCSKPVDVTKFGIIYAGAQKNVGPSGVMIVIIRKDLIGNTQPITPIMLDYKIH  744
            VADMSS   S+P+DV+KFG+IYAGAQKN+GP+GV +VI+R+DL+G+    TP +LDY+  
Sbjct  170  VADMSSTLLSRPIDVSKFGMIYAGAQKNIGPAGVTVVIVREDLLGSAMAETPAILDYQKM  229

Query  743  SDNNSLYNTPPFYGIYMCGLVFEDLLAQGGLGEVEKKNMKKAEILYEAIDSSNGFYRCPV  564
            ++++S+ NTPP +  YM GLVF+ L  QGGL  + + N +KA  LY+AID+S GFYR PV
Sbjct  230  AESDSMANTPPTFAWYMAGLVFKWLKRQGGLEAMAEINRRKAGKLYDAIDAS-GFYRNPV  288

Query  563  EKSVRSLMNVPFTLAKPELEGEFIKEAAAGKMVQLKGHRSVGGMRASIYNAMPLAGVEKL  384
            +   RS MNVPF LA   L   F+ EA A  +  LKGHRSVGGMRASIYNAMP AGV+ L
Sbjct  289  DPDCRSWMNVPFVLADESLNDTFLSEAKAAGLATLKGHRSVGGMRASIYNAMPEAGVDAL  348

Query  383  VAFMKDFMAKHG  348
            V+FM+DF  +HG
Sbjct  349  VSFMQDFERRHG  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996