BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6990

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHG94611.1|  beta-galactosidase                                      313   3e-96   Camellia sinensis [black tea]
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 311   2e-95   Nicotiana sylvestris
gb|AGW47883.1|  beta-galactosidase precursor                            311   2e-95   Nicotiana tabacum [American tobacco]
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 311   2e-95   Nicotiana tomentosiformis
ref|NP_001234303.1|  beta-galactosidase precursor                       309   1e-94   Solanum lycopersicum
gb|ADO34788.1|  beta-galactosidase STBG3                                308   2e-94   Solanum lycopersicum
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 305   4e-93   Sesamum indicum [beniseed]
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                300   1e-92   Erythranthe guttata [common monkey flower]
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 303   2e-92   Sesamum indicum [beniseed]
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 303   2e-92   Solanum tuberosum [potatoes]
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                300   1e-91   Erythranthe guttata [common monkey flower]
gb|KCW69754.1|  hypothetical protein EUGRSUZ_F031301                    285   2e-91   Eucalyptus grandis [rose gum]
gb|ACC60981.1|  beta-galactosidase 1 precursor                          297   4e-90   Petunia x hybrida [garden petunia]
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 294   4e-89   Nicotiana sylvestris
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               293   9e-89   Eucalyptus grandis [rose gum]
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      293   1e-88   Nicotiana sylvestris
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 291   4e-88   
ref|XP_012068994.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    291   6e-88   Jatropha curcas
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   286   6e-88   Citrus sinensis [apfelsine]
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 290   1e-87   Solanum lycopersicum
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      288   9e-87   Nicotiana tomentosiformis
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    288   9e-87   
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 286   3e-86   Solanum tuberosum [potatoes]
ref|NP_001234465.1|  beta-galactosidase precursor                       286   3e-86   Solanum lycopersicum
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               286   4e-86   Citrus sinensis [apfelsine]
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               286   4e-86   Tarenaya hassleriana [spider flower]
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             286   4e-86   Citrus clementina [clementine]
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             286   4e-86   Citrus clementina [clementine]
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   286   5e-86   Citrus sinensis [apfelsine]
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 286   5e-86   
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   286   7e-86   Citrus sinensis [apfelsine]
emb|CDO97918.1|  unnamed protein product                                285   7e-86   Coffea canephora [robusta coffee]
gb|KJB17254.1|  hypothetical protein B456_003G0595002                   280   5e-85   Gossypium raimondii
gb|KJB17255.1|  hypothetical protein B456_003G0595002                   280   6e-85   Gossypium raimondii
ref|XP_002527409.1|  beta-galactosidase, putative                       283   9e-85   
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      282   1e-84   Gossypium arboreum [tree cotton]
dbj|BAD95407.1|  galactosidase                                          266   3e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KJB70255.1|  hypothetical protein B456_011G065300                    278   4e-84   Gossypium raimondii
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               280   1e-83   Populus euphratica
gb|ABK96254.1|  unknown                                                 279   2e-83   Populus trichocarpa x Populus deltoides
ref|XP_006385360.1|  beta-galactosidase 1 family protein                279   2e-83   
ref|XP_006369293.1|  beta-galactosidase 1 family protein                278   4e-83   
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               278   5e-83   Populus euphratica
gb|KJB70254.1|  hypothetical protein B456_011G065300                    277   5e-83   Gossypium raimondii
gb|KJB70251.1|  hypothetical protein B456_011G065300                    278   8e-83   Gossypium raimondii
ref|XP_010106660.1|  Beta-galactosidase 1                               276   3e-82   Morus notabilis
emb|CAC44500.1|  beta-galactosidase                                     276   3e-82   Fragaria x ananassa
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    276   3e-82   Prunus mume [ume]
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             276   3e-82   Prunus persica
gb|KJB56893.1|  hypothetical protein B456_009G140800                    275   4e-82   Gossypium raimondii
gb|KJB56892.1|  hypothetical protein B456_009G140800                    275   4e-82   Gossypium raimondii
gb|ABV32545.1|  beta-galactosidase protein 2                            275   5e-82   Prunus persica
ref|XP_007024475.1|  Beta galactosidase 1                               275   9e-82   
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      273   2e-81   Gossypium arboreum [tree cotton]
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    274   2e-81   Cucumis melo [Oriental melon]
dbj|BAF02242.1|  putative galactosidase                                 268   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      274   2e-81   Gossypium arboreum [tree cotton]
dbj|BAH20412.1|  AT3G13750                                              268   4e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1                    273   5e-81   Cucumis sativus [cucumbers]
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    273   6e-81   Vitis vinifera
emb|CBI35944.3|  unnamed protein product                                272   7e-81   Vitis vinifera
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    272   7e-81   Tarenaya hassleriana [spider flower]
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             270   3e-80   Eutrema salsugineum [saltwater cress]
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    270   4e-80   Fragaria vesca subsp. vesca
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               270   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    270   7e-80   Pyrus x bretschneideri [bai li]
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             269   1e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    269   1e-79   
emb|CDX97513.1|  BnaA05g25660D                                          269   1e-79   
ref|NP_187988.1|  beta galactosidase 1                                  269   1e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23637.1|  BnaC05g39570D                                          269   1e-79   Brassica napus [oilseed rape]
gb|AAM13196.1|  galactosidase, putative                                 269   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             269   1e-79   Capsella rubella
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    268   2e-79   Malus domestica [apple tree]
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    268   2e-79   Camelina sativa [gold-of-pleasure]
emb|CDY51738.1|  BnaA01g37210D                                          267   7e-79   Brassica napus [oilseed rape]
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               266   1e-78   Camelina sativa [gold-of-pleasure]
emb|CDY37486.1|  BnaC01g37460D                                          266   1e-78   Brassica napus [oilseed rape]
gb|KJB70252.1|  hypothetical protein B456_011G065300                    266   1e-78   Gossypium raimondii
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           266   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               266   2e-78   Brassica rapa
gb|ACP18875.1|  beta-galactosidase pBG(a)                               265   2e-78   Carica papaya [mamon]
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                261   8e-77   Cicer arietinum [garbanzo]
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             260   2e-76   Phaseolus vulgaris [French bean]
gb|KEH18344.1|  beta-galactosidase                                      260   3e-76   Medicago truncatula
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           259   3e-76   Nelumbo nucifera [Indian lotus]
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               259   7e-76   Cicer arietinum [garbanzo]
gb|KHN39301.1|  Beta-galactosidase 1                                    258   2e-75   Glycine soja [wild soybean]
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               258   2e-75   Glycine max [soybeans]
gb|KHN32687.1|  Beta-galactosidase 1                                    257   2e-75   Glycine soja [wild soybean]
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               257   2e-75   Glycine max [soybeans]
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               257   3e-75   Glycine max [soybeans]
ref|XP_003597608.1|  Beta-galactosidase                                 257   3e-75   Medicago truncatula
gb|KHN30042.1|  Beta-galactosidase 1                                    257   3e-75   Glycine soja [wild soybean]
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               256   5e-75   Glycine max [soybeans]
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      252   1e-73   Phoenix dactylifera
gb|EPS65481.1|  beta-galactosidase                                      243   3e-73   Genlisea aurea
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             250   8e-73   Phaseolus vulgaris [French bean]
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    250   8e-73   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF31233.1|  beta-D-galactosidase                                   250   1e-72   Persea americana
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      246   3e-71   Phoenix dactylifera
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      244   2e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002514108.1|  beta-galactosidase, putative                       243   3e-70   
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             241   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           241   1e-69   Elaeis guineensis
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      241   2e-69   Populus euphratica
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               241   2e-69   Elaeis guineensis
ref|XP_010910613.1|  PREDICTED: beta-galactosidase-like                 231   3e-69   
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 241   3e-69   Nicotiana sylvestris
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      241   4e-69   Populus euphratica
gb|ERM94020.1|  hypothetical protein AMTR_s00136p00108810               239   6e-69   Amborella trichopoda
ref|XP_006826783.2|  PREDICTED: beta-galactosidase                      239   9e-69   
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   238   2e-68   Citrus sinensis [apfelsine]
ref|XP_007012844.1|  Beta-galactosidase                                 238   4e-68   
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               237   4e-68   Phoenix dactylifera
gb|EEC70956.1|  hypothetical protein OsI_02569                          230   6e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    236   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           235   2e-67   Elaeis guineensis
tpg|DAA58691.1|  TPA: hypothetical protein ZEAMMB73_223728              232   4e-67   
ref|XP_012076927.1|  PREDICTED: beta-galactosidase-like                 234   9e-67   Jatropha curcas
gb|KGN59822.1|  hypothetical protein Csa_3G848310                       232   1e-66   Cucumis sativus [cucumbers]
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    233   2e-66   Asparagus officinalis
ref|NP_001043405.1|  Os01g0580200                                       232   5e-66   
gb|EEE54862.1|  hypothetical protein OsJ_02342                          232   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      232   5e-66   Phoenix dactylifera
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1         231   5e-66   
gb|EEC70952.1|  hypothetical protein OsI_02561                          231   6e-66   Oryza sativa Indica Group [Indian rice]
gb|KDP40783.1|  hypothetical protein JCGZ_24782                         218   6e-66   Jatropha curcas
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    230   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          229   2e-65   
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               230   2e-65   Setaria italica
gb|AAQ21370.1|  beta-galactosidase                                      225   3e-65   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      229   3e-65   Nicotiana tomentosiformis
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      229   4e-65   Nicotiana sylvestris
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      229   4e-65   Nicotiana tomentosiformis
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      229   4e-65   Nicotiana sylvestris
gb|KJB17252.1|  hypothetical protein B456_003G0595002                   226   8e-65   Gossypium raimondii
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               227   3e-64   Oryza brachyantha
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      226   4e-64   Nicotiana sylvestris
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      226   4e-64   Nicotiana sylvestris
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      226   4e-64   Nicotiana sylvestris
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      226   5e-64   Nicotiana sylvestris
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    226   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    226   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT02336.1|  Beta-galactosidase 2                                    226   5e-64   
gb|KHN06610.1|  Beta-galactosidase                                      226   8e-64   Glycine soja [wild soybean]
gb|EMS53990.1|  Beta-galactosidase 2                                    225   9e-64   Triticum urartu
gb|KHN17668.1|  Beta-galactosidase                                      224   1e-63   Glycine soja [wild soybean]
dbj|BAF31234.1|  beta-D-galactosidase                                   225   1e-63   Persea americana
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 225   2e-63   Glycine max [soybeans]
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 224   4e-63   Eucalyptus grandis [rose gum]
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             223   6e-63   Prunus persica
ref|XP_010437357.1|  PREDICTED: beta-galactosidase 3-like               211   7e-63   Camelina sativa [gold-of-pleasure]
dbj|BAD95183.1|  beta-galactosidase like protein                        210   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    222   2e-62   Cucumis melo [Oriental melon]
gb|ABV32546.1|  beta-galactosidase protein 1                            222   2e-62   Prunus persica
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               221   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002310279.2|  beta-galactosidase family protein                  221   5e-62   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    221   5e-62   Eucalyptus grandis [rose gum]
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3                    220   7e-62   Cucumis sativus [cucumbers]
gb|KJB65167.1|  hypothetical protein B456_010G082900                    219   1e-61   Gossypium raimondii
gb|KJB65170.1|  hypothetical protein B456_010G082900                    219   1e-61   Gossypium raimondii
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    219   2e-61   
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               218   4e-61   Phoenix dactylifera
emb|CBI27912.3|  unnamed protein product                                218   4e-61   Vitis vinifera
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             218   4e-61   Phaseolus vulgaris [French bean]
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      218   5e-61   Vitis vinifera
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               218   5e-61   Elaeis guineensis
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    218   6e-61   Populus euphratica
dbj|BAF01862.1|  beta-galactosidase like protein                        213   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090040.1|  hypothetical protein L484_027271                   216   2e-60   Morus notabilis
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    216   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB17716.1|  hypothetical protein B456_003G011900                    216   2e-60   Gossypium raimondii
gb|ABY71826.1|  beta-galactosidase                                      216   2e-60   Prunus salicina [Japanese plum]
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               215   4e-60   Elaeis guineensis
gb|KJB43424.1|  hypothetical protein B456_007G198900                    215   4e-60   Gossypium raimondii
gb|KJB43422.1|  hypothetical protein B456_007G198900                    215   4e-60   Gossypium raimondii
gb|KJB43419.1|  hypothetical protein B456_007G198900                    215   4e-60   Gossypium raimondii
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    215   5e-60   Arabis alpina [alpine rockcress]
gb|KHG01120.1|  Beta-galactosidase                                      214   7e-60   Gossypium arboreum [tree cotton]
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    214   8e-60   Brassica rapa
gb|AAQ21369.1|  beta-galactosidase                                      214   1e-59   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_006838689.1|  PREDICTED: beta-galactosidase 5                    214   1e-59   Amborella trichopoda
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               213   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    213   4e-59   Tarenaya hassleriana [spider flower]
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    213   4e-59   Zea mays [maize]
ref|XP_007158611.1|  hypothetical protein PHAVU_002G1672001g            207   4e-59   Phaseolus vulgaris [French bean]
gb|EPS60900.1|  beta-galactosidase                                      199   5e-59   Genlisea aurea
dbj|BAJ34544.1|  unnamed protein product                                211   8e-59   Eutrema halophilum
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             211   8e-59   Eutrema salsugineum [saltwater cress]
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               211   9e-59   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             211   9e-59   Citrus clementina [clementine]
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   211   1e-58   Citrus sinensis [apfelsine]
emb|CDY59693.1|  BnaC07g51120D                                          211   1e-58   Brassica napus [oilseed rape]
emb|CAB16852.1|  beta-galactosidase like protein                        211   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568001.1|  beta-galactosidase 3                                  211   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    211   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               211   1e-58   Camelina sativa [gold-of-pleasure]
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         211   1e-58   Jatropha curcas
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    211   1e-58   Sesamum indicum [beniseed]
ref|XP_012078404.1|  PREDICTED: beta-galactosidase 3                    211   1e-58   Jatropha curcas
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               211   2e-58   Glycine max [soybeans]
gb|KHN27041.1|  Beta-galactosidase 3                                    210   2e-58   Glycine soja [wild soybean]
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               210   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             210   2e-58   Capsella rubella
ref|XP_003612093.1|  Beta-galactosidase                                 206   2e-58   
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               210   2e-58   Phoenix dactylifera
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          209   3e-58   Sorghum bicolor [broomcorn]
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     209   4e-58   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             209   5e-58   
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2    209   5e-58   
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               209   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             209   7e-58   Phaseolus vulgaris [French bean]
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    209   8e-58   Vitis vinifera
emb|CAA18137.1|  beta-galactosidase like protein                        209   8e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113483.1|  Beta-galactosidase 3                               209   9e-58   Morus notabilis
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                208   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    207   2e-57   Setaria italica
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               207   2e-57   Cicer arietinum [garbanzo]
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               207   2e-57   Glycine max [soybeans]
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       207   2e-57   Cucumis sativus [cucumbers]
gb|KHN00504.1|  Beta-galactosidase 3                                    207   2e-57   Glycine soja [wild soybean]
ref|NP_849506.1|  beta-galactosidase 3                                  207   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               207   3e-57   Oryza brachyantha
ref|XP_011100972.1|  PREDICTED: beta-galactosidase 3-like               207   4e-57   Sesamum indicum [beniseed]
gb|AAG12249.1|AF184080_1  beta-galactosidase                            199   5e-57   Prunus armeniaca
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 206   6e-57   Prunus mume [ume]
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             205   1e-56   Prunus persica
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    205   1e-56   
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    205   1e-56   Brachypodium distachyon [annual false brome]
ref|XP_003612092.1|  Beta-galactosidase                                 205   2e-56   Medicago truncatula
gb|ABR16628.1|  unknown                                                 204   3e-56   Picea sitchensis
gb|EMT10014.1|  Beta-galactosidase 5                                    204   5e-56   
ref|NP_001049068.1|  Os03g0165400                                       203   5e-56   
gb|AAM22973.1|AF499737_1  beta-galactosidase                            203   5e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEE58382.1|  hypothetical protein OsJ_09539                          203   6e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    203   8e-56   Fragaria vesca subsp. vesca
dbj|BAJ96054.1|  predicted protein                                      202   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP01954.1|  unnamed protein product                                202   1e-55   Coffea canephora [robusta coffee]
gb|EEC74580.1|  hypothetical protein OsI_10152                          202   1e-55   Oryza sativa Indica Group [Indian rice]
gb|KHN36067.1|  Beta-galactosidase 3                                    202   2e-55   Glycine soja [wild soybean]
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               202   2e-55   
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               202   2e-55   Glycine max [soybeans]
gb|KHN41933.1|  Beta-galactosidase 3                                    202   2e-55   Glycine soja [wild soybean]
gb|AGR44464.1|  beta-D-galactosidase 5                                  201   3e-55   Pyrus x bretschneideri [bai li]
gb|AHL69742.1|  beta-galactosidase                                      201   5e-55   Hylocereus undatus [dragon fruit]
dbj|BAK07157.1|  predicted protein                                      201   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               201   6e-55   Sesamum indicum [beniseed]
dbj|BAD91082.1|  beta-D-galactosidase                                   200   8e-55   Pyrus pyrifolia [sha li]
ref|NP_001168664.1|  uncharacterized protein LOC100382452               199   1e-54   Zea mays [maize]
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    199   2e-54   Zea mays [maize]
tpg|DAA43551.1|  TPA: beta-galactosidase                                199   2e-54   
ref|XP_002514109.1|  beta-galactosidase, putative                       199   2e-54   Ricinus communis
ref|XP_002306893.1|  beta-galactosidase family protein                  199   3e-54   Populus trichocarpa [western balsam poplar]
gb|AAW47739.1|  beta-galactosidase                                      199   3e-54   Prunus persica
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               198   3e-54   Solanum tuberosum [potatoes]
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    198   4e-54   Prunus mume [ume]
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               198   4e-54   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    198   4e-54   Populus euphratica
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    197   6e-54   Prunus mume [ume]
ref|NP_001234317.1|  TBG6 protein precursor                             197   7e-54   Solanum lycopersicum
gb|ADO34791.1|  beta-galactosidase STBG6                                197   8e-54   Solanum lycopersicum
gb|ADD62393.1|  beta-galactosidase 3                                    196   8e-54   Prunus persica
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             197   1e-53   Prunus persica
ref|XP_008388000.1|  PREDICTED: beta-galactosidase 5                    196   2e-53   
gb|EMS60063.1|  Beta-galactosidase 5                                    196   2e-53   Triticum urartu
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              196   2e-53   Vitis vinifera
emb|CAN78072.1|  hypothetical protein VITISV_013292                     196   3e-53   Vitis vinifera
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    196   3e-53   Vitis vinifera
emb|CBI19767.3|  unnamed protein product                                196   3e-53   Vitis vinifera
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    195   5e-53   Nicotiana tomentosiformis
ref|XP_002510455.1|  beta-galactosidase, putative                       195   7e-53   Ricinus communis
gb|AGR44466.1|  beta-D-galactosidase 7                                  194   7e-53   Pyrus x bretschneideri [bai li]
dbj|BAD91084.1|  beta-D-galactosidase                                   194   8e-53   Pyrus pyrifolia [sha li]
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    194   1e-52   Nicotiana sylvestris
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                194   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_008377189.1|  PREDICTED: beta-galactosidase 5-like               193   2e-52   
gb|ABK22678.1|  unknown                                                 184   5e-52   Picea sitchensis
ref|XP_012076925.1|  PREDICTED: beta-galactosidase-like                 191   8e-52   Jatropha curcas
ref|XP_009335672.1|  PREDICTED: beta-galactosidase 5                    191   1e-51   
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               191   1e-51   
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg             190   1e-51   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               191   2e-51   
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   189   2e-51   
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                   189   3e-51   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             189   6e-51   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   189   1e-50   
ref|XP_012071945.1|  PREDICTED: beta-galactosidase 5                    189   1e-50   
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               188   1e-50   
dbj|BAD91085.1|  beta-D-galactosidase                                   188   2e-50   
ref|XP_010672619.1|  PREDICTED: beta-galactosidase 5                    187   2e-50   
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               186   6e-50   
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               184   2e-49   
emb|CDP07463.1|  unnamed protein product                                183   1e-48   
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    182   3e-48   
gb|KDP33830.1|  hypothetical protein JCGZ_07401                         180   3e-48   
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               181   4e-48   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             181   7e-48   
ref|XP_010032010.1|  PREDICTED: beta-galactosidase 8                    181   8e-48   
gb|KJB65169.1|  hypothetical protein B456_010G082900                    179   1e-47   
ref|XP_012076926.1|  PREDICTED: beta-galactosidase-like                 179   2e-47   
ref|XP_010911712.1|  PREDICTED: beta-galactosidase 6-like               169   2e-47   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               179   2e-47   
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 5                    178   7e-47   
ref|XP_002456725.1|  hypothetical protein SORBIDRAFT_03g041450          177   9e-47   
gb|ERM97946.1|  hypothetical protein AMTR_s00117p00061070               168   1e-46   
gb|AFK47105.1|  unknown                                                 167   1e-46   
dbj|BAK02766.1|  predicted protein                                      177   2e-46   
gb|ACJ86219.1|  unknown                                                 165   4e-46   
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   176   5e-46   
gb|KJB43423.1|  hypothetical protein B456_007G198900                    175   5e-46   
gb|AEC33272.1|  beta-galactosidase                                      174   5e-46   
ref|XP_008359158.1|  PREDICTED: putative pentatricopeptide repeat...    172   5e-46   
ref|XP_006645099.1|  PREDICTED: beta-galactosidase 3-like               175   6e-46   
ref|XP_010232635.1|  PREDICTED: beta-galactosidase 3                    175   8e-46   
ref|XP_010313192.1|  PREDICTED: TBG5 protein isoform X1                 175   1e-45   
ref|XP_009335064.1|  PREDICTED: beta-galactosidase 8-like isoform X2    174   1e-45   
ref|NP_001234312.1|  TBG5 protein precursor                             174   2e-45   
dbj|BAD91083.1|  beta-D-galactosidase                                   174   2e-45   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 5-like               174   2e-45   
ref|XP_004962561.1|  PREDICTED: beta-galactosidase 15-like              174   3e-45   
dbj|BAA13685.1|  AR782                                                  163   3e-45   
ref|XP_011089891.1|  PREDICTED: beta-galactosidase 8-like isoform X1    173   4e-45   
gb|EEC71891.1|  hypothetical protein OsI_04635                          173   4e-45   
ref|XP_006645100.1|  PREDICTED: beta-galactosidase 3-like               172   6e-45   
ref|XP_008366360.1|  PREDICTED: beta-galactosidase 8-like               172   6e-45   
ref|XP_008385297.1|  PREDICTED: beta-galactosidase 8-like               172   6e-45   
dbj|BAF31232.1|  beta-D-galactosidase                                   172   7e-45   
ref|NP_001044964.1|  Os01g0875500                                       172   8e-45   
dbj|BAG95687.1|  unnamed protein product                                173   8e-45   
gb|KGN62231.1|  hypothetical protein Csa_2G337760                       172   1e-44   
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               172   1e-44   
ref|XP_010689565.1|  PREDICTED: beta-galactosidase 8                    171   1e-44   
ref|XP_004147332.1|  PREDICTED: beta-galactosidase 10                   171   1e-44   
ref|NP_001289207.1|  beta-galactosidase 8-like precursor                171   1e-44   
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   171   2e-44   
ref|XP_001753645.1|  predicted protein                                  172   2e-44   
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   171   2e-44   
emb|CAC44501.1|  beta-galactosidase                                     171   2e-44   
ref|XP_008227597.1|  PREDICTED: beta-galactosidase 10                   171   2e-44   
gb|ACJ83814.1|  unknown                                                 160   2e-44   
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             171   2e-44   
emb|CDP07127.1|  unnamed protein product                                171   2e-44   
ref|XP_010650317.1|  PREDICTED: beta-galactosidase 9 isoform X2         170   3e-44   
ref|XP_010107841.1|  Beta-galactosidase 3                               171   3e-44   
gb|KJB72045.1|  hypothetical protein B456_011G155500                    169   3e-44   
ref|XP_011089316.1|  PREDICTED: beta-galactosidase 8-like               170   4e-44   
ref|XP_007214623.1|  hypothetical protein PRUPE_ppa001345mg             169   4e-44   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               170   4e-44   
ref|XP_002310540.2|  beta-galactosidase family protein                  170   4e-44   
ref|XP_002518051.1|  beta-galactosidase, putative                       171   4e-44   
gb|EYU18852.1|  hypothetical protein MIMGU_mgv1a001263mg                170   4e-44   
gb|KJB72044.1|  hypothetical protein B456_011G155500                    170   5e-44   
gb|KJB72043.1|  hypothetical protein B456_011G155500                    170   7e-44   
ref|XP_010228859.1|  PREDICTED: beta-galactosidase 6                    169   8e-44   
ref|XP_002530296.1|  beta-galactosidase, putative                       169   8e-44   
gb|ERN18154.1|  hypothetical protein AMTR_s00054p00133410               169   8e-44   
gb|EYU31481.1|  hypothetical protein MIMGU_mgv1a001399mg                169   8e-44   
ref|XP_007034276.1|  Beta galactosidase 9 isoform 3                     168   8e-44   
gb|ABA97653.1|  Galactose binding lectin domain containing protei...    162   8e-44   
ref|XP_006340153.1|  PREDICTED: beta-galactosidase 8-like               169   8e-44   
ref|XP_011627921.1|  PREDICTED: beta-galactosidase 10                   169   8e-44   
gb|EEE53128.1|  hypothetical protein OsJ_35926                          162   9e-44   
ref|XP_012064843.1|  PREDICTED: beta-galactosidase 8                    169   9e-44   
ref|XP_003538054.1|  PREDICTED: beta-galactosidase 8-like               169   1e-43   
ref|XP_011461703.1|  PREDICTED: beta-galactosidase 8                    169   1e-43   
gb|EAY82933.1|  hypothetical protein OsI_38150                          162   1e-43   
gb|ABF95029.1|  Beta-galactosidase precursor, putative, expressed       168   1e-43   
tpg|DAA56579.1|  TPA: beta-galactosidase isoform 1                      169   1e-43   
ref|XP_002263385.1|  PREDICTED: beta-galactosidase 9 isoform X1         169   1e-43   
ref|XP_007214624.1|  hypothetical protein PRUPE_ppa001345mg             169   1e-43   
ref|XP_011101986.1|  PREDICTED: beta-galactosidase 9-like               169   1e-43   
ref|XP_011462809.1|  PREDICTED: beta-galactosidase 9                    167   1e-43   
emb|CBI17270.3|  unnamed protein product                                170   1e-43   
ref|XP_006649762.1|  PREDICTED: beta-galactosidase 6-like               168   2e-43   
gb|KJB55481.1|  hypothetical protein B456_009G078400                    169   2e-43   
ref|XP_007015424.1|  Beta-galactosidase 8 isoform 4                     168   2e-43   
dbj|BAB86232.1|  putative beta-D-galactosidase                          167   2e-43   
gb|KHG08626.1|  Beta-galactosidase 8 -like protein                      168   3e-43   
ref|XP_007015421.1|  Beta-galactosidase 8 isoform 1                     167   3e-43   
emb|CDX75569.1|  BnaA01g01330D                                          167   4e-43   
dbj|BAJ95568.1|  predicted protein                                      167   4e-43   
gb|ACN25553.1|  unknown                                                 157   4e-43   
ref|XP_007034274.1|  Beta galactosidase 9 isoform 1                     167   5e-43   
gb|ABF95028.1|  Beta-galactosidase precursor, putative, expressed       167   5e-43   
ref|NP_001151478.1|  LOC100285111 precursor                             167   5e-43   
gb|EAZ24672.1|  hypothetical protein OsJ_08441                          167   6e-43   
sp|Q10NX8.2|BGAL6_ORYSJ  RecName: Full=Beta-galactosidase 6; Shor...    167   7e-43   
ref|XP_003606403.1|  Beta-galactosidase                                 167   7e-43   
ref|XP_009766589.1|  PREDICTED: beta-galactosidase 8                    167   8e-43   
ref|NP_001049591.1|  Os03g0255100                                       167   8e-43   
ref|XP_007132215.1|  hypothetical protein PHAVU_011G075900g             166   9e-43   
ref|XP_010910537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    167   9e-43   
ref|XP_007227352.1|  hypothetical protein PRUPE_ppa001149mg             167   9e-43   
gb|EAY89299.1|  hypothetical protein OsI_10800                          166   1e-42   
dbj|BAJ89450.1|  predicted protein                                      166   1e-42   
ref|XP_004505982.1|  PREDICTED: beta-galactosidase 8-like               166   1e-42   
ref|XP_008225494.1|  PREDICTED: beta-galactosidase 8                    166   1e-42   
ref|XP_011044378.1|  PREDICTED: beta-galactosidase 8                    166   1e-42   
ref|XP_002314274.2|  beta-galactosidase family protein                  166   2e-42   
ref|XP_011620343.1|  PREDICTED: beta-galactosidase 9                    166   2e-42   
ref|XP_008222836.1|  PREDICTED: beta-galactosidase 9                    166   2e-42   
emb|CDP18451.1|  unnamed protein product                                164   2e-42   
ref|XP_007207302.1|  hypothetical protein PRUPE_ppa001480mg             165   2e-42   
ref|XP_008438342.1|  PREDICTED: beta-galactosidase 9 isoform X2         164   3e-42   
ref|XP_010274045.1|  PREDICTED: beta-galactosidase 9 isoform X2         165   3e-42   
ref|XP_006854486.1|  PREDICTED: beta-galactosidase 8                    165   4e-42   
gb|EMT18371.1|  Beta-galactosidase 6                                    163   4e-42   
ref|XP_012092087.1|  PREDICTED: beta-galactosidase 10                   165   4e-42   
gb|KCW54087.1|  hypothetical protein EUGRSUZ_I00065                     155   4e-42   
ref|XP_007132205.1|  hypothetical protein PHAVU_011G074900g             164   4e-42   
ref|XP_010098210.1|  Beta-galactosidase 8                               165   5e-42   
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   164   5e-42   
ref|XP_009780201.1|  PREDICTED: beta-galactosidase 9-like               155   5e-42   
ref|XP_010274044.1|  PREDICTED: beta-galactosidase 9 isoform X1         164   6e-42   
ref|XP_002862517.1|  hypothetical protein ARALYDRAFT_333310             162   6e-42   
gb|ABK24373.1|  unknown                                                 164   6e-42   
ref|XP_011072090.1|  PREDICTED: beta-galactosidase 10                   164   7e-42   
ref|XP_008791518.1|  PREDICTED: beta-galactosidase 6 isoform X2         164   7e-42   
ref|XP_004970751.1|  PREDICTED: beta-galactosidase 3-like               164   8e-42   
emb|CDX69219.1|  BnaC01g02340D                                          164   9e-42   
ref|XP_007132198.1|  hypothetical protein PHAVU_011G074300g             164   9e-42   
gb|AGR44461.1|  beta-D-galactosidase 2                                  164   9e-42   
ref|XP_007132236.1|  hypothetical protein PHAVU_011G077600g             164   9e-42   
ref|XP_008463829.1|  PREDICTED: beta-galactosidase 8                    164   1e-41   
ref|XP_008363504.1|  PREDICTED: beta-galactosidase 8-like               160   1e-41   
ref|XP_008791517.1|  PREDICTED: beta-galactosidase 6 isoform X1         163   1e-41   
ref|XP_010907798.1|  PREDICTED: beta-galactosidase 3 isoform X2         163   1e-41   
ref|XP_003635211.1|  PREDICTED: beta-galactosidase 6                    153   1e-41   
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         163   1e-41   
ref|XP_008438341.1|  PREDICTED: beta-galactosidase 9 isoform X1         163   1e-41   
gb|ERN14823.1|  hypothetical protein AMTR_s00032p00109160               163   1e-41   
emb|CDM85192.1|  unnamed protein product                                163   2e-41   
dbj|BAE72075.1|  pear beta-galactosidase3                               163   2e-41   
ref|XP_010907797.1|  PREDICTED: beta-galactosidase 3 isoform X1         163   2e-41   
ref|XP_008778218.1|  PREDICTED: beta-galactosidase 6-like               157   2e-41   
ref|XP_010253630.1|  PREDICTED: beta-galactosidase 8                    163   2e-41   
ref|XP_006853356.2|  PREDICTED: beta-galactosidase 8                    164   2e-41   
ref|XP_010243524.1|  PREDICTED: beta-galactosidase 10 isoform X1        163   2e-41   
emb|CDY59691.1|  BnaC07g51100D                                          157   2e-41   
ref|XP_009338266.1|  PREDICTED: beta-galactosidase 8-like isoform X2    161   2e-41   
emb|CDY59722.1|  BnaA03g59210D                                          152   2e-41   
ref|XP_008674433.1|  PREDICTED: beta-galactosidase 15 isoform X1        162   2e-41   
ref|XP_007048525.1|  Beta-galactosidase 3                               162   3e-41   
gb|AHC32021.1|  beta-galactosidase 3                                    162   3e-41   
ref|XP_009398591.1|  PREDICTED: beta-galactosidase 6-like               162   3e-41   
gb|KHN38778.1|  Beta-galactosidase 8                                    162   3e-41   
ref|XP_003538213.1|  PREDICTED: beta-galactosidase 8-like               162   3e-41   
gb|EMT22873.1|  Beta-galactosidase 3                                    162   3e-41   
ref|XP_009595284.1|  PREDICTED: beta-galactosidase 8                    162   4e-41   
gb|KFK32294.1|  hypothetical protein AALP_AA6G223900                    162   4e-41   
ref|NP_850121.1|  beta-galactosidase 8                                  162   5e-41   
emb|CAB64744.1|  putative beta-galactosidase                            162   5e-41   
ref|XP_010030277.1|  PREDICTED: beta-galactosidase 3-like               155   5e-41   
ref|NP_001189624.1|  beta-galactosidase 8                               162   5e-41   
gb|AAD21482.1|  putative beta-galactosidase                             162   5e-41   
dbj|BAD91079.1|  beta-D-galactosidase                                   162   5e-41   
ref|XP_006409871.1|  hypothetical protein EUTSA_v10016234mg             162   5e-41   
ref|NP_001235722.1|  lectin                                             158   5e-41   
ref|XP_010414520.1|  PREDICTED: beta-galactosidase 8                    161   5e-41   
ref|XP_002285084.2|  PREDICTED: beta-galactosidase 8                    161   5e-41   
ref|XP_004148770.1|  PREDICTED: beta-galactosidase 8                    161   6e-41   
gb|KDO52437.1|  hypothetical protein CISIN_1g0461461mg                  159   6e-41   
ref|XP_004984968.1|  PREDICTED: beta-galactosidase 6-like               161   7e-41   
ref|XP_008674434.1|  PREDICTED: beta-galactosidase 15 isoform X2        161   8e-41   
ref|XP_009338265.1|  PREDICTED: beta-galactosidase 8-like isoform X1    161   9e-41   
ref|XP_010510620.1|  PREDICTED: beta-galactosidase 8-like               161   9e-41   
gb|KHG01468.1|  Beta-galactosidase                                      160   1e-40   
ref|XP_004288998.1|  PREDICTED: beta-galactosidase 15-like              160   1e-40   
ref|XP_006351534.1|  PREDICTED: beta-galactosidase 3-like               160   1e-40   
ref|XP_006420948.1|  hypothetical protein CICLE_v10004268mg             159   2e-40   
ref|XP_004289502.1|  PREDICTED: beta-galactosidase 10                   160   2e-40   
gb|EMS56907.1|  Beta-galactosidase 15                                   158   2e-40   
ref|XP_008799173.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    160   2e-40   
gb|KHN31190.1|  Beta-galactosidase 10                                   160   2e-40   
gb|KDO73224.1|  hypothetical protein CISIN_1g003095mg                   159   3e-40   
ref|XP_003523206.1|  PREDICTED: beta-galactosidase 10                   159   3e-40   
ref|XP_002879094.1|  beta-glactosidase 8                                159   3e-40   
ref|NP_001289210.1|  beta-galactosidase 10 precursor                    159   3e-40   
ref|XP_006360940.1|  PREDICTED: beta-galactosidase 9-like               160   3e-40   
ref|XP_010522389.1|  PREDICTED: beta-galactosidase 9                    160   3e-40   
ref|XP_006296187.1|  hypothetical protein CARUB_v10025350mg             159   3e-40   
ref|XP_006493072.1|  PREDICTED: beta-galactosidase 9-like isoform X2    159   4e-40   
ref|NP_001066673.1|  Os12g0429200                                       159   4e-40   
ref|XP_008794977.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    158   4e-40   
ref|XP_006663996.1|  PREDICTED: beta-galactosidase 15-like              159   4e-40   
ref|XP_001775275.1|  predicted protein                                  159   4e-40   
ref|XP_003597217.1|  Beta-galactosidase                                 159   5e-40   
ref|XP_008358406.1|  PREDICTED: beta-galactosidase 8-like               159   5e-40   
ref|XP_009355857.1|  PREDICTED: beta-galactosidase 10                   159   6e-40   
gb|EMT06783.1|  Beta-galactosidase 15                                   156   7e-40   
ref|XP_006493071.1|  PREDICTED: beta-galactosidase 9-like isoform X1    159   7e-40   
ref|XP_004288329.1|  PREDICTED: beta-galactosidase 15-like              158   7e-40   
gb|KDO73221.1|  hypothetical protein CISIN_1g003095mg                   158   7e-40   
ref|XP_003629663.1|  Beta-galactosidase                                 159   7e-40   
ref|XP_006442891.1|  hypothetical protein CICLE_v10018839mg             158   7e-40   
emb|CDX67939.1|  BnaA07g19790D                                          148   8e-40   
ref|XP_010929758.1|  PREDICTED: beta-galactosidase 15 isoform X3        157   8e-40   
gb|AET04139.2|  beta-galactosidase                                      159   8e-40   
ref|XP_006420947.1|  hypothetical protein CICLE_v10004268mg             159   8e-40   



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    CS CNYAGWF E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  658  GRYWPGYKA-TGSCSACNYAGWFYEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVVFEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNPYGISL+KR++ SVCA +FEWQP L+NW++QASGK  R LRPK HLSC  G K I++
Sbjct  717  GGNPYGISLVKRQVGSVCADIFEWQPTLVNWQLQASGKVNRPLRPKAHLSCSPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG F+QGSCHAFHS+DIFEKYC+G  SC+VPV PEAFGGDPCP+VMKK
Sbjct  776  IKFASFGTPEGVCGSFRQGSCHAFHSYDIFEKYCIGQQSCSVPVVPEAFGGDPCPSVMKK  835

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  836  LSVEVICS  843



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWFDE+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  655  GRYWPGYKASGN-CGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQL+NW+MQASGK +R LRPK HLSC  G K I++
Sbjct  714  GGEPHGISLVKREVASVCADINEWQPQLVNWQMQASGKVDRPLRPKAHLSCASGQK-ISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  773  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  832

Query  275  VAVEVVCS  252
            ++VEVVCS
Sbjct  833  LSVEVVCS  840



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWFDE+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  656  GRYWPGYKASGN-CGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQL+NW+MQASGK +R LRPK HLSC  G K I++
Sbjct  715  GGEPHGISLVKREVASVCADINEWQPQLVNWQMQASGKVDRPLRPKAHLSCASGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  774  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  833

Query  275  VAVEVVCS  252
            ++VEVVCS
Sbjct  834  LSVEVVCS  841



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWFDE+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  655  GRYWPGYKASGN-CGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQL+NW+MQASGK +R LRPK HLSC  G K I++
Sbjct  714  GGEPHGISLVKREVASVCADINEWQPQLVNWQMQASGKVDRPLRPKAHLSCASGQK-ISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  773  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  832

Query  275  VAVEVVCS  252
            ++VEVVCS
Sbjct  833  LSVEVVCS  840



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWF+E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  653  GRYWPGYKASGN-CGACNYAGWFNEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQL+NW+MQASGK ++ LRPK HLSC  G K IT+
Sbjct  712  GGEPHGISLVKREVASVCADINEWQPQLVNWQMQASGKVDKPLRPKAHLSCASGQK-ITS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  771  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  830

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  831  LSVEVICS  838



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 167/188 (89%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWF+E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  653  GRYWPGYKASGN-CGACNYAGWFNEKKCLSNCGEASQRWYHVPRSWLYPTGNLLVLFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQL+NW+MQASGK ++ LRPK HLSC  G K IT+
Sbjct  712  GGEPHGISLVKREVASVCADINEWQPQLVNWQMQASGKVDKPLRPKAHLSCAPGQK-ITS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  771  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  830

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  831  LSVEVICS  838



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 161/188 (86%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W   KA  D C  CNYAGWF+E+KCL NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  657  GRYWNQYKASGD-CVPCNYAGWFNEKKCLGNCGEASQRWYHVPRSWLYPTGNLLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNPY ISL+KRE+ASVCA +FEWQP L+NW+M ASG+  + LRPK HLSC  G K I++
Sbjct  716  GGNPYEISLVKREVASVCADIFEWQPTLVNWQMLASGEVNKPLRPKAHLSCASGQK-ISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CGDF+QGSCHAFHS+D+FE+YCVG  SCTVPVTPE FGGDPCPN+MKK
Sbjct  775  IKFASFGTPEGVCGDFRQGSCHAFHSYDVFERYCVGQQSCTVPVTPEIFGGDPCPNIMKK  834

Query  275  VAVEVVCS  252
            + VE VCS
Sbjct  835  LFVEAVCS  842



>gb|EYU45851.1| hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata]
Length=689

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W   KA  + C  CNYAGWF+E+KCL+NCGEASQRWYH+PRSWL PTGNLLV+FEEW
Sbjct  504  GRYWNQYKASGN-CGACNYAGWFNEKKCLTNCGEASQRWYHIPRSWLYPTGNLLVVFEEW  562

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNPYGISL+KRE+ASVCA ++EWQP L+NW++Q+SGK  + LRPK HLSC   G+ I++
Sbjct  563  GGNPYGISLVKREVASVCADIYEWQPTLVNWQLQSSGKVNKPLRPKAHLSC-DAGQKISS  621

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG+F++G+CHAFHS+D+FEKYCVG  SCTVPVTPE FGGDPCP+VMKK
Sbjct  622  IKFASFGTPQGSCGNFREGNCHAFHSYDVFEKYCVGQESCTVPVTPEIFGGDPCPSVMKK  681

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  682  LSVEAICS  689



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   303 bits (776),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W   KA  + C  CNYAGWF+E+KCLSNCG+ASQRWYHVPRSWLRPTGNLLV+ EEW
Sbjct  657  GRYWNEYKASGN-CGACNYAGWFNEKKCLSNCGKASQRWYHVPRSWLRPTGNLLVVLEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNPYGISL+KRE+ASVCA ++EWQP L+NW++QASGK  + LRPK HLSC  G K I++
Sbjct  716  GGNPYGISLVKREVASVCADIYEWQPTLVNWQLQASGKVNKPLRPKAHLSCAAGQK-ISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG+FQ+GSCHAFHS+D+FE+YC+G  SCTVPVTPE FGGDPCP+VMKK
Sbjct  775  IKFASFGTPQGSCGNFQEGSCHAFHSYDVFERYCIGQQSCTVPVTPEIFGGDPCPSVMKK  834

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  835  LSVEAICS  842



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  CNYAGWF+E+KCLSNCGEASQR YHVPRSWL PTGNLLV+FEE 
Sbjct  653  GRYWPGYKASGN-CGACNYAGWFNEKKCLSNCGEASQRMYHVPRSWLYPTGNLLVLFEES  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P+GISL+KRE+ASVCA + EWQPQLMNW+MQASGK ++ LRPK HLSC  G K IT+
Sbjct  712  GGEPHGISLVKREVASVCADINEWQPQLMNWQMQASGKVDKPLRPKAHLSCASGQK-ITS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHAFHS+D FE+YC+G NSC+VPVTPE FGGDPCP+VMKK
Sbjct  771  IKFASFGTPQGVCGSFREGSCHAFHSYDAFERYCIGQNSCSVPVTPEIFGGDPCPHVMKK  830

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  831  LSVEVICS  838



>gb|EYU21377.1| hypothetical protein MIMGU_mgv1a001631mg [Erythranthe guttata]
Length=782

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W   KA  + C  CNY GWFDE+KCLS C EASQRWYHVPRSWLRP+GNLLV+FEEW
Sbjct  597  GRYWNQYKASGE-CVPCNYTGWFDEKKCLSKCDEASQRWYHVPRSWLRPSGNLLVVFEEW  655

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL+KRE+ SVCA ++EWQP LMNW+MQ+SGK  +ALRPK HLSC  G K I++
Sbjct  656  GGNPNGISLVKREVESVCADIYEWQPNLMNWQMQSSGKVTKALRPKAHLSCAPGQK-ISS  714

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG F+QGSCHAFHS+D+FE+YCVG  SC+VP+TPE FGGDPCPN+MKK
Sbjct  715  VKFASFGTPEGACGSFRQGSCHAFHSYDVFERYCVGQQSCSVPITPEIFGGDPCPNIMKK  774

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  775  LSVEAVCS  782



>gb|KCW69754.1| hypothetical protein EUGRSUZ_F031301, partial [Eucalyptus grandis]
Length=291

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C+ CNY G F+E KCLSNCGEASQRWYH+PRSWL PTGNLLV+ EEW
Sbjct  106  GRYWPAYKASGT-CNSCNYTGTFNENKCLSNCGEASQRWYHIPRSWLYPTGNLLVVLEEW  164

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P GISL+KREI SVC+ +FEWQP LMNW+MQASGK  + LRPKVHL C   G+ I++
Sbjct  165  GGEPNGISLVKREIDSVCSDIFEWQPTLMNWQMQASGKVTKPLRPKVHLWCSP-GQQISS  223

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FASFGTPEG CG F+QGSCHAFHS+D+FE+ C+G NSC+V V PE FGGDPCPNVMKK
Sbjct  224  IRFASFGTPEGTCGSFRQGSCHAFHSYDVFERTCLGLNSCSVTVAPEIFGGDPCPNVMKK  283

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  284  LSVEAVCS  291



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   297 bits (760),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 161/188 (86%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  CNYAG F+E+KCLSNCG+ASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  657  GRYWPGYKA-SGTCDACNYAGPFNEKKCLSNCGDASQRWYHVPRSWLHPTGNLLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KRE+ASVCA + EWQPQL+NW++QASGK ++ LRPK HLSC  G K IT+
Sbjct  716  GGDPNGISLVKRELASVCADINEWQPQLVNWQLQASGKVDKPLRPKAHLSCTSGQK-ITS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F +GSCHA HS+D FEKYC+G  SCTVPVTPE FGGDPCP+VMKK
Sbjct  775  IKFASFGTPQGVCGSFSEGSCHAHHSYDAFEKYCIGQESCTVPVTPEIFGGDPCPSVMKK  834

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  835  LSVEAVCS  842



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =   294 bits (753),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  CNYAG+F+E KC SNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  657  GRYWPGYKA-SGTCGACNYAGYFNEDKCQSNCGEASQRWYHVPRSWLHPTGNLLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KRE+ASVCA + EWQPQL+NW+MQASGK ++ LRP+ HLSC  G K IT+
Sbjct  716  GGDPNAISLIKRELASVCADINEWQPQLVNWQMQASGKVDKPLRPRAHLSCAPGQK-ITS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F++GSCHA HS+D FEKYC+G  SCTVPVTPE FGGDPCP VMKK
Sbjct  775  IKFASFGTPQGVCGSFREGSCHAHHSYDAFEKYCIGQESCTVPVTPEIFGGDPCPGVMKK  834

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  835  LSVEAICS  842



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   293 bits (751),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG + E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  659  GRYWPAYKA-SGTCGGCNYAGTYGEKKCLSNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  717

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++R++ SVCA ++EWQP LMN++MQASGK  + LRPK HLSC  G K I++
Sbjct  718  GGDPNGISLVRRDVDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKAHLSCSPGQK-ISS  776

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEGICG F++GSCHAFHS+D+F+K CVG NSCTVPVTPE FGGDPCP+VMKK
Sbjct  777  IKFASFGTPEGICGSFREGSCHAFHSYDVFQKTCVGQNSCTVPVTPEIFGGDPCPSVMKK  836

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  837  LSVEAICS  844



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =   293 bits (750),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG K+  + C+ C Y GWFDE+KCLSNCGE SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  659  GRHWPGYKSSGN-CTACYYTGWFDEKKCLSNCGEGSQRWYHVPRSWLHPTGNLLVVFEEW  717

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+PYGI+L+KREIASVCA ++EWQPQL+NW+  ASGK +R LRPK HL C  G K I++
Sbjct  718  GGDPYGITLVKREIASVCADIYEWQPQLLNWQRLASGKFDRPLRPKAHLRCAPGQK-ISS  776

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG FQQGSCHA HS+D FEK CVG  SC+V VTPE FGGDPC NV+KK
Sbjct  777  IKFASFGTPEGVCGSFQQGSCHARHSYDAFEKNCVGQESCSVSVTPENFGGDPCRNVLKK  836

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  837  LSVEAICS  844



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =   291 bits (746),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  CNYAG+F E KC SNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  659  GRYWPGYKA-SGTCGACNYAGFFSEDKCQSNCGEASQRWYHVPRSWLHPTGNLLVVFEEW  717

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KRE+ASVCA + EWQPQL+NW+MQASGK ++ LRP+ HLSC  G K IT+
Sbjct  718  GGDPNAISLVKRELASVCADINEWQPQLVNWQMQASGKVDKPLRPRAHLSCAPGQK-ITS  776

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFG+P+G+CG F++GSCHA HS+D FEKYC+G  SCTVPVTPE FGGDPCP VMKK
Sbjct  777  IKFASFGSPQGVCGSFREGSCHAHHSYDAFEKYCIGQESCTVPVTPEIFGGDPCPGVMKK  836

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  837  LSVEAICS  844



>ref|XP_012068994.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 1-like [Jatropha 
curcas]
Length=841

 Score =   291 bits (745),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  K+  D C FCNYAG ++E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  656  GRYWPAYKSSGD-CGFCNYAGTYNEKKCLSNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN+ MQASGK ++ LRPKVHL CG G K I++
Sbjct  715  GGDPNGISLVRREVDSVCADIYEWQPTLMNYMMQASGKVDKPLRPKVHLQCGTGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG ++QGSCHAFHS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  774  IKFASFGTPEGACGGYRQGSCHAFHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            +AVE VCS
Sbjct  834  LAVEAVCS  841



>gb|KDO65276.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=618

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  433  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  491

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  492  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  550

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP++MK+
Sbjct  551  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQ  610

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  611  LAVEAIC  617



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG K+    CS CNYAG+F+E KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  656  GRYWPGYKS-SGTCSACNYAGYFNENKCLSNCGEASQRWYHVPRSWLHPTGNLLVVFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KRE+ASVCA + EWQPQL+N++MQASG+ +R LRPK HL C  G K IT+
Sbjct  715  GGDPNAISLVKRELASVCADINEWQPQLVNYKMQASGEVDRPLRPKAHLRCATGQK-ITS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G+CG F +GSCHA HS+D FEKYC+G  SC+VPVTPE FGGDPCP VMKK
Sbjct  774  IKFASFGTPVGVCGSFSEGSCHAHHSYDAFEKYCIGQESCSVPVTPEIFGGDPCPGVMKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEALCS  841



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =   288 bits (737),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  K+  + C+ CNY GWFDE+KCLSNCGE SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  660  GRHWPAYKSSGN-CTACNYKGWFDEKKCLSNCGEGSQRWYHVPRSWLHPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+PYGI+L+KRE+ASVCA ++EWQPQL+NW+  ASGK +R LRPK HL C  G K I++
Sbjct  719  GGDPYGITLVKREVASVCADIYEWQPQLLNWQRLASGKFDRPLRPKAHLRCAPGQK-ISS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG FQQGSCHA  S+D FEK CVG   C+V VTPE FGGDPC NV+KK
Sbjct  778  IKFASFGTPEGVCGSFQQGSCHARRSYDAFEKNCVGQEFCSVSVTPENFGGDPCRNVLKK  837

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  838  LSVEAICS  845



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =   288 bits (736),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C+ CNY G F+E KCLSNCGEASQRWYH+PRSWL PTGNLLV+ EEW
Sbjct  640  GRYWPAYKA-SGTCNSCNYTGTFNENKCLSNCGEASQRWYHIPRSWLYPTGNLLVVLEEW  698

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P GISL+KREI SVC+ +FEWQP LMNW+MQASGK  + LRPKVHL C   G+ I++
Sbjct  699  GGEPNGISLVKREIDSVCSDIFEWQPTLMNWQMQASGKVTKPLRPKVHLWCSP-GQQISS  757

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FASFGTPEG CG F+QGSCHAFHS+D+FE+ C+G NSC+V V PE FGGDPCPNVMKK
Sbjct  758  IRFASFGTPEGTCGSFRQGSCHAFHSYDVFERTCLGLNSCSVTVAPEIFGGDPCPNVMKK  817

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  818  LSVEAVCS  825



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  K+    CS CNY GWFDE+KCL+NCGE SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  654  GRHWPAYKS-SGSCSVCNYTGWFDEKKCLTNCGEGSQRWYHVPRSWLYPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+PYGI+L+KREIASVCA ++EWQPQL+NW+   SGK +R LRPKVHL C  G K I++
Sbjct  713  GGDPYGITLVKREIASVCANIYEWQPQLLNWQRLVSGKFDRPLRPKVHLKCAPGQK-ISS  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G+CG FQQGSCHA  S+D F+K CVG  SC+V VTPE FGGDPC NV+KK
Sbjct  772  IKFASFGTPGGVCGSFQQGSCHAPRSYDAFKKNCVGQESCSVQVTPENFGGDPCRNVLKK  831

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  832  LSVEAICS  839



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  K+    CS CNY GWFDE+KCL+NCGE SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  650  GRHWPAYKS-SGSCSVCNYTGWFDEKKCLTNCGEGSQRWYHVPRSWLYPTGNLLVVFEEW  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+PYGI+L+KREI SVCA ++EWQPQL+NW+   SGK +R LRPK HL C  G K I++
Sbjct  709  GGDPYGITLVKREIGSVCADIYEWQPQLLNWQRLVSGKFDRPLRPKAHLKCAPGQK-ISS  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG+FQQGSCHA  S+D F+K CVG  SC+V VTPE FGGDPC NV+KK
Sbjct  768  IKFASFGTPEGVCGNFQQGSCHAPRSYDAFKKNCVGKESCSVQVTPENFGGDPCRNVLKK  827

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  828  LSVEAICS  835



>ref|XP_006466038.1| PREDICTED: beta-galactosidase 1-like [Citrus sinensis]
Length=845

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  660  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  719  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP+VMK+
Sbjct  778  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSVMKQ  837

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  838  LAVEAIC  844



>ref|XP_010542431.1| PREDICTED: beta-galactosidase 1-like [Tarenaya hassleriana]
Length=847

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    CS C+YAG FDE KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  662  GRYWPAYKA-SGSCSECSYAGSFDENKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN+EMQASGK  + LRPKVHL CG G K ++A
Sbjct  721  GGDPNGISLVRREVDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKVHLQCGDGQK-MSA  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG +++GSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  780  VKFASFGTPEGTCGSYREGSCHALHSYDAFNRVCVGQNWCSVTVAPEMFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            +AVEVVCS
Sbjct  840  LAVEVVCS  847



>ref|XP_006426534.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39774.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=846

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  661  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  720  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP++MK+
Sbjct  779  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQ  838

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  839  LAVEAIC  845



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  660  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  719  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP++MK+
Sbjct  778  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQ  837

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  838  LAVEAIC  844



>gb|KDO65274.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=845

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  660  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  719  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP++MK+
Sbjct  778  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQ  837

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  838  LAVEAIC  844



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   286 bits (733),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG K+    CS CNYAG+F+E KCLSNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  681  GRYWPGYKS-SGTCSACNYAGYFNENKCLSNCGEASQRWYHVPRSWLHPTGNLLVVFEEW  739

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KRE+ASVCA + EWQPQL+N++MQASG+ +R LRPK HL C  G K IT+
Sbjct  740  GGDPNAISLVKRELASVCADINEWQPQLVNYKMQASGEVDRPLRPKAHLRCAPGQK-ITS  798

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G+CG F +GSC A HS+D FEKYC+G  SC+VPVTPE FGGDPCP VMKK
Sbjct  799  IKFASFGTPVGVCGSFSEGSCRAHHSYDAFEKYCIGKESCSVPVTPEIFGGDPCPGVMKK  858

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  859  LSVEALCS  866



>gb|KDO65275.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=872

 Score =   286 bits (732),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  687  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  745

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  746  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  804

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ CVG N CTV V PE FGGDPCP++MK+
Sbjct  805  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRLCVGQNMCTVTVAPEMFGGDPCPSIMKQ  864

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  865  LAVEAIC  871



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   285 bits (730),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR++P  KA  + C  C+YAG F+E+KCLSNCGEASQ+WYHVPRSWL PTGNLLV+FEEW
Sbjct  650  GRYYPAYKASGN-CGACSYAGSFNEKKCLSNCGEASQKWYHVPRSWLYPTGNLLVVFEEW  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNPYGISL+KRE++SVCA ++EWQP L+NW++Q+SGK  + LRPK HLSC   G+ I++
Sbjct  709  GGNPYGISLVKREVSSVCADIYEWQPTLVNWQLQSSGKVSKPLRPKAHLSCAP-GQRISS  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG+F+QG CHAFHS+D FE YC+G  +C+V V P  FGGDPCPNVMKK
Sbjct  768  IKFASFGTPEGTCGNFRQGGCHAFHSYDAFETYCIGQQTCSVTVAPALFGGDPCPNVMKK  827

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  828  LSVEAVCS  835



>gb|KJB17254.1| hypothetical protein B456_003G0595002 [Gossypium raimondii]
Length=695

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + CS CNYAG +DE KC +NC EASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  510  GRHWPAYKASGN-CSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGNLLVVIEEW  568

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++RE  SVCA ++EWQP LMN++M ASGKA++ LRPKVHL C  G K I+A
Sbjct  569  GGDPNAISLVRRETDSVCADIYEWQPTLMNYQMHASGKADKPLRPKVHLECDMGQK-ISA  627

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KF SFGTPEG+CG +++GSCHA+HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  628  VKFVSFGTPEGVCGSYREGSCHAYHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  687

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  688  LSVEVICS  695



>gb|KJB17255.1| hypothetical protein B456_003G0595002, partial [Gossypium raimondii]
Length=692

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + CS CNYAG +DE KC +NC EASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  507  GRHWPAYKASGN-CSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGNLLVVIEEW  565

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++RE  SVCA ++EWQP LMN++M ASGKA++ LRPKVHL C  G K I+A
Sbjct  566  GGDPNAISLVRRETDSVCADIYEWQPTLMNYQMHASGKADKPLRPKVHLECDMGQK-ISA  624

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KF SFGTPEG+CG +++GSCHA+HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  625  VKFVSFGTPEGVCGSYREGSCHAYHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  684

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  685  LSVEVICS  692



>ref|XP_002527409.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF34975.1| beta-galactosidase, putative [Ricinus communis]
Length=845

 Score =   283 bits (723),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA  + C  CNYAG F+E+KCL+NCGEASQRWYHVPRSWL   GNLLV+FEEW
Sbjct  660  GRYWPAYKASGN-CGVCNYAGTFNEKKCLTNCGEASQRWYHVPRSWLNTAGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN+ MQ+SGK  + LRPKVHL CG G K I+ 
Sbjct  719  GGDPNGISLVRREVDSVCADIYEWQPTLMNYMMQSSGKVNKPLRPKVHLQCGAGQK-ISL  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG ++QGSCHAFHS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  778  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  837

Query  275  VAVEVVCS  252
            +AVE VCS
Sbjct  838  LAVEAVCS  845



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + CS CNYAG +DE KC +NCGEASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  658  GRHWPAYKASGN-CSVCNYAGTYDEYKCRTNCGEASQRWYHVPRSWLNPTGNLLVVIEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+ RE  SVCA ++EWQP LMN++M ASGKA++ LRPKVHL C  G K I+A
Sbjct  717  GGDPNAISLVHRETDSVCADIYEWQPTLMNYQMHASGKADKPLRPKVHLECDMGQK-ISA  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA+HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  776  VKFASFGTPEGVCGSYREGSCHAYHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  835

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  836  LSVEVICS  843



>dbj|BAD95407.1| galactosidase [Arabidopsis thaliana]
Length=270

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  85   GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  143

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PK HL CG G K IT 
Sbjct  144  GGDPNGITLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKAHLQCGPGQK-ITT  202

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  203  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  262

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  263  LAVEAVCA  270



>gb|KJB70255.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=690

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  C+YAG F+E+KC +NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  505  GRHWPAYKASGN-CGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  563

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE  SVCA ++EWQP LMN+ M+ASGK  + LRPKVHL C   G+ I+A
Sbjct  564  GGDPNGITLVRRETDSVCADIYEWQPNLMNYLMKASGKVNKPLRPKVHLEC-DAGQKISA  622

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  623  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  682

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  683  LSVEVICS  690



>ref|XP_011000791.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=846

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = -1

Query  821  QH-GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIF  645
            QH GRHWP  KA    C  C+Y G + E+KC +NCGEASQRWYHVP+SWL+PTGNLLV+F
Sbjct  658  QHVGRHWPAYKA-SGTCGDCSYIGTYSEKKCSTNCGEASQRWYHVPQSWLKPTGNLLVVF  716

Query  644  EEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKN  465
            EEWGG+P GISL++R++ SVCA ++EWQP LMN+EMQASGK  + LRPK HLSCG G K 
Sbjct  717  EEWGGDPNGISLVRRDVDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKAHLSCGPGQK-  775

Query  464  ITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNV  285
            I +IKFASFGTPEG+CG ++QGSCHAFHS+D F   CVG NSC+V V PE FGGDPC NV
Sbjct  776  IRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCLNV  835

Query  284  MKKVAVEVVCS  252
            MKK+AVE +CS
Sbjct  836  MKKLAVEAICS  846



>gb|ABK96254.1| unknown [Populus trichocarpa x Populus deltoides]
Length=846

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -1

Query  821  QH-GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIF  645
            QH GRHWP  KA    C  C+Y G ++E+KC +NCGEASQRWYHVP+SWL+PTGNLLV+F
Sbjct  658  QHVGRHWPAYKA-SGTCGDCSYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGNLLVVF  716

Query  644  EEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKN  465
            EEWGG+P GISL++R++ SVCA ++EWQP LMN++MQASGK  + LRPK HLSCG G K 
Sbjct  717  EEWGGDPNGISLVRRDVDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKAHLSCGPGQK-  775

Query  464  ITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNV  285
            I +IKFASFGTPEG+CG ++QGSCHAFHS+D F   CVG NSC+V V PE FGGDPC NV
Sbjct  776  IRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCLNV  835

Query  284  MKKVAVEVVCS  252
            MKK+AVE +CS
Sbjct  836  MKKLAVEAICS  846



>ref|XP_006385360.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP63157.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=846

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -1

Query  821  QH-GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIF  645
            QH GRHWP  KA    C  C+Y G ++E+KC +NCGEASQRWYHVP+SWL+PTGNLLV+F
Sbjct  658  QHVGRHWPAYKA-SGTCGDCSYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGNLLVVF  716

Query  644  EEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKN  465
            EEWGG+P GISL++R++ SVCA ++EWQP LMN++MQASGK  + LRPK HLSCG G K 
Sbjct  717  EEWGGDPNGISLVRRDVDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKAHLSCGPGQK-  775

Query  464  ITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNV  285
            I +IKFASFGTPEG+CG ++QGSCHAFHS+D F   CVG NSC+V V PE FGGDPC NV
Sbjct  776  IRSIKFASFGTPEGVCGSYRQGSCHAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCLNV  835

Query  284  MKKVAVEVVCS  252
            MKK+AVE +CS
Sbjct  836  MKKLAVEAICS  846



>ref|XP_006369293.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP65862.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=837

 Score =   278 bits (711),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 3/191 (2%)
 Frame = -1

Query  821  QH-GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIF  645
            QH GRHWP  KA    C  C Y G ++E KC +NCGEASQRWYHVP+SWL+PTGNLLV+F
Sbjct  649  QHVGRHWPAYKA-SGTCGECTYIGTYNENKCSTNCGEASQRWYHVPQSWLKPTGNLLVVF  707

Query  644  EEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKN  465
            EEWGG+P G+SL++RE+ SVCA ++EWQP LMN++MQASGK  + LRPK HLSCG G K 
Sbjct  708  EEWGGDPNGVSLVRREVDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKAHLSCGPGQK-  766

Query  464  ITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNV  285
            I +IKFASFGTPEG+CG + QGSCHAFHS+D F   CVG NSC+V V PE FGGDPCP+V
Sbjct  767  IRSIKFASFGTPEGVCGSYNQGSCHAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCPSV  826

Query  284  MKKVAVEVVCS  252
            MKK+A E +CS
Sbjct  827  MKKLAAEAICS  837



>ref|XP_011010891.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=845

 Score =   278 bits (711),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = -1

Query  821  QH-GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIF  645
            QH GRHWP  KA    C  C Y G ++E+KC +NCGEASQRWYHVP+SWL+PTGNLLV+F
Sbjct  657  QHVGRHWPAYKA-SGTCGECTYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGNLLVVF  715

Query  644  EEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKN  465
            EEWGG+P G+SL++RE+ SVCA ++EWQP LMN++M+ASGK  + LRPK HLSCG G K 
Sbjct  716  EEWGGDPNGVSLVRREVDSVCADIYEWQPTLMNYQMRASGKVNKPLRPKAHLSCGPGQK-  774

Query  464  ITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNV  285
            I +IKFASFGTPEG+CG++ QGSCHAFHS+D F   CVG NSC+V V PE FGGDPCP+V
Sbjct  775  IRSIKFASFGTPEGVCGNYHQGSCHAFHSYDAFNNLCVGQNSCSVTVAPEMFGGDPCPSV  834

Query  284  MKKVAVEVVCS  252
            MKK+A E +CS
Sbjct  835  MKKLAAEAICS  845



>gb|KJB70254.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=784

 Score =   277 bits (708),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  C+YAG F+E+KC +NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  599  GRHWPAYKASGN-CGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  657

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE  SVCA ++EWQP LMN+ M+ASGK  + LRPKVHL C   G+ I+A
Sbjct  658  GGDPNGITLVRRETDSVCADIYEWQPNLMNYLMKASGKVNKPLRPKVHLEC-DAGQKISA  716

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  717  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  776

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  777  LSVEVICS  784



>gb|KJB70251.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=846

 Score =   278 bits (710),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  C+YAG F+E+KC +NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  661  GRHWPAYKASGN-CGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE  SVCA ++EWQP LMN+ M+ASGK  + LRPKVHL C   G+ I+A
Sbjct  720  GGDPNGITLVRRETDSVCADIYEWQPNLMNYLMKASGKVNKPLRPKVHLEC-DAGQKISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  839  LSVEVICS  846



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+YAG ++E+KCLSNCG+ASQRWYHVP+SWL+PTGNLLV+FEEW
Sbjct  660  GRYWPAYKA-QGSCGGCDYAGTYNEKKCLSNCGDASQRWYHVPKSWLKPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P G+ L++R++ +VCA ++EWQP LMNW+MQ+SGK ++ LRPK HLSCG  G+ I+ 
Sbjct  719  GGDPNGVFLVRRDVDTVCADIYEWQPTLMNWQMQSSGKVDKPLRPKAHLSCG-AGQKISK  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++GSCHA HS+D FE+ CVG NSC+V V  E FGGDPCP+VMKK
Sbjct  778  IKFASFGTPEGACGSFREGSCHAHHSYDAFERLCVGQNSCSVTVAAEMFGGDPCPSVMKK  837

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  838  LSVEAICT  845



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG F E+KCLSNCGEASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  658  GRYWPAYKA-SGTCGECNYAGTFSEKKCLSNCGEASQRWYHVPRSWLNPTGNLLVVLEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++RE+ SVCA ++EWQP LM+W+MQ SG+  + LRPK HLSCG G K I++
Sbjct  717  GGDPNGIFLVRREVDSVCADIYEWQPNLMSWQMQVSGRVNKPLRPKAHLSCGPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG F++G CHA  S++ FE+ C+G NSC+V V+PE FGGDPCPNVMKK
Sbjct  776  IKFASFGTPEGVCGSFREGGCHAHKSYNAFERSCIGQNSCSVTVSPENFGGDPCPNVMKK  835

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  836  LSVEAICS  843



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG + E+KCLSNCGEASQRWYHVPR+WL PTGNLLV+ EEW
Sbjct  656  GRYWPAYKA-SGSCGACNYAGTYHEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++REI S+CA ++EWQP LM+W+MQASGK ++ +RPK HLSCG G K I++
Sbjct  715  GGDPNGIFLVRREIDSICADIYEWQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++GSCHA +S+D F++ C+G NSC+V V PE FGGDPCPNVMKK
Sbjct  774  IKFASFGTPEGGCGSFREGSCHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG + E+KCLSNCGEASQRWYHVPR+WL PTGNLLV+ EEW
Sbjct  656  GRYWPAYKA-SGSCGACNYAGTYHEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++REI S+CA ++EWQP LM+W+MQASGK ++ +RPK HLSCG G K I++
Sbjct  715  GGDPNGIFLVRREIDSICADIYEWQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++GSCHA +S+D F++ C+G NSC+V V PE FGGDPCPNVMKK
Sbjct  774  IKFASFGTPEGGCGSFREGSCHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>gb|KJB56893.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=806

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  CNYAG F E KC +NCGEASQRWYHVPRSWL PTGNLLV+FEE 
Sbjct  621  GRHWPAYKASGN-CGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEES  679

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE  SVCA ++EWQP LMN+EMQASGK  + LRPKVHL C   G+ I+A
Sbjct  680  GGDPNGISLVRRETDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKVHLEC-DAGQKISA  738

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + C+G N CTV V PE FGGDPCP+VMKK
Sbjct  739  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCLGQNFCTVTVAPEMFGGDPCPSVMKK  798

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  799  LSVEVICS  806



>gb|KJB56892.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=845

 Score =   275 bits (704),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  CNYAG F E KC +NCGEASQRWYHVPRSWL PTGNLLV+FEE 
Sbjct  660  GRHWPAYKASGN-CGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEES  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE  SVCA ++EWQP LMN+EMQASGK  + LRPKVHL C   G+ I+A
Sbjct  719  GGDPNGISLVRRETDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKVHLEC-DAGQKISA  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + C+G N CTV V PE FGGDPCP+VMKK
Sbjct  778  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCLGQNFCTVTVAPEMFGGDPCPSVMKK  837

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  838  LSVEVICS  845



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG + E+KCLSNCGEASQRWYHVPR+WL PTGNLLV+ EEW
Sbjct  656  GRYWPAYKA-SGSCGACNYAGSYHEKKCLSNCGEASQRWYHVPRTWLNPTGNLLVVLEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++REI S+CA ++EWQP LM+W+MQASGK ++ +RPK HLSCG G K I++
Sbjct  715  GGDPNGIFLVRREIDSICADIYEWQPNLMSWQMQASGKVKKPVRPKAHLSCGPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++GSCHA +S+D F++ C+G NSC+V V PE FGGDPCPNVMKK
Sbjct  774  IKFASFGTPEGGCGSFREGSCHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>ref|XP_007024475.1| Beta galactosidase 1 [Theobroma cacao]
 gb|EOY27097.1| Beta galactosidase 1 [Theobroma cacao]
Length=843

 Score =   275 bits (702),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  CNYAG +DE+KC +NCGEASQ WYH+PRSWL PTGNLLV+FEEW
Sbjct  658  GRHWPAYKASGN-CGDCNYAGTYDEKKCRTNCGEASQGWYHIPRSWLNPTGNLLVVFEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++RE  SVCA ++EWQP LMN++MQASGK  + LRPKVHL C   G+ I+A
Sbjct  717  GGDPNAISLVRRETDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKVHLEC-DAGQKISA  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG +++GSCHA HS+D F + CVG N C+V V PE FGGDPCP+VMKK
Sbjct  776  VKFASFGTPEGACGSYREGSCHAHHSYDAFNRLCVGQNFCSVTVAPEMFGGDPCPSVMKK  835

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  836  LSVEVICS  843



>gb|KHF99404.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=808

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  CNYAG F E KC +NCGEASQRWYHVPRSWL PTGN LV+FEE 
Sbjct  623  GRHWPAYKASGN-CGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGNFLVVFEES  681

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE  SVCA ++EWQP LMN+EMQASGK  + LRPKVHL C   G+ I+A
Sbjct  682  GGDPNGISLVRRETDSVCADIYEWQPTLMNYEMQASGKVNKPLRPKVHLEC-DAGQKISA  740

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F + C+G N CTV V PE FGGDPCP+VMKK
Sbjct  741  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNRLCLGQNFCTVTVAPEMFGGDPCPSVMKK  800

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  801  LSVEVICS  808



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  K+    C  C+Y G ++E+KC SNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  659  GRYWPAYKS-TGSCGSCDYTGTYNEKKCSSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  717

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R++ SVC  + EWQP LMNW+MQ+SGK  + LRPK HLSCG G K I++
Sbjct  718  GGDPNGIHLVRRDVDSVCVNINEWQPTLMNWQMQSSGKVNKPLRPKAHLSCGPGQK-ISS  776

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG F++GSCHA HS+D F++ CVG N CTV V PE FGGDPCPNVMKK
Sbjct  777  VKFASFGTPEGECGSFREGSCHAHHSYDAFQRTCVGQNFCTVTVAPEMFGGDPCPNVMKK  836

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  837  LSVEVICS  844



>dbj|BAF02242.1| putative galactosidase [Arabidopsis thaliana]
Length=592

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  407  GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  465

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PK HL CG G K IT 
Sbjct  466  GGDPNGITLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKAHLQCGPGQK-ITT  524

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  525  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  584

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  585  LAVEAVCA  592



>gb|KHF98342.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=846

 Score =   274 bits (700),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  C+YAG F+E+KC +NCG ASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  661  GRHWPAYKASGN-CGICSYAGTFNEKKCGTNCGGASQRWYHVPRSWLNPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE  SVCA ++EWQP LMN+ M+ASGK  + LRPKVHL C   G+ I+A
Sbjct  720  GGDPNGITLVRRETDSVCADIYEWQPNLMNYLMKASGKVNKPLRPKVHLEC-DAGQKISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTP G+CG +++GSCHA HS+D F + CVG N CTV V PE FGGDPCPNVMKK
Sbjct  779  VKFASFGTPGGVCGSYREGSCHAHHSYDAFTRLCVGQNFCTVTVAPEMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  839  LSVEVICS  846



>dbj|BAH20412.1| AT3G13750 [Arabidopsis thaliana]
Length=625

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  440  GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  498

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PK HL CG G K IT 
Sbjct  499  GGDPNGITLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKAHLQCGPGQK-ITT  557

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  558  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  617

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  618  LAVEAVCA  625



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1 [Cucumis sativus]
Length=841

 Score =   273 bits (697),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  K+    C  C+Y G ++E+KC SNCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  656  GRYWPAYKS-TGSCGSCDYTGTYNEKKCSSNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R++ SVC  + EWQP LMNW+MQ+SGK  + LRPK HLSCG G K I++
Sbjct  715  GGDPNGIHLVRRDVDSVCVNINEWQPTLMNWQMQSSGKVNKPLRPKAHLSCGPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG F++GSCHA HS+D F++ CVG N CTV V PE FGGDPCPNVMKK
Sbjct  774  VKFASFGTPEGECGSFREGSCHAHHSYDAFQRTCVGQNFCTVTVAPEMFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  834  LSVEVICS  841



>ref|XP_010654522.1| PREDICTED: beta-galactosidase 1 [Vitis vinifera]
Length=850

 Score =   273 bits (697),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA   GC  CNYAG + E+KCLSNCGE SQRWYHVP SWL PTGNLLV+FEE 
Sbjct  665  GRYWPAYKA-TGGCGDCNYAGTYSEKKCLSNCGEPSQRWYHVPHSWLSPTGNLLVVFEES  723

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA ++EWQP LMN+EMQASGK  + LRPK HL C  G K I++
Sbjct  724  GGNPAGISLVEREIESVCADIYEWQPTLMNYEMQASGKVNKPLRPKAHLWCAPGQK-ISS  782

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG +++GSCHA  S+D FE+ C+G NSC+V V PE FGGDPCP+VMKK
Sbjct  783  IKFASFGTPEGVCGSYREGSCHAHKSYDAFERSCIGMNSCSVTVAPEIFGGDPCPSVMKK  842

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  843  LSVEAICS  850



>emb|CBI35944.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   272 bits (696),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA   GC  CNYAG + E+KCLSNCGE SQRWYHVP SWL PTGNLLV+FEE 
Sbjct  656  GRYWPAYKA-TGGCGDCNYAGTYSEKKCLSNCGEPSQRWYHVPHSWLSPTGNLLVVFEES  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA ++EWQP LMN+EMQASGK  + LRPK HL C  G K I++
Sbjct  715  GGNPAGISLVEREIESVCADIYEWQPTLMNYEMQASGKVNKPLRPKAHLWCAPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG +++GSCHA  S+D FE+ C+G NSC+V V PE FGGDPCP+VMKK
Sbjct  774  IKFASFGTPEGVCGSYREGSCHAHKSYDAFERSCIGMNSCSVTVAPEIFGGDPCPSVMKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>ref|XP_010534899.1| PREDICTED: beta-galactosidase 1 [Tarenaya hassleriana]
Length=847

 Score =   272 bits (696),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    CS C+YAG F+E KCL NCGEASQRWYHVP SWL+P GNLLV+FEEW
Sbjct  662  GRYWPAYKA-SGSCSECSYAGSFNENKCLRNCGEASQRWYHVPHSWLKPNGNLLVVFEEW  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN++MQASGK  + L PKVHL CG G K +  
Sbjct  721  GGDPNGISLVRREVDSVCADIYEWQPTLMNYQMQASGKVNKPLHPKVHLQCGFGQK-MRT  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG +++G+CHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  780  VKFASFGTPEGTCGSYREGNCHAHHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            ++VEVVCS
Sbjct  840  LSVEVVCS  847



>ref|XP_006407174.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
 gb|ESQ48627.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
Length=846

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  661  GRHWPAYKAVGS-CSECSYKGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  720  GGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  839  LAVEAVCA  846



>ref|XP_011463326.1| PREDICTED: beta-galactosidase 1 [Fragaria vesca subsp. vesca]
Length=843

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG F E+KCL NCGEASQRWYHVPRSWL P GNLLV+ EEW
Sbjct  658  GRYWPAYKA-SGTCGECNYAGTFSEKKCLCNCGEASQRWYHVPRSWLNPAGNLLVVLEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++RE+ SVCA ++EWQP LM+W+MQ SG+  + LRPK HLSCG G K I++
Sbjct  717  GGDPNGIFLVRREVDSVCADIYEWQPNLMSWQMQVSGRVNKPLRPKAHLSCGPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG+CG F++G CHA  S++ FE+ C+G NSC+V V+PE FGGDPCPNVMKK
Sbjct  776  IKFASFGTPEGVCGSFREGGCHAHKSYNAFERSCIGQNSCSVTVSPENFGGDPCPNVMKK  835

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  836  LSVEAICN  843



>ref|XP_010487145.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+YAG F+E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  661  GRHWPAYKAVGS-CSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG  G+ IT 
Sbjct  720  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCG-AGQKITT  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  839  LAVEAVCA  846



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =   270 bits (689),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A  + C  CNYAG ++E+KCLSNCG+ASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  658  GRYWPAYTASGN-CGACNYAGTYNEKKCLSNCGQASQRWYHVPRSWLNPTGNLLVVLEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++RE+ S+CA ++EWQP LM+++MQASGK ++ +RPK HLSCG G K I++
Sbjct  717  GGDPNGIFLVRREVDSICADIYEWQPNLMSYQMQASGKVKKPVRPKAHLSCGPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++G+CHA +S+D F++ C+G NSC+V V PE FGGDPCP+VMKK
Sbjct  776  IKFASFGTPEGACGSFREGACHAHNSYDAFQRSCIGQNSCSVTVAPENFGGDPCPSVMKK  835

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  836  LSVEAICS  843



>ref|XP_002882842.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59101.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
Length=847

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  662  GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  721  GGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCH  HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  780  VKFASFGTPEGTCGSYRQGSCHDHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  840  LAVEAVCA  847



>ref|XP_009146456.1| PREDICTED: beta-galactosidase 1 [Brassica rapa]
Length=839

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  654  GRHWPAYKAVGS-CGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQ  L+N+++ +SGK  + L PKVHL CG G K +T 
Sbjct  713  GGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHSSGKVNKPLHPKVHLQCGPGQK-MTT  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  772  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  832  LAVEAVCA  839



>emb|CDX97513.1| BnaA05g25660D [Brassica napus]
Length=840

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  655  GRHWPAYKAVGS-CGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQ  L+N+++ +SGK  + L PKVHL CG G K +T 
Sbjct  714  GGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHSSGKVNKPLHPKVHLQCGPGQK-MTT  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  773  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  832

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  833  LAVEAVCA  840



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  662  GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PK HL CG G K IT 
Sbjct  721  GGDPNGITLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKAHLQCGPGQK-ITT  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  780  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  840  LAVEAVCA  847



>emb|CDY23637.1| BnaC05g39570D [Brassica napus]
Length=839

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  654  GRHWPAYKAVGS-CGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQ  L+N+++ +SGK  + L PKVHL CG G K +T 
Sbjct  713  GGDPNGISLVRREVDSVCADIYEWQSTLVNYQLHSSGKVNKPLHPKVHLQCGPGQK-MTT  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V PE FGGDPCPNVMKK
Sbjct  772  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPEMFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  832  LAVEAVCA  839



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+Y G F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  662  GRHWPAYKAVGS-CSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE+ SVCA ++EWQ  L+N+++ ASGK  + L PK HL CG G K IT 
Sbjct  721  GGDPNGITLVRREVDSVCADIYEWQSTLVNYQLHASGKVNKPLHPKAHLQCGPGQK-ITT  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F K CVG N C+V V PE FGGDPCPNVMKK
Sbjct  780  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNKLCVGQNWCSVTVAPEMFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  840  LAVEAVCA  847



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+YAG F E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  661  GRHWPAYKAVGS-CSECSYAGTFKEDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  720  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QGSCHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  839  LAVEAVCA  846



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 156/188 (83%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A  + C  CNYAG ++E+KCLSNCG+ASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  658  GRYWPAYTASGN-CGACNYAGTYNEKKCLSNCGQASQRWYHVPRSWLNPTGNLLVVLEEW  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++RE+ S+CA ++EWQP LM+++MQASGK ++ +RPK HL+CG G K I++
Sbjct  717  GGDPNGIFLVRREVDSICADIYEWQPNLMSYQMQASGKVKKPVRPKAHLTCGPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG F++G+CHA +S+D F++ C+G NSC+V V PE FGGDPCP+VMKK
Sbjct  776  IKFASFGTPEGACGSFREGACHAHNSYDAFQRSCIGQNSCSVTVEPENFGGDPCPSVMKK  835

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  836  LSVEAICS  843



>ref|XP_010465236.1| PREDICTED: beta-galactosidase 1 [Camelina sativa]
Length=846

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+YAG F+E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  661  GRHWPAYKAVGS-CSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  720  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGAGQK-ITT  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QG CHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGTCGSYRQGGCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  839  LAVEAVCA  846



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =   267 bits (682),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  654  GRHWPAYKAVGT-CRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  713  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTP+G CG ++QGSCHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  772  VKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  832  LAVEAVCA  839



>ref|XP_010501131.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    CS C+YAG F+E KCL NCGEASQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  661  GRHWPAYKAVGS-CSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ A+GK  + L PKVHL CG G K IT 
Sbjct  720  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHAAGKVNKPLHPKVHLQCGAGQK-ITN  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG CG ++QG CHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGTCGSYRQGGCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  838

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  839  LAVEAVCA  846



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  654  GRHWPAYKAVGT-CRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  713  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTP+G CG ++QGSCHA HS+D F + C+G N C+V V P  FGGDPCPNVMKK
Sbjct  772  VKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRLCIGQNWCSVTVAPAMFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            +AVE VC+
Sbjct  832  LAVEAVCA  839



>gb|KJB70252.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=841

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 151/188 (80%), Gaps = 7/188 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + C  C+YAG F+E+KC +NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  661  GRHWPAYKASGN-CGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L++RE  SVCA ++EWQP LMN+ M+ASGK  + LRPKVHL C   G+ I+A
Sbjct  720  GGDPNGITLVRRETDSVCADIYEWQPNLMNYLMKASGKVNKPLRPKVHLEC-DAGQKISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTPEG+CG +++GSCHA HS+D F +     N C+V V PE FGGDPCPNVMKK
Sbjct  779  VKFASFGTPEGVCGSYREGSCHAHHSYDAFNR-----NFCSVTVAPEMFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VEV+CS
Sbjct  834  LSVEVICS  841



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG +DE+KC SNCGEASQRWYHVPRSWLRPTGN LVIFEEW
Sbjct  657  GRYWPAYKAYGS-CGGCNYAGTYDEKKCRSNCGEASQRWYHVPRSWLRPTGNQLVIFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL KR + SVCA ++EWQP L NWE+Q+SGK +R LRPK HL C  G K I++
Sbjct  716  GGYPNWISLDKRTVQSVCADIYEWQPTLTNWELQSSGKVQRPLRPKAHLWCSPGTK-ISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG FQ+GSCHA  S+D F++ C+G  +C+V V PE FGGDPCP+ MKK
Sbjct  775  IKFASFGTPQGVCGSFQEGSCHAHKSYDAFQRNCIGQQTCSVTVAPEVFGGDPCPSTMKK  834

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  835  LSVEAICS  842



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C  C+Y G F+E KCL NCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  654  GRHWPAYKAVGT-CRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ +VCA ++EWQ  L+N+++ ASGK  + L PKVHL CG G K IT 
Sbjct  713  GGDPNGISLVRREVDTVCADIYEWQSTLVNYQLHASGKVNKPLHPKVHLQCGPGQK-ITT  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTP+G CG ++QGSCHA HS+D F + CVG N C+V V P  FGGDPCPNVMKK
Sbjct  772  VKFASFGTPQGTCGSYRQGSCHAHHSYDAFNRLCVGQNWCSVTVAPAMFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  832  LSVEAVCA  839



>gb|ACP18875.1| beta-galactosidase pBG(a) [Carica papaya]
Length=836

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 152/189 (80%), Gaps = 3/189 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+YAG F+E+KCLSNCGEASQRWYHVPRSW  PTGNLLV+FEEW
Sbjct  650  GRHWPAYKA-SGSCGWCDYAGTFNEKKCLSNCGEASQRWYHVPRSWPNPTGNLLVVFEEW  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN++MQASGK  + LRPK HL CG G K I++
Sbjct  709  GGDPNGISLVRREVDSVCADIYEWQPTLMNYQMQASGKVNKPLRPKAHLQCGPGQK-ISS  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGD-PCPNVMK  279
            +KFASFGTPEG CG +++GSCHA HS+D FE+ CVG N C+V V P    G+ P P+VMK
Sbjct  768  VKFASFGTPEGACGSYREGSCHAHHSYDAFERLCVGQNWCSVTVVPRNVSGEIPAPSVMK  827

Query  278  KVAVEVVCS  252
            K+AVEVVCS
Sbjct  828  KLAVEVVCS  836



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC +NCGEASQRWYHVP SWL+PTGNLLV+FEE 
Sbjct  654  GRYWPAYKA-TGSCDYCNYAGTYNEKKCGTNCGEASQRWYHVPHSWLKPTGNLLVMFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P G+ L++R+I SVCA ++EWQP L++++MQASGK  R + PK HLSCG G K I++
Sbjct  713  GGDPNGVFLVRRDIDSVCADIYEWQPNLVSYQMQASGKVSRPVSPKAHLSCGPGQK-ISS  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++GSCHA  S+D F++ CVG +SCTV V+PE FGGDPCPNVMKK
Sbjct  772  IKFASFGTPVGSCGNYREGSCHAHKSYDAFQRNCVGQSSCTVTVSPEIFGGDPCPNVMKK  831

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  832  LSVEAICT  839



>ref|XP_007135555.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
 gb|ESW07549.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
Length=844

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC SNCGEASQRWYHVP SWL+PTGNLLV+FEE 
Sbjct  659  GRYWPAYKA-SGSCGYCNYAGTYNEKKCASNCGEASQRWYHVPHSWLKPTGNLLVVFEEL  717

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L+++EMQASGK    +RPK HLSCG G K I++
Sbjct  718  GGDPNGIFLVRRDIDSVCADIYEWQPNLVSYEMQASGKVRSPVRPKAHLSCGPGQK-ISS  776

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +++GSCHA  S+D F+K CVG + CTV V PE FGGDPCP+VMKK
Sbjct  777  IKFASFGTPVGSCGSYREGSCHAHKSYDAFQKNCVGQSWCTVTVAPEIFGGDPCPSVMKK  836

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  837  LSVEAICT  844



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  653  GRYWPAYKA-SGSCDYCNYAGTYNEKKCGSNCGEASQRWYHVPKSWLKPTGNLLVMFEEL  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P G+SL++R+I SVCA ++EWQP L++++MQASGK +  + PK HLSCG G K I++
Sbjct  712  GGDPNGVSLVRRDIDSVCADIYEWQPNLVSYQMQASGKVKIPVSPKAHLSCGPGQK-ISS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++GSCHA  S+D F+K CVG +SCTV V+P  FGGDPCP+VMKK
Sbjct  771  IKFASFGTPVGSCGNYREGSCHAHKSYDAFQKNCVGQSSCTVTVSPGIFGGDPCPHVMKK  830

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  831  LSVEAICT  838



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 148/193 (77%), Gaps = 7/193 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  CNYAG +DE+KC SNCGEASQRWYHVPRSWLRPTGN LVIFEEW
Sbjct  657  GRYWPAYKAYGS-CGGCNYAGTYDEKKCRSNCGEASQRWYHVPRSWLRPTGNQLVIFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL KR + SVCA ++EWQP L NWE+Q+SGK +R LRPK HL C  G K I++
Sbjct  716  GGYPNWISLDKRTVQSVCADIYEWQPTLTNWELQSSGKVQRPLRPKAHLWCSPGTK-ISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEK-----YCVGWNSCTVPVTPEAFGGDPCP  291
            IKFASFGTP+G+CG FQ+GSCHA  S+D F++      C+G  +C+V V PE FGGDPCP
Sbjct  775  IKFASFGTPQGVCGSFQEGSCHAHKSYDAFQREDLLQNCIGQQTCSVTVAPEVFGGDPCP  834

Query  290  NVMKKVAVEVVCS  252
            + MKK++VE +CS
Sbjct  835  STMKKLSVEAICS  847



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =   259 bits (661),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+YAG ++E KC SNCGEASQ WYHVPRSWL PTGNLLV+FEE 
Sbjct  662  GRYWPAYKA-SGTCDDCDYAGTYNENKCRSNCGEASQTWYHVPRSWLIPTGNLLVVFEEL  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++R+I SVCA ++EWQP L++++MQ SGK  + +RPK HLSCG G K I++
Sbjct  721  GGDPNGISLVRRDIDSVCADIYEWQPNLISYQMQTSGKVSKPVRPKAHLSCGPGQK-ISS  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S++ FE+ C+G N CTV V+PE FGGDPCPNVMKK
Sbjct  780  IKFASFGTPVGSCGNFHEGSCHAHKSYNAFERNCIGQNLCTVTVSPENFGGDPCPNVMKK  839

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  840  LSVEAICT  847



>gb|KHN39301.1| Beta-galactosidase 1 [Glycine soja]
Length=838

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC SNCG+ASQRWYHVP SWL+PTGNLLV+FEE 
Sbjct  653  GRYWPAYKA-SGSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGNLLVVFEEL  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQASGK    +RPK HLSCG G K I++
Sbjct  712  GGDPNGIFLVRRDIDSVCADIYEWQPNLVSYDMQASGKVRSPVRPKAHLSCGPGQK-ISS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++GSCHA  S+D F+K CVG + CTV V+PE FGGDPCP+VMKK
Sbjct  771  IKFASFGTPVGSCGNYREGSCHAHKSYDAFQKNCVGQSWCTVTVSPEIFGGDPCPSVMKK  830

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  831  LSVEAICT  838



>ref|XP_003529875.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=845

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC SNCG+ASQRWYHVP SWL+PTGNLLV+FEE 
Sbjct  660  GRYWPAYKA-SGSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGNLLVVFEEL  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQASGK    +RPK HLSCG G K I++
Sbjct  719  GGDPNGIFLVRRDIDSVCADIYEWQPNLVSYDMQASGKVRSPVRPKAHLSCGPGQK-ISS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++GSCHA  S+D F+K CVG + CTV V+PE FGGDPCP+VMKK
Sbjct  778  IKFASFGTPVGSCGNYREGSCHAHKSYDAFQKNCVGQSWCTVTVSPEIFGGDPCPSVMKK  837

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  838  LSVEAICT  845



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +C+YAG ++E KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  648  GRYWPAYKA-SGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEEL  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQ SGKA   +RPKVHLSC  G K I++
Sbjct  707  GGDPNGIFLVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQK-ISS  763

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S+D FE+ CVG N CTV V+PE FGGDPCPNV+KK
Sbjct  764  IKFASFGTPAGSCGNFHEGSCHAHKSYDAFERNCVGQNWCTVTVSPENFGGDPCPNVLKK  823

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  824  LSVEAICS  831



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +C+YAG ++E KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  657  GRYWPAYKA-SGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQ SGKA   +RPKVHLSC  G K I++
Sbjct  716  GGDPNGIFLVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQK-ISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S+D FE+ CVG N CTV V+PE FGGDPCPNV+KK
Sbjct  773  IKFASFGTPAGSCGNFHEGSCHAHKSYDAFERNCVGQNWCTVTVSPENFGGDPCPNVLKK  832

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  833  LSVEAICS  840



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +C+YAG ++E KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  658  GRYWPAYKA-SGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GISL++R+I SVCA ++EWQP L++++MQ SGKA   +RPKVHLSC  G K I++
Sbjct  717  GGDLNGISLVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S+D FE+ CVG N CTV V+PE FGGDPCPNV+KK
Sbjct  774  IKFASFGTPVGSCGNFHEGSCHAHMSYDAFERNCVGQNLCTVAVSPENFGGDPCPNVLKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+YAG ++E KC SNCGEASQRWYHVP SWL PTGNLLV+FEE 
Sbjct  656  GRYWPAYKA-SGTCDNCDYAGTYNENKCRSNCGEASQRWYHVPHSWLIPTGNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQ SGK  + +RPK HLSCG G K I++
Sbjct  715  GGDPNGIFLVRRDIDSVCADIYEWQPNLISYQMQTSGKTNKPVRPKAHLSCGPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S++ FEK CVG NSC V V+PE FGGDPCPNV+KK
Sbjct  774  IKFASFGTPVGSCGNFHEGSCHAHKSYNTFEKNCVGQNSCKVTVSPENFGGDPCPNVLKK  833

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  834  LSVEAICT  841



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +C+YAG ++E KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  648  GRYWPAYKA-SGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEEL  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GISL++R+I SVCA ++EWQP L++++MQ SGKA   +RPKVHLSC  G K I++
Sbjct  707  GGDLNGISLVRRDIDSVCADIYEWQPNLISYQMQTSGKA--PVRPKVHLSCSPGQK-ISS  763

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S+D FE+ CVG N CTV V+PE FGGDPCPNV+KK
Sbjct  764  IKFASFGTPVGSCGNFHEGSCHAHMSYDAFERNCVGQNLCTVAVSPENFGGDPCPNVLKK  823

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  824  LSVEAICS  831



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   256 bits (655),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C +CNYAG ++E+KC SNCGEASQRWYHVP SWL+P+GNLLV+FEE 
Sbjct  658  GRYWPAYKA-SGSCGYCNYAGTYNEKKCGSNCGEASQRWYHVPHSWLKPSGNLLVVFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L+++EMQASGK    +RPK HLSCG G K I++
Sbjct  717  GGDPNGIFLVRRDIDSVCADIYEWQPNLVSYEMQASGKVRSPVRPKAHLSCGPGQK-ISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +++GSCHA  S+D F K CVG + CTV V+PE FGGDPCP VMKK
Sbjct  776  IKFASFGTPVGSCGSYREGSCHAHKSYDAFLKNCVGQSWCTVTVSPEIFGGDPCPRVMKK  835

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  836  LSVEAICT  843



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPGNKA    C  C+Y G +DE+KC +NCGE SQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  656  GRYWPGNKAYGS-CGVCDYRGTYDEKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR++ SVCA++ EWQP   NW+ + +G      RPK HLSC   G+ +T+
Sbjct  715  GGDPTGISMVKRKVGSVCAEISEWQPSFNNWKTKGNG------RPKAHLSC-PTGQQMTS  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG F +GSCHAFHS+DIF+K C+G   C+VPV  E FGGDPCP  MKK
Sbjct  768  IKFASFGTPQGACGSFSEGSCHAFHSYDIFQKKCIGQQRCSVPVVSEMFGGDPCPGTMKK  827

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  828  LAVEAIC  834



>gb|EPS65481.1| beta-galactosidase [Genlisea aurea]
Length=460

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 140/188 (74%), Gaps = 20/188 (11%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W   KA  D CS C+YAGWFDE+KCL+NCGEASQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  293  GRYWNQYKAGGD-CSPCDYAGWFDEKKCLANCGEASQRWYHVPRSWLYPTGNLLVVFEEW  351

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P+GISL KREI SVCA + EWQP L+NW++ +SGK                   I++
Sbjct  352  GGDPHGISLAKREIDSVCADVHEWQPTLVNWQLLSSGK-------------------ISS  392

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FASFGTPEG C ++++G CHA HS+D+F K CVG  SC V +TPE FGGDPC  VMK+
Sbjct  393  IAFASFGTPEGSCRNYRRGKCHALHSYDVFVKSCVGQQSCRVAITPENFGGDPCEGVMKR  452

Query  275  VAVEVVCS  252
            +AVE +CS
Sbjct  453  LAVEAICS  460



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =   250 bits (639),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR WP  KA    C  C+YAG ++E KC SNCGEASQRWYHVP+SWL+PTGNLLV+FEE 
Sbjct  654  GRFWPAYKAAG-ACDHCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGNLLVVFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI L++R+I SVCA ++EWQP L++++MQ +GK    +RPKVHL+C  G K I++
Sbjct  713  GGDPNGIFLVRRDIDSVCADIYEWQPNLISYQMQVAGKP--PVRPKVHLTCSPGQK-ISS  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F +GSCHA  S+D FE+ CVG N CTV V+PE FGGDPCPNVMKK
Sbjct  770  IKFASFGTPVGSCGNFHEGSCHAHKSYDAFERNCVGQNWCTVTVSPENFGGDPCPNVMKK  829

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  830  LSVEAICT  837



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   250 bits (639),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A    CS C+YAG+F E+KCL+ CG+ASQRWYHVPRSWL+P GNL+V+FEE 
Sbjct  656  GRYWPAYTA-KGSCSDCSYAGYFSEKKCLTYCGDASQRWYHVPRSWLKPRGNLMVVFEEM  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
             G P  ISL+K+EI+S+CA + EWQP L+NW +++SG+ ++ LRPK HL C  G K I++
Sbjct  715  SGAPNFISLMKKEISSICADINEWQPTLVNWHLKSSGRIDKPLRPKAHLWCAPGQK-ISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTPEG CG+++QG+CHA +S+DIF+K CVG   C + V P  FGGDPCPNVMKK
Sbjct  774  IKFASFGTPEGSCGNYKQGNCHAHNSYDIFQKDCVGQPGCAITVEPRLFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            +AVE +CS
Sbjct  834  LAVEAICS  841



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   250 bits (638),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA  + C  C+Y G ++E+KCL+NCGEASQRWYHVP SWL PT NLLV+FEEW
Sbjct  664  GRYWPAYKAYGN-CGECSYTGRYNEKKCLANCGEASQRWYHVPSSWLYPTANLLVVFEEW  722

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++R   S CA + EW P L  W ++  G+AER  RPK HLSC  G K I++
Sbjct  723  GGDPTGISLVRRTTGSACAFISEWHPTLRKWHIKDYGRAERPRRPKAHLSCADGQK-ISS  781

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG+F +GSCHA  S+DIFEK CVG   C+V ++P+ FGGDPCPNVMK 
Sbjct  782  IKFASFGTPQGVCGNFTEGSCHAHKSYDIFEKNCVGQQWCSVTISPDVFGGDPCPNVMKN  841

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  842  LAVEAIC  848



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score =   246 bits (628),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 143/192 (74%), Gaps = 13/192 (7%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPGNKA    C  C+Y G +DE+KC +NCGE SQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  656  GRYWPGNKAYGS-CGVCDYRGTYDEKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR++ SVCA++ EWQP   NW+ + +G      RPK HLSC   G+ +T+
Sbjct  715  GGDPTGISMVKRKVGSVCAEISEWQPSFNNWKTKGNG------RPKAHLSC-PTGQQMTS  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEK-----YCVGWNSCTVPVTPEAFGGDPCP  291
            IKFASFGTP+G CG F +GSCHAFHS+DIF+K      C+G   C+VPV  E FGGDPCP
Sbjct  768  IKFASFGTPQGACGSFSEGSCHAFHSYDIFQKESLSQKCIGQQRCSVPVVSEMFGGDPCP  827

Query  290  NVMKKVAVEVVC  255
              MKK+AVE +C
Sbjct  828  GTMKKLAVEAIC  839



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 137/188 (73%), Gaps = 8/188 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+YAG +D+ KC SNCGEASQRWYHVPRSWL PTGNL VIFEEW
Sbjct  667  GRYWPAYKA-SGTCGNCSYAGEYDDSKCQSNCGEASQRWYHVPRSWLNPTGNLFVIFEEW  725

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL KR + S+CA + EWQP       Q S K  R LRPK HL C  G K IT+
Sbjct  726  GGDPTWISLNKRTVGSLCADIHEWQPS------QRSSKIGRLLRPKAHLQCSPGTK-ITS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+GICG FQ+GSCHA  S+D FEK C+G   C V V PE FGGDPCPN+MKK
Sbjct  779  IKFASFGTPQGICGSFQEGSCHAHKSYDAFEKNCIGKQMCAVSVAPEVFGGDPCPNIMKK  838

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  839  LSVEAICS  846



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A    CS CNYAG +D++KC SNCGE SQRWYHVPRSWL P+GNLLV+FEEW
Sbjct  656  GRHWPAYTA-RGSCSACNYAGTYDDKKCRSNCGEPSQRWYHVPRSWLNPSGNLLVVFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P GISL+KR   SVCA +FE QP L NW+M A G+ +  L+PK HL C HG K I+ 
Sbjct  715  GGEPSGISLVKRTTGSVCADIFEGQPALKNWQMIALGRLDH-LQPKAHLWCPHGQK-ISK  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G+P+G CG F+ GSCHA  S+D FEK C+G  SC+V V  E FGGDPCP+  KK
Sbjct  773  IKFASYGSPQGTCGSFKAGSCHAHKSYDAFEKKCIGKQSCSVTVAAEVFGGDPCPDSSKK  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCT  840



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG FD++KC +NCGE SQRWYHVPRSWL+P+GNLL +FEEW
Sbjct  653  GRHWPGYIA-HGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS +KR  ASVCA +FE QP L NW+  ASGK   + +PK HL C  G K I+ 
Sbjct  712  GGDPTGISFVKRTTASVCADIFEGQPALKNWQAIASGKV-ISPQPKAHLWCPTGQK-ISQ  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFG P+G CG F++GSCHA  S+D FE+ CVG  SC+V V PE FGGDPCP+  KK
Sbjct  770  IKFASFGMPQGTCGSFREGSCHAHKSYDAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKK  829

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  830  LSVEAVCS  837



>ref|XP_010915229.1| PREDICTED: beta-galactosidase isoform X2 [Elaeis guineensis]
Length=836

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 141/187 (75%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+Y G ++E+KC +NCGE SQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  657  GRYWPAYKAYGS-CGGCDYRGTYNEKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR++ SVCA++FEWQP   NW+ +  G      RPK HLSC  G K ++ 
Sbjct  716  GGDPTGISMVKRKVGSVCAEIFEWQPSARNWKTKGYG------RPKAHLSCPPGQK-MSK  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F +GSCHAFHS+D F+K C+G   C+V V P+ FGGDPCP +MKK
Sbjct  769  IKFASFGTPQGVCGSFSEGSCHAFHSYDAFQKNCIGQQWCSVVVAPQMFGGDPCPGIMKK  828

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  829  LAVEAIC  835



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG FD++KC +NCGE SQRWYHVPRSWL+P+GNLL +FEEW
Sbjct  654  GRHWPGYIA-HGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS +KR  ASVCA +FE QP L NW+  ASGK   + +PK HL C  G K I+ 
Sbjct  713  GGDPTGISFVKRTTASVCADIFEGQPALKNWQAIASGKV-ISPQPKAHLWCPPGQK-ISQ  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFG P+G CG F++GSCHA  S+D FE+ CVG  SC+V V PE FGGDPCP+  KK
Sbjct  771  IKFASFGMPQGTCGSFREGSCHAHKSYDAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKK  830

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  831  LSVEAVCS  838



>ref|XP_010939579.1| PREDICTED: beta-galactosidase 2-like [Elaeis guineensis]
Length=833

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 137/187 (73%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G +DE+KC +NCGE+SQ WYHVPRSWL PTGNLLV+FEEW
Sbjct  654  GRYWPGYKAYGT-CGNCDYRGEYDEKKCQTNCGESSQIWYHVPRSWLNPTGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR + S CA + EWQP + NW  +  G      R KVHLSC HG K IT 
Sbjct  713  GGDPKGISMVKRTVGSACADISEWQPAMKNWHTKNYG------RSKVHLSCDHGRK-ITK  765

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F +GSCHA  S+D FEK CVG   C+V + PE FGGDPCP  MK+
Sbjct  766  IKFASFGTPQGVCGSFSEGSCHAHESYDAFEKNCVGQEKCSVTIVPEVFGGDPCPGTMKR  825

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  826  IAVEALC  832



>ref|XP_010910613.1| PREDICTED: beta-galactosidase-like, partial [Elaeis guineensis]
Length=399

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G ++E+KC +NCGE+SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  220  GRYWPGYKAYGS-CGGCDYRGTYNEKKCQTNCGESSQRWYHVPRSWLNPTGNLLVVFEEW  278

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR++ SV A++ EWQP L NW  +A G      RPK  LSC  G K +T 
Sbjct  279  GGDPTGISMVKRKVGSVGAELSEWQPSLNNWNTKAYG------RPKAQLSCPPGQK-MTN  331

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FASFGTP+G+ G F +G+CHA HS+D F+K CVG   C+V V+ E FGGDPCP  MKK
Sbjct  332  INFASFGTPQGVHGSFSEGTCHASHSYDAFKKNCVGQQWCSVTVSSEMFGGDPCPGTMKK  391

Query  275  VAVEVVC  255
            +AVE VC
Sbjct  392  LAVEAVC  398



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 141/188 (75%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  653  GRHWPGYIAQGN-CGECNYAGLYSEKKCHTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++R  A VCA + E QP L NW M  SGK+   ++PK HL C  G K I+ 
Sbjct  712  GGDPTGISLVRRSTARVCADIVEGQPSLKNWRMATSGKSNN-MQPKAHLWCSAGQK-ISN  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG++++GSCHA  S+D FEK C+G  SC+V V PE FGGDPCPN  KK
Sbjct  770  IEFASYGLPQGTCGNYREGSCHAHKSYDAFEKNCIGRQSCSVSVVPEVFGGDPCPNTSKK  829

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  830  LSVEAICS  837



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =   241 bits (614),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG FD++KC +NCGE SQRWYHVPRSWL+P+GNLL +FEEW
Sbjct  696  GRHWPGYIA-HGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEW  754

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS +KR  ASVCA +FE QP L NW+  ASGK   + +PK HL C  G K I+ 
Sbjct  755  GGDPTGISFVKRTTASVCADIFEGQPALKNWQAIASGKV-ISPQPKAHLWCPPGQK-ISQ  812

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFG P+G CG F++GSCHA  S+D FE+ CVG  SC+V V PE FGGDPCP+  KK
Sbjct  813  IKFASFGMPQGTCGSFREGSCHAHKSYDAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKK  872

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  873  LSVEAVCS  880



>gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A    C  C+Y+G ++E+ C SNCGE SQRWYHVPR WL PTGNLLV+FEEW
Sbjct  570  GRYWPAYTA-KGSCGDCSYSGTYNEKNCQSNCGEPSQRWYHVPRPWLNPTGNLLVVFEEW  628

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KR + SVCA + EW   + NW ++  GK ER  R KVHL C   G+ IT+
Sbjct  629  GGDPSGISLVKRSVGSVCADVSEWHLTIKNWHIKTYGKPERLQRAKVHLGCDQ-GQTITS  687

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG+FQQG+CH+ +S+ +F+K CVG  +C V ++P+ FGGDPC +VMK+
Sbjct  688  IKFASFGTPQGACGNFQQGACHSPNSYAVFQKKCVGQQACAVTISPDVFGGDPCFSVMKR  747

Query  275  VAVEVVCS  252
            VAVE +C+
Sbjct  748  VAVEAICN  755



>ref|XP_006826783.2| PREDICTED: beta-galactosidase [Amborella trichopoda]
Length=815

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A    C  C+Y+G ++E+ C SNCGE SQRWYHVPR WL PTGNLLV+FEEW
Sbjct  630  GRYWPAYTA-KGSCGDCSYSGTYNEKNCQSNCGEPSQRWYHVPRPWLNPTGNLLVVFEEW  688

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KR + SVCA + EW   + NW ++  GK ER  R KVHL C   G+ IT+
Sbjct  689  GGDPSGISLVKRSVGSVCADVSEWHLTIKNWHIKTYGKPERLQRAKVHLGCDQ-GQTITS  747

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG+FQQG+CH+ +S+ +F+K CVG  +C V ++P+ FGGDPC +VMK+
Sbjct  748  IKFASFGTPQGACGNFQQGACHSPNSYAVFQKKCVGQQACAVTISPDVFGGDPCFSVMKR  807

Query  275  VAVEVVCS  252
            VAVE +C+
Sbjct  808  VAVEAICN  815



>gb|KDO65277.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=815

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA    C +C+Y G + E+KCLSNCGEASQRWYHVPRSWL+PTGNLLV+FEEW
Sbjct  660  GRHWPAYKA-SGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGNLLVVFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL++REI SVCA M+EWQP L+NW++ ASGK  + LRPK HL CG G K I +
Sbjct  719  GGNPNGISLVRREIDSVCAYMYEWQPTLINWQLHASGKVNKPLRPKAHLMCGPGQK-IKS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCV  351
            IKFASFGTPEG+CG ++QGSCHAFHS+D F++ C+
Sbjct  778  IKFASFGTPEGVCGSYRQGSCHAFHSYDAFQRVCI  812



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 137/188 (73%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  C+YAG + ++KC +NCGE SQRWYHVPRSWL P+GNL+V+FEEW
Sbjct  665  GRHWPGYIA-RGACGACDYAGTYSDKKCRTNCGEPSQRWYHVPRSWLNPSGNLMVVFEEW  723

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KR   SVCA +FE QP + NW M ASGK     RPK HL C  G K I+ 
Sbjct  724  GGDPSGISLVKRTTGSVCADIFEAQPTMKNWGMLASGKIN---RPKAHLWCPPGQK-ISE  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G PEG CG F +GSCHA  S+D F+K C+G  SC+V V PE FGGDPCP+ MKK
Sbjct  780  IKFASYGIPEGTCGSFSEGSCHAHRSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPDSMKK  839

Query  275  VAVEVVCS  252
            ++VE  C+
Sbjct  840  LSVEAACN  847



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    CS C+Y G +DE+KC +NCGE+SQ+WYHVPRSWL PTGNLLV+FEEW
Sbjct  654  GRYWPGYKAYGT-CSNCDYRGEYDEKKCQTNCGESSQKWYHVPRSWLNPTGNLLVLFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR I SVCA + EWQP + NW      + +   R KVHLSC   G+ +T 
Sbjct  713  GGDPKGISMVKRTIGSVCADISEWQPAMKNW------RTKDYERSKVHLSC-DPGRKVTK  765

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+CG F +GSCHA  S+D FEK CVG   C+V + PE FGGDPCP  MK+
Sbjct  766  IKFASFGTPQGVCGSFSEGSCHAHESYDAFEK-CVGQEKCSVTIVPEVFGGDPCPGTMKR  824

Query  275  VAVEVVC  255
            +AVE +C
Sbjct  825  IAVEALC  831



>gb|EEC70956.1| hypothetical protein OsI_02569 [Oryza sativa Indica Group]
Length=480

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  C+Y G +DE KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  301  GRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGNLLVIFEEW  359

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR I SVCA + EWQP + NW  +   KA      KVHL C +G K IT 
Sbjct  360  GGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTKDYEKA------KVHLQCDNGQK-ITE  412

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K CVG   C V V PE FGGDPCP  MK+
Sbjct  413  IKFASFGTPQGSCGSYTEGGCHAHKSYDIFWKNCVGQERCGVSVVPEIFGGDPCPGTMKR  472

Query  275  VAVEVVC  255
              VE +C
Sbjct  473  AVVEAIC  479



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 135/187 (72%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG  A    C  C+Y G +DE+KC +NCGE SQ+WYHVPRSWL PTGNLLV+FEEW
Sbjct  657  GRYWPGYMAYGS-CGDCDYRGTYDEKKCQTNCGEPSQKWYHVPRSWLNPTGNLLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
             G+P GIS++KR + SVCA + EWQP + NW  +  GK      PKV L CG   +NITA
Sbjct  716  AGDPTGISMVKRSVGSVCADISEWQPSMSNWHTRDYGK------PKVRLFCGT-AQNITA  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG F +GSCHA  S+D FEK C+G   C+V ++PE FGGDPCP  MK+
Sbjct  769  IKFASFGTPQGACGSFSEGSCHAHKSYDAFEKNCLGEQRCSVTISPEVFGGDPCPGTMKR  828

Query  275  VAVEVVC  255
            + VE VC
Sbjct  829  ITVEAVC  835



>ref|XP_010915228.1| PREDICTED: beta-galactosidase isoform X1 [Elaeis guineensis]
Length=841

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 13/192 (7%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+Y G ++E+KC +NCGE SQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  657  GRYWPAYKAYGS-CGGCDYRGTYNEKKCQTNCGEPSQRWYHVPRSWLNPTGNLLVVLEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR++ SVCA++FEWQP   NW+ +  G      RPK HLSC  G K ++ 
Sbjct  716  GGDPTGISMVKRKVGSVCAEIFEWQPSARNWKTKGYG------RPKAHLSCPPGQK-MSK  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEK-----YCVGWNSCTVPVTPEAFGGDPCP  291
            IKFASFGTP+G+CG F +GSCHAFHS+D F+K      C+G   C+V V P+ FGGDPCP
Sbjct  769  IKFASFGTPQGVCGSFSEGSCHAFHSYDAFQKESLLQNCIGQQWCSVVVAPQMFGGDPCP  828

Query  290  NVMKKVAVEVVC  255
             +MKK+AVE +C
Sbjct  829  GIMKKLAVEAIC  840



>tpg|DAA58691.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=655

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G +DE+KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  476  GRYWPGYKASGT-CGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGNLLVIFEEW  534

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR   S+CA + EWQP + NW  +   KA      KVHL C H G+ +T 
Sbjct  535  GGDPTGISMVKRIAGSICADVSEWQPSMANWRTKGYEKA------KVHLQCDH-GRKMTH  587

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K C+G   C V V P+AFGGDPCP  MK+
Sbjct  588  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKSCIGQERCGVSVVPDAFGGDPCPGTMKR  647

Query  275  VAVEVVC  255
              VE +C
Sbjct  648  AVVEAIC  654



>ref|XP_012076927.1| PREDICTED: beta-galactosidase-like [Jatropha curcas]
 gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   234 bits (596),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A    C  CNYAG FD++KC  NCGE SQRWYHVPRSWL P+GNLLV+FEE+
Sbjct  654  GRHWPAYTA-RGSCGDCNYAGTFDDKKCRRNCGEPSQRWYHVPRSWLNPSGNLLVVFEEF  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GISL+KR   +VCA ++E QP L NW+M A GK +  L+PK HL C  G K I+ 
Sbjct  713  GGNPSGISLVKRTTGTVCADIYEGQPALKNWQMIALGKLDH-LQPKAHLWCPPGQK-ISQ  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG F++GSCHA  S++ FEK CVG  SC+V V  E FGGDPCP+  KK
Sbjct  771  IKFASYGVPQGACGSFREGSCHAHKSYNAFEKKCVGKQSCSVTVASEVFGGDPCPDTAKK  830

Query  275  VAVEVVC  255
            ++VE VC
Sbjct  831  LSVEAVC  837



>gb|KGN59822.1| hypothetical protein Csa_3G848310 [Cucumis sativus]
Length=737

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = -1

Query  701  WYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGK  522
            WYHVPRSWL PTGNLLV+FEEWGG+P GI L++R++ SVC  + EWQP LMNW+MQ+SGK
Sbjct  589  WYHVPRSWLNPTGNLLVVFEEWGGDPNGIHLVRRDVDSVCVNINEWQPTLMNWQMQSSGK  648

Query  521  AERALRPKVHLSCGHGGKNITAIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWN  342
              + LRPK HLSCG G K I+++KFASFGTPEG CG F++GSCHA HS+D F++ CVG N
Sbjct  649  VNKPLRPKAHLSCGPGQK-ISSVKFASFGTPEGECGSFREGSCHAHHSYDAFQRTCVGQN  707

Query  341  SCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
             CTV V PE FGGDPCPNVMKK++VEV+CS
Sbjct  708  FCTVTVAPEMFGGDPCPNVMKKLSVEVICS  737



>sp|P45582.1|BGAL_ASPOF RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Asparagus officinalis]
 emb|CAA54525.1| beta-galactosidase [Asparagus officinalis]
Length=832

 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 13/192 (7%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+Y G ++E+KCLSNCGEASQRWYHVPRSWL PTGN LV+ EEW
Sbjct  648  GRYWPAYKA-SGSCGSCDYRGTYNEKKCLSNCGEASQRWYHVPRSWLIPTGNFLVVLEEW  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR +ASVCA++ E QP + NW  +A G      RPKVHLSC  G K ++ 
Sbjct  707  GGDPTGISMVKRSVASVCAEVEELQPTMDNWRTKAYG------RPKVHLSCDPGQK-MSK  759

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFE-----KYCVGWNSCTVPVTPEAFGGDPCP  291
            IKFASFGTP+G CG F +GSCHA  S+D FE     + CVG   C+V V PE FGGDPCP
Sbjct  760  IKFASFGTPQGTCGSFSEGSCHAHKSYDAFEQEGLMQNCVGQEFCSVNVAPEVFGGDPCP  819

Query  290  NVMKKVAVEVVC  255
              MKK+AVE +C
Sbjct  820  GTMKKLAVEAIC  831



>ref|NP_001043405.1| Os01g0580200 [Oryza sativa Japonica Group]
 sp|Q8W0A1.1|BGAL2_ORYSJ RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB84455.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF05319.1| Os01g0580200 [Oryza sativa Japonica Group]
 dbj|BAG95853.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  C+Y G +DE KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  648  GRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGNLLVIFEEW  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR I SVCA + EWQP + NW  +   KA      KVHL C +G K IT 
Sbjct  707  GGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTKDYEKA------KVHLQCDNGQK-ITE  759

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K CVG   C V V PE FGGDPCP  MK+
Sbjct  760  IKFASFGTPQGSCGSYTEGGCHAHKSYDIFWKNCVGQERCGVSVVPEIFGGDPCPGTMKR  819

Query  275  VAVEVVC  255
              VE +C
Sbjct  820  AVVEAIC  826



>gb|EEE54862.1| hypothetical protein OsJ_02342 [Oryza sativa Japonica Group]
Length=839

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  C+Y G +DE KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  660  GRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGNLLVIFEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR I SVCA + EWQP + NW  +   KA      KVHL C +G K IT 
Sbjct  719  GGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTKDYEKA------KVHLQCDNGQK-ITE  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K CVG   C V V PE FGGDPCP  MK+
Sbjct  772  IKFASFGTPQGSCGSYTEGGCHAHKSYDIFWKNCVGQERCGVSVVPEIFGGDPCPGTMKR  831

Query  275  VAVEVVC  255
              VE +C
Sbjct  832  AVVEAIC  838



>ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dactylifera]
Length=840

 Score =   232 bits (591),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 138/187 (74%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G + E+KC +NCGE+SQ WYHVPRSWL PTGNLLV+FEEW
Sbjct  661  GRYWPGYKAYGS-CGGCDYRGTYSEKKCQTNCGESSQTWYHVPRSWLNPTGNLLVVFEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR + SV A++ E QP + NW  +  G      RPK HLSC  G K +T 
Sbjct  720  GGDPTGISMVKRIVGSVGAEISELQPSVDNWNAKVYG------RPKAHLSCPPGQK-MTN  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G+ G+F +G+CHAFHS+D F+K CVG   C+V V+PE FGGDPCP  MKK
Sbjct  773  IKFASFGTPQGVHGNFSEGACHAFHSYDAFDKNCVGQQHCSVSVSPEMFGGDPCPGTMKK  832

Query  275  VAVEVVC  255
            +AVE VC
Sbjct  833  LAVEAVC  839



>ref|XP_008672351.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58688.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=830

 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G +DE+KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  651  GRYWPGYKASGT-CGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGNLLVIFEEW  709

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR   S+CA + EWQP + NW  +   KA      KVHL C HG K +T 
Sbjct  710  GGDPTGISMVKRIAGSICADVSEWQPSMANWRTKGYEKA------KVHLQCDHGRK-MTH  762

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K C+G   C V V P+AFGGDPCP  MK+
Sbjct  763  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKSCIGQERCGVSVVPDAFGGDPCPGTMKR  822

Query  275  VAVEVVC  255
              VE +C
Sbjct  823  AVVEAIC  829



>gb|EEC70952.1| hypothetical protein OsI_02561 [Oryza sativa Indica Group]
Length=822

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  C+Y G +DE KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  643  GRYWPGYKASGN-CGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGNLLVIFEEW  701

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR I SVCA + EWQP + NW  +   KA      KVHL C +G K IT 
Sbjct  702  GGDPTGISMVKRSIGSVCADVSEWQPSMKNWHTKDYEKA------KVHLQCDNGQK-ITE  754

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K CVG   C V V PE FGGDPCP  MK+
Sbjct  755  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCVGQERCGVSVVPEIFGGDPCPGTMKR  814

Query  275  VAVEVVC  255
              VE +C
Sbjct  815  AVVEAIC  821



>gb|KDP40783.1| hypothetical protein JCGZ_24782 [Jatropha curcas]
Length=251

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  K+  D CSFCNYAG ++E+KCLSNCGEASQ+WYHVPRSWL PTGNLLV+FEEW
Sbjct  93   GRYWPAYKSSGD-CSFCNYAGTYNEKKCLSNCGEASQKWYHVPRSWLNPTGNLLVVFEEW  151

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL++RE+ SVCA ++EWQP LMN+ MQASGK ++ LRPKVHL CG G K I++
Sbjct  152  GGDPNGISLVRREVDSVCADIYEWQPTLMNYMMQASGKVDKPLRPKVHLQCGTGQK-ISS  210

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVG  348
            IKFASFGTPEG CG ++QGS   F    +   + +G
Sbjct  211  IKFASFGTPEGACGGYRQGSVTPFILMMLLTGFVLG  246



>ref|XP_003566806.1| PREDICTED: beta-galactosidase 2 [Brachypodium distachyon]
Length=831

 Score =   230 bits (587),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 132/188 (70%), Gaps = 8/188 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G ++E KC +NCG+ SQRWYHVPR WL PTGNLLVIFEEW
Sbjct  652  GRYWPGYKA-SGTCGHCDYRGEYNETKCQTNCGDPSQRWYHVPRPWLNPTGNLLVIFEEW  710

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR   SVCA + EWQP + NW  +   KAE      VHL C HG K IT 
Sbjct  711  GGDPTGISMVKRTTGSVCADVSEWQPSIKNWRTKDYEKAE------VHLQCDHGRK-ITE  763

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG++ +G CHA  S+DIF+K C+    C V V PEAFGGDPCP  MK+
Sbjct  764  IKFASFGTPQGSCGNYSEGGCHAHRSYDIFKKNCINQEWCGVSVVPEAFGGDPCPGTMKR  823

Query  275  VAVEVVCS  252
              VEV CS
Sbjct  824  AVVEVTCS  831



>ref|XP_002455836.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
 gb|EES00956.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
Length=785

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 131/187 (70%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G +DE+KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  606  GRYWPGYKA-SGTCGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGNLLVIFEEW  664

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR   S+CA + EWQP + NW  +   KA      K+HL C HG K +T 
Sbjct  665  GGDPTGISMVKRTTGSICADVSEWQPSMTNWRTKDYEKA------KIHLQCDHGRK-MTD  717

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K C+G   C V V P  FGGDPCP  MK+
Sbjct  718  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCIGQERCGVSVVPNVFGGDPCPGTMKR  777

Query  275  VAVEVVC  255
              VE +C
Sbjct  778  AVVEAIC  784



>ref|XP_004969419.1| PREDICTED: beta-galactosidase 2-like [Setaria italica]
Length=825

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 133/187 (71%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA    C  C+Y G +DE+KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  646  GRYWPGYKA-SGTCGNCDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGNLLVIFEEW  704

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS++KR   S+CA + EWQP + +W  +   KA      KVHL C H G+ IT 
Sbjct  705  GGDPTGISMVKRTTGSICADVSEWQPSMKSWHTKDYEKA------KVHLQCDH-GRKITE  757

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G+CHA  S+DIF K C+G   C V V P+ FGGDPCP  MK+
Sbjct  758  IKFASFGTPQGSCGSYSEGTCHAHKSYDIFLKNCIGQERCGVSVVPDVFGGDPCPGTMKR  817

Query  275  VAVEVVC  255
              VE +C
Sbjct  818  AVVEAIC  824



>gb|AAQ21370.1| beta-galactosidase [Sandersonia aurantiaca]
Length=568

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 135/192 (70%), Gaps = 13/192 (7%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+Y G ++E+KC SNCGE++QRWYHVPRSWL PTGNLLV+FEEW
Sbjct  384  GRYWPAYKASGS-CGGCDYRGTYNEKKCQSNCGESTQRWYHVPRSWLNPTGNLLVVFEEW  442

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GIS+++R++ SVCA++ EWQP + N      G      R K HLSC  G K +T 
Sbjct  443  GGDPSGISMVRRKVESVCAEIAEWQPNMDNVHTGNYG------RSKAHLSCAPGQK-MTN  495

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEK-----YCVGWNSCTVPVTPEAFGGDPCP  291
            IKFASFGTP+G CG F +G+CHA  S+D FEK      C+G  SC V V PE FGGDPCP
Sbjct  496  IKFASFGTPQGTCGAFSEGTCHAHKSYDAFEKESLLQNCIGQQSCAVLVAPEVFGGDPCP  555

Query  290  NVMKKVAVEVVC  255
              MKK+AVE +C
Sbjct  556  GTMKKLAVEAIC  567



>ref|XP_009611028.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana tomentosiformis]
Length=837

 Score =   229 bits (585),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  653  GRHWPGYIAKGH-CGECNYAGDYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  ASVCA + + QP L NW M +SGK+   +R K HL C   GK I+ 
Sbjct  712  GGVPTRISLVRRATASVCADIVDGQPTLKNWRMVSSGKSGN-VRRKAHLWCPD-GKKISK  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC+V V P+ FGGDPCPN  KK
Sbjct  770  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSVNVVPKVFGGDPCPNTSKK  829

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  830  LSVEAIC  836



>ref|XP_009757670.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=839

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  655  GRHWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW    SGK+   + PK HL C   GK I+ 
Sbjct  714  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVGSGKSNN-MHPKAHLCCPD-GKKISK  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC+V V PE FGGDPCPN  KK
Sbjct  772  IQFASYGVPQGTCGNFREGTCHARKSYDAFEKNCIGRQSCSVNVVPEVFGGDPCPNTSKK  831

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  832  LSVEAIC  838



>ref|XP_009611026.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana tomentosiformis]
Length=839

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  655  GRHWPGYIAKGH-CGECNYAGDYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  ASVCA + + QP L NW M +SGK+   +R K HL C   GK I+ 
Sbjct  714  GGVPTRISLVRRATASVCADIVDGQPTLKNWRMVSSGKSGN-VRRKAHLWCPD-GKKISK  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC+V V P+ FGGDPCPN  KK
Sbjct  772  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSVNVVPKVFGGDPCPNTSKK  831

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  832  LSVEAIC  838



>ref|XP_009757671.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  655  GRHWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW    SGK+   + PK HL C   GK I+ 
Sbjct  714  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVGSGKSNN-MHPKAHLCCPD-GKKISK  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC+V V PE FGGDPCPN  KK
Sbjct  772  IQFASYGVPQGTCGNFREGTCHARKSYDAFEKNCIGRQSCSVNVVPEVFGGDPCPNTSKK  831

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  832  LSVEAIC  838



>gb|KJB17252.1| hypothetical protein B456_003G0595002 [Gossypium raimondii]
Length=689

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA  + CS CNYAG +DE KC +NC EASQRWYHVPRSWL PTGNLLV+ EEW
Sbjct  505  GRHWPAYKASGN-CSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGNLLVVIEEW  563

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++RE  SVCA ++EWQP LMN++M ASGKA++ LRPKVHL C  G K I+A
Sbjct  564  GGDPNAISLVRRETDSVCADIYEWQPTLMNYQMHASGKADKPLRPKVHLECDMGQK-ISA  622

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYC  354
            +KF SFGTPEG+CG +++GSCHA+HS+D F + C
Sbjct  623  VKFVSFGTPEGVCGSYREGSCHAYHSYDAFNRVC  656



>ref|XP_006646030.1| PREDICTED: beta-galactosidase 2-like [Oryza brachyantha]
Length=827

 Score =   227 bits (578),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 130/187 (70%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KA  + C  C+Y G +DE KC +NCG++SQRWYHVPRSWL PTGNLLVIFEEW
Sbjct  648  GRYWPGYKATGN-CGTCDYRGEYDESKCQTNCGDSSQRWYHVPRSWLNPTGNLLVIFEEW  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GIS+ KR I SVCA + EWQP + NW  +   KA      KVHL C +G K IT 
Sbjct  707  GGDHTGISMAKRSIGSVCADVSEWQPSMKNWRTKDYEKA------KVHLQCDNGQK-ITE  759

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K CVG   C V V PE FGGDPCP  MK+
Sbjct  760  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCVGQERCGVSVVPEVFGGDPCPGTMKR  819

Query  275  VAVEVVC  255
              VE  C
Sbjct  820  AVVEATC  826



>ref|XP_009760186.1| PREDICTED: beta-galactosidase-like isoform X3 [Nicotiana sylvestris]
Length=809

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR WPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  625  GRQWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  683

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW   +SGK+   + PK HL C   GK I+ 
Sbjct  684  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVSSGKSNN-MHPKAHLCCPD-GKKISK  741

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC++ V PE FGGDPCPN  KK
Sbjct  742  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSLNVVPEVFGGDPCPNTSKK  801

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  802  LSVEAIC  808



>ref|XP_009760184.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=841

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR WPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  657  GRQWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW   +SGK+   + PK HL C   GK I+ 
Sbjct  716  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVSSGKSNN-MHPKAHLCCPD-GKKISK  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC++ V PE FGGDPCPN  KK
Sbjct  774  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSLNVVPEVFGGDPCPNTSKK  833

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  834  LSVEAIC  840



>ref|XP_009760185.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   226 bits (577),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR WPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  655  GRQWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW   +SGK+   + PK HL C   GK I+ 
Sbjct  714  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVSSGKSNN-MHPKAHLCCPD-GKKISK  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC++ V PE FGGDPCPN  KK
Sbjct  772  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSLNVVPEVFGGDPCPNTSKK  831

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  832  LSVEAIC  838



>ref|XP_009760187.1| PREDICTED: beta-galactosidase-like isoform X4 [Nicotiana sylvestris]
Length=807

 Score =   226 bits (576),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 135/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR WPG  A    C  CNYAG + E+KC +NCG+ SQRWYHVPRSWL+P+GNLLV+FEEW
Sbjct  623  GRQWPGYIAKGH-CGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGNLLVVFEEW  681

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  ISL++R  A VCA + + QP L NW   +SGK+   + PK HL C   GK I+ 
Sbjct  682  GGVPTRISLVRRATARVCADIVDGQPTLKNWRTVSSGKSNN-MHPKAHLCCPD-GKKISK  739

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FAS+G P+G CG+F++G+CHA  S+D FEK C+G  SC++ V PE FGGDPCPN  KK
Sbjct  740  IQFASYGVPQGTCGNFREGTCHAHKSYDAFEKNCIGRQSCSLNVVPEVFGGDPCPNTSKK  799

Query  275  VAVEVVC  255
            ++VE +C
Sbjct  800  LSVEAIC  806



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   226 bits (576),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP+  C+ C+Y G +   KC SNCG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  655  GRYWTA-YAPNGDCNSCSYIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEV  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   IS++KR ++SVCA + EW P + NW++++ G+ E   +PKVHL C   G++I+A
Sbjct  714  GGDATKISMMKRSVSSVCADVSEWHPTIKNWDIESDGQPEEYHKPKVHLRCAP-GQSISA  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP G CG+FQQG+CH+ +S+ I EK C+G   C V ++   FGGDPCPNVMK+
Sbjct  773  IKFASYGTPLGTCGNFQQGACHSPNSYTILEKNCIGQERCAVVISTTNFGGDPCPNVMKR  832

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  833  VAVEAICS  840



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   226 bits (576),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP+  C+ C+Y G +   KC SNCG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  668  GRYWTA-YAPNGDCNSCSYIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRNLLVIFEEV  726

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   IS++KR ++SVCA + EW P + NW++++ G+ E   +PKVHL C   G++I+A
Sbjct  727  GGDATKISMMKRSVSSVCADVSEWHPTIKNWDIESDGQPEEYHKPKVHLRCAP-GQSISA  785

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP G CG+FQQG+CH+ +S+ I EK C+G   C V ++   FGGDPCPNVMK+
Sbjct  786  IKFASYGTPLGTCGNFQQGACHSPNSYTILEKNCIGQERCAVVISTTNFGGDPCPNVMKR  845

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  846  VAVEAICS  853



>gb|EMT02336.1| Beta-galactosidase 2 [Aegilops tauschii]
Length=813

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 130/187 (70%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KAP   C +C+Y G ++E KC +NCG++SQRWYHVPR WL PTGNLLVIFEE 
Sbjct  634  GRYWPGYKAPGT-CGYCDYRGEYNETKCQTNCGDSSQRWYHVPRPWLNPTGNLLVIFEEI  692

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  IS++KR   SVCA + EWQP + NW  +   KA      KVHL C HG K IT 
Sbjct  693  GGDPSEISMVKRTTGSVCADVSEWQPSMTNWRTKDYEKA------KVHLQCDHGRK-ITE  745

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP+G CG + +G CHA  S+DIF K C+    C V V PE FGGDPCP  MK+
Sbjct  746  IKFASFGTPQGSCGSYSEGGCHAHKSYDIFRKNCINQEHCAVCVVPEVFGGDPCPGTMKR  805

Query  275  VAVEVVC  255
              VEV+C
Sbjct  806  AVVEVMC  812



>gb|KHN06610.1| Beta-galactosidase [Glycine soja]
Length=831

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  C YAG + ++KC +NCGE SQRWYH+PRSWL P+GN LV+FEEW
Sbjct  649  GRHWPGYIA-RGSCGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEW  707

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KR  ASVCA +FE QP L N +M  SGK    +RPK HL C  G K I+ 
Sbjct  708  GGDPTGISLVKRTTASVCADIFEGQPTLKNRQMLDSGK---VIRPKAHLWCPPGQK-ISK  763

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P G CG+F++GSCHA  S+D  +K C+G  SC V V PE FGGDPCP + KK
Sbjct  764  IKFASYGLPHGTCGNFREGSCHAHKSYDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKK  823

Query  275  VAVEVVCS  252
             ++E +CS
Sbjct  824  FSLEALCS  831



>gb|EMS53990.1| Beta-galactosidase 2 [Triticum urartu]
Length=807

 Score =   225 bits (574),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 131/187 (70%), Gaps = 8/187 (4%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WPG KAP   C +C+Y G +DE KC +NCG++SQRWYHVPR+WL PTGNLLVIFEE 
Sbjct  628  GRYWPGYKAPGT-CGYCDYRGEYDETKCQTNCGDSSQRWYHVPRAWLNPTGNLLVIFEEM  686

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  IS++KR   SVCA + EWQP + NW  +   KA      KVHL C HG K IT 
Sbjct  687  GGDPSEISMVKRTRGSVCADVSEWQPSMTNWRTKDYEKA------KVHLQCDHGRK-ITE  739

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            +KFASFGTP+G CG + +G CHA  S+DIF K C+    C V V P+ FGGDPCP  MK+
Sbjct  740  VKFASFGTPQGSCGSYSEGGCHAHKSYDIFWKNCINQEHCAVSVVPQVFGGDPCPGTMKR  799

Query  275  VAVEVVC  255
              VEV+C
Sbjct  800  AVVEVMC  806



>gb|KHN17668.1| Beta-galactosidase [Glycine soja]
Length=771

 Score =   224 bits (572),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  C YAG + ++KC +NCGE SQRWYH+PRSWL P+GN LV+FEEW
Sbjct  589  GRHWPGYIARGN-CGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEW  647

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L+KR  ASVCA +++ QP L N +M  SGK    +RPK HL C   GKNI+ 
Sbjct  648  GGDPTGITLVKRTTASVCADIYQGQPTLKNRQMLDSGK---VVRPKAHLWC-PPGKNISQ  703

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG+F++GSCHA  S+D  +K C+G  SC V V PE FGGDPCP + KK
Sbjct  704  IKFASYGLPQGTCGNFREGSCHAHKSYDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKK  763

Query  275  VAVEVVC  255
            +++E +C
Sbjct  764  LSLEALC  770



>dbj|BAF31234.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A +  C+ C+YAG +   KC + CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  659  GRYW--TAAANGDCNHCSYAGTYRAPKCQTGCGQPTQRWYHVPRSWLQPTKNLLVIFEEI  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GISL+KR ++SVCA + EW P + NW +++ G++E   RPKVHL C   G++I+A
Sbjct  717  GGDASGISLVKRSVSSVCADVSEWHPTIKNWHIESYGRSEELHRPKVHLRCAM-GQSISA  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  I EK C+G   C V ++   FGGDPCPNVMK+
Sbjct  776  IKFASFGTPLGTCGSFQQGPCHSPNSHAILEKKCIGQQRCAVTISMNNFGGDPCPNVMKR  835

Query  275  VAVEVVCS  252
            VAVE +C+
Sbjct  836  VAVEAICT  843



>ref|XP_003550633.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=839

 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 5/187 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  C YAG + ++KC +NCGE SQRWYH+PRSWL P+GN LV+FEEW
Sbjct  657  GRHWPGYIARGN-CGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVFEEW  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L+KR  ASVCA +++ QP L N +M  SGK    +RPK HL C   GKNI+ 
Sbjct  716  GGDPTGITLVKRTTASVCADIYQGQPTLKNRQMLDSGK---VVRPKAHLWC-PPGKNISQ  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG+F++GSCHA  S+D  +K C+G  SC V V PE FGGDPCP + KK
Sbjct  772  IKFASYGLPQGTCGNFREGSCHAHKSYDAPQKNCIGKQSCLVTVAPEVFGGDPCPGIAKK  831

Query  275  VAVEVVC  255
            +++E +C
Sbjct  832  LSLEALC  838



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A    C  CNYAG F E KC +NCG+ SQRWYH+PRSWL PT NLLV+FEEW
Sbjct  671  GRHWPSYVA-GGSCGECNYAGIFVENKCRTNCGQPSQRWYHIPRSWLNPTANLLVVFEEW  729

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P GISL+KR   SVCA +F+ QP L +  + +SGK+  +  PKVHL+C   G+ I+ 
Sbjct  730  GGEPAGISLVKRMTGSVCADIFDGQPALKDRHLVSSGKS-NSTYPKVHLTCPR-GQEISE  787

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG++Q+G CHA  S+D   K C+G   C+V V PE FGGDPCPN  KK
Sbjct  788  IKFASYGLPQGTCGNYQEGPCHAHRSYDALRKNCIGKQLCSVTVAPEVFGGDPCPNSEKK  847

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  848  LSVEAICS  855



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C  C YAG +D++KC ++CGE SQRWYHVPRSWL P+GNLLV+FEEW
Sbjct  654  GRHWPAYTARGN-CGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R  +SVCA +FE QP L N +  ASGK     RPK HL C   G+ I+ 
Sbjct  713  GGDPTKISLVERRTSSVCADIFEGQPTLTNSQKLASGKLN---RPKAHLWC-PPGQVISD  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG FQ+GSCHA  S+D  ++ C+G  SC+V V PEAFGGDPCP   KK
Sbjct  769  IKFASYGLPQGTCGSFQEGSCHAHKSYDAPKRNCIGKQSCSVAVAPEAFGGDPCPGSTKK  828

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  829  LSVEAVCS  836



>ref|XP_010437357.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=257

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  63   GRYWTAFATGD--CGHCSYTGTYKPNKCQTGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  120

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  121  GGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  179

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  180  IKFASFGTPLGTCGSYQQGECHATTSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  239

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  240  LTVEAVCA  247



>dbj|BAD95183.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=275

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  81   GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  138

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  139  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  197

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  198  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  257

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  258  LTVEAVCA  265



>ref|XP_008440778.1| PREDICTED: beta-galactosidase 3 [Cucumis melo]
Length=854

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C  CNYAG F   KC   CG+ +QRWYHVPR+WL+P  NLLV+FEE 
Sbjct  658  GRYWTAYATGN--CDKCNYAGTFRPPKCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA + E+ P L NW +++ GK+E   RPKVHL C   G +IT+
Sbjct  716  GGNPTSISLVKRSVTSVCADVSEYHPTLKNWHIESYGKSEDLHRPKVHLKCS-AGYSITS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+DI EK C+G   C V ++   FG DPCPNV+K+
Sbjct  775  IKFASFGTPLGTCGSYQQGTCHAPMSYDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKR  834

Query  275  VAVEVVCS  252
            ++VEVVC+
Sbjct  835  LSVEVVCA  842



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C  C YAG +D++KC ++CGE SQRWYHVPRSWL P+GNLLV+FEEW
Sbjct  654  GRHWPAYTARGN-CGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R  +SVCA +FE QP L N +  ASGK     RPK HL C   G+ I+ 
Sbjct  713  GGDPTKISLVERRTSSVCADIFEGQPTLTNSQKLASGKLN---RPKAHLWC-PPGQVISD  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG FQ+GSCHA  S+D  ++ C+G  SC+V V PE FGGDPCP   KK
Sbjct  769  IKFASYGLPQGTCGSFQEGSCHAHKSYDAPKRNCIGKQSCSVAVAPEVFGGDPCPGSTKK  828

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  829  LSVEAVCS  836



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP + C  C+Y G +   KC S CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  656  GRYWTA-YAPKENCKSCSYTGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+ R ++SVCA + EW P + NW +++ G+ E   +PKVHL C   G++I+A
Sbjct  715  GGDATKIALMMRSVSSVCADVSEWHPTIKNWHIESYGEPEEYRKPKVHLRCAP-GQSISA  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP G CG+FQQG+CH+ +S  I EK C+G   C V ++   FGGDPCPNVMKK
Sbjct  774  IKFASYGTPLGTCGNFQQGACHSPNSHTILEKKCIGKEKCVVAISQANFGGDPCPNVMKK  833

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  834  VAVEAVCS  841



>ref|XP_002310279.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90729.2| beta-galactosidase family protein [Populus trichocarpa]
Length=847

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 137/188 (73%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    + +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYWTAYASGN--CNGCSYAGTFRPTKCQLGCGQPTQRWYHVPRSWLKPTNNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR +ASVCA++ E+ P + NW++++ G+AE    PKVHL C  GG++IT+
Sbjct  715  GGDPSRISLVKRSLASVCAEVSEFHPTIKNWQIESYGRAEEFHSPKVHLRCS-GGQSITS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+ I EK C+G   C V ++   FG DPCPNVMKK
Sbjct  774  IKFASFGTPLGTCGSYQQGACHASTSYAILEKKCIGKQRCAVTISNSNFGQDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>ref|XP_010029731.1| PREDICTED: beta-galactosidase 3 [Eucalyptus grandis]
 gb|KCW56689.1| hypothetical protein EUGRSUZ_I02384 [Eucalyptus grandis]
Length=849

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  659  GRYWTAYATGD--CNGCNYAGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA + E+ P L NW +++ GK+E    PKVHL C   G++I++
Sbjct  717  GGNPSKISLVKRSMTSVCADVTEFHPTLKNWHIESYGKSEEFHNPKVHLRCSP-GQSISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+DI EK C+G   C+V ++   FG DPCPNV+K+
Sbjct  776  IKFASFGTPLGTCGSYQQGACHAQSSYDILEKKCIGKERCSVTISNSNFGRDPCPNVLKR  835

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  836  LSVEAVCT  843



>ref|XP_004149980.1| PREDICTED: beta-galactosidase 3 [Cucumis sativus]
Length=854

 Score =   220 bits (561),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C  CNYAG F   KC   CG+ +QRWYHVPR+WL+P  NLLV+FEE 
Sbjct  658  GRYWTAYATGN--CDKCNYAGTFRPPKCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR +  VCA + E+ P L NW +++ GK+E   RPKVHL C   G +IT+
Sbjct  716  GGNPTSISLVKRSVTGVCADVSEYHPTLKNWHIESYGKSEDLHRPKVHLKCS-AGYSITS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+DI EK C+G   C V ++   FG DPCPNV+K+
Sbjct  775  IKFASFGTPLGTCGSYQQGTCHAPMSYDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKR  834

Query  275  VAVEVVCS  252
            ++VEVVC+
Sbjct  835  LSVEVVCA  842



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 5/187 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  C+YAG + ++KC +NCGE SQRWYHVPRSWL+P+GN LV++EEW
Sbjct  661  GRHWPGYIAHGN-CYACDYAGTYSDQKCRTNCGEPSQRWYHVPRSWLKPSGNFLVVYEEW  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L KR  ASVCA +FE QP +    M  +G   R  RPK HL C  G K I+ 
Sbjct  720  GGDPNGIALAKRTTASVCADIFEGQPTMKKRGMLIAG---RISRPKAHLWCPPGQK-ISK  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FAS+G PEG CG+F++GSCHA  S+D F+K C+G  SC+V V PE FGGDPCP   KK
Sbjct  776  INFASYGMPEGSCGNFREGSCHAHKSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPGSRKK  835

Query  275  VAVEVVC  255
            ++VE  C
Sbjct  836  LSVEAAC  842



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 5/187 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  C+YAG + ++KC +NCGE SQRWYHVPRSWL+P+GN LV++EEW
Sbjct  660  GRHWPGYIAHGN-CYACDYAGTYSDQKCRTNCGEPSQRWYHVPRSWLKPSGNFLVVYEEW  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L KR  ASVCA +FE QP +    M  +G   R  RPK HL C  G K I+ 
Sbjct  719  GGDPNGIALAKRTTASVCADIFEGQPTMKKRGMLIAG---RISRPKAHLWCPPGQK-ISK  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FAS+G PEG CG+F++GSCHA  S+D F+K C+G  SC+V V PE FGGDPCP   KK
Sbjct  775  INFASYGMPEGSCGNFREGSCHAHKSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPGSRKK  834

Query  275  VAVEVVC  255
            ++VE  C
Sbjct  835  LSVEAAC  841



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C  C YAG +D++KC ++CGE SQRWYHVPRSWL P+ NLLV+FEEW
Sbjct  654  GRHWPAYTARGN-CGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSENLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R  +SVCA +FE QP L N +  ASGK     RPK HL C   G+ I+ 
Sbjct  713  GGDPTKISLVERRTSSVCADIFEGQPTLTNSQKLASGKLN---RPKAHLWC-PPGQVISD  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG FQ+GSCHA  S+D  ++ C+G  SC+V V PE FGGDPCP   KK
Sbjct  769  IKFASYGLPQGTCGSFQEGSCHAHKSYDAPKRNCIGKQSCSVTVAPEVFGGDPCPGSTKK  828

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  829  LSVEAVCS  836



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    APD  C  CNYAG +    C S CG+ +QRWYHVPRSWL+P  NLLV+FEE 
Sbjct  660  GRYW-SLWAPDGDCKGCNYAGTYRSPNCQSGCGQPTQRWYHVPRSWLQPAQNLLVVFEEL  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL+K+ ++SVCA + EW P + NW +++ G+     +PKVHL C   G++I+A
Sbjct  719  GGDATKISLVKKSVSSVCADVSEWHPTIKNWHIESYGQPVEHHKPKVHLRCAP-GQSISA  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+FQQG+CH+ +S    EK C+G   C V ++ + FGGDPCPNVMK+
Sbjct  778  IKFASFGTPLGTCGNFQQGACHSTNSHSTLEKKCIGQQRCAVTISTDNFGGDPCPNVMKR  837

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  838  VAVEAICS  845



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C+ CNYAG F+++KC + CG  SQRWYHVPRSWL+P+GN L++FEE 
Sbjct  649  GRHWPAYTAHGN-CNGCNYAGIFNDKKCQTGCGGPSQRWYHVPRSWLKPSGNQLIVFEEL  707

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GI+L+KR +  VCA +FE QP L N ++  S K   +L+ K HL C  G K I+ 
Sbjct  708  GGNPAGITLVKRTMDRVCADIFEGQPSLKNSQIIGSSKV-NSLQSKAHLWCAPGLK-ISK  765

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FASFG P+G CG F++GSCHA  S+D  ++ C+G  SC+V V PE FGGDPCP  MKK
Sbjct  766  IQFASFGVPQGTCGSFREGSCHAHKSYDALQRNCIGKQSCSVSVAPEVFGGDPCPGSMKK  825

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  826  LSVEALCS  833



>ref|XP_007154660.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
 gb|ESW26654.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
Length=833

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 134/188 (71%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A    C  C YAG ++++KC +NCGE SQRWYH+PRSWL P+GN LV+ EEW
Sbjct  651  GRHWPGYIARGH-CGECYYAGTYNDKKCRTNCGEPSQRWYHIPRSWLNPSGNYLVVLEEW  709

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GISL+KR  ASVCA ++E QP L +  M  +GK     RPK HL C  G K I+ 
Sbjct  710  GGDPNGISLVKRTTASVCADIYEGQPTLKSRHMLDTGKIN---RPKAHLWCPPGLK-ISQ  765

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG++++GSCHA  S+D  EK C+G  SC+V V PE FGGDPCP   KK
Sbjct  766  IKFASYGLPQGTCGNYREGSCHAHRSYDAPEKNCIGKQSCSVTVAPEVFGGDPCPGTAKK  825

Query  275  VAVEVVCS  252
            +++E +CS
Sbjct  826  LSLEALCS  833



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =   218 bits (554),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C+ CNYAG F+++KC + CG  SQRWYHVPRSWL+P+GN L++FEE 
Sbjct  652  GRHWPAYTAHGN-CNGCNYAGIFNDKKCQTGCGGPSQRWYHVPRSWLKPSGNQLIVFEEL  710

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP GI+L+KR +  VCA +FE QP L N ++  S K   +L+ K HL C  G K I+ 
Sbjct  711  GGNPAGITLVKRTMDRVCADIFEGQPSLKNSQIIGSSKV-NSLQSKAHLWCAPGLK-ISK  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FASFG P+G CG F++GSCHA  S+D  ++ C+G  SC+V V PE FGGDPCP  MKK
Sbjct  769  IQFASFGVPQGTCGSFREGSCHAHKSYDALQRNCIGKQSCSVSVAPEVFGGDPCPGSMKK  828

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  829  LSVEALCS  836



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   218 bits (554),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP+  C+ CNYAG +   KC S CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYW-SLWAPNGDCNGCNYAGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTQNLLVVFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   IS +K+ ++ VCA + EW P + NW +++ G+ E   +PKVHL C   G++I+A
Sbjct  716  GGDATKISFVKKSVSGVCADVSEWHPMIKNWHIESYGQPEEHHKPKVHLRCAP-GQSISA  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+F+QG+CH+ +S    EK C+G   C V ++ + FGGDPCPNVMK+
Sbjct  775  IKFASFGTPLGTCGNFEQGACHSPNSHSTLEKKCIGQQRCAVTISTDNFGGDPCPNVMKR  834

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  835  VAVEAICS  842



>ref|XP_011025878.1| PREDICTED: beta-galactosidase 3 [Populus euphratica]
Length=847

 Score =   218 bits (554),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    + +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYWTAYASGN--CNGCSYAGTFRPTKCQLGCGQPTQRWYHVPRSWLKPTNNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR +ASVCA++ E+ P + NW++++ G+AE    PKVHL C   G++IT+
Sbjct  715  GGDPSRISLVKRSLASVCAEVSEFHPTIKNWQIESYGRAEEFHNPKVHLRCSV-GQSITS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+ I EK C+G   C V ++   FG DPCPNVMKK
Sbjct  774  IKFASFGTPLGTCGSYQQGACHASTSYAILEKKCIGKQRCAVTISNSNFGQDPCPNVMKK  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>dbj|BAF01862.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=578

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  384  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  441

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  442  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCS-PGQAIAS  500

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  501  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  560

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  561  LTVEAVCA  568



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 133/188 (71%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP  KA   GC  CNYAG F ++KC ++CG+ SQRWYHVPRSWL PTGNLLV+FEEW
Sbjct  656  GRHWPAYKA-SGGCGPCNYAGTFTDKKCRTDCGQPSQRWYHVPRSWLNPTGNLLVVFEEW  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I+L +R   +VCA + E QP + NW    SGK   A   K HL C  G K I+ 
Sbjct  715  GGDPNWINLDQRTTGTVCADIHEGQPTMENWGALGSGKVAVA---KAHLWCPPGHK-ISQ  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG+++ GSCHA  S+D+ +K CVG  SCTV V P+ FGGDPCP V KK
Sbjct  771  IKFASYGVPQGTCGNYRAGSCHAHKSYDVPQKNCVGQQSCTVIVAPQFFGGDPCPGVAKK  830

Query  275  VAVEVVCS  252
            +++E +CS
Sbjct  831  LSLEAICS  838



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP + C+ C+Y G +   KC S CG+ +QRWYHVPRSWL+PT NLL++FEE 
Sbjct  650  GRYWTA-YAPSEYCNSCSYRGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRNLLIVFEEL  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL KR ++SVCA + EW P + NW ++  G+ E   +PKVHL C   G+ I+A
Sbjct  709  GGDATKISLAKRSVSSVCADVSEWHPTIKNWHIENYGRPEEHHKPKVHLRCAQ-GQFISA  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP G CG+FQQG+CH+ +S  I EK C+G   C V ++   FGGDPC NVMK+
Sbjct  768  IKFASYGTPIGTCGNFQQGACHSPNSHTILEKMCIGKEKCMVAISQNIFGGDPCRNVMKR  827

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  828  VAVEAICS  835



>gb|KJB17716.1| hypothetical protein B456_003G011900 [Gossypium raimondii]
Length=854

 Score =   216 bits (550),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y+G F   KC   CG+ +Q+WYHVPRSWL+PT NLLV+FEE 
Sbjct  658  GRYWTAYAHGD--CSGCSYSGTFRPTKCQLGCGQPTQKWYHVPRSWLKPTQNLLVLFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR +++VCA++ E+ P + NW++++ GK E   RPKVHL C   G+ I++
Sbjct  716  GGDPSKISLVKRSVSTVCAEISEYHPNIKNWQIESYGKTEEFHRPKVHLHCSP-GQAISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+DI EK CVG   C V ++   FG DPCPNV+K+
Sbjct  775  IKFASFGTPLGTCGSYQQGPCHAPTSYDILEKRCVGKQRCAVTISNSNFGHDPCPNVLKR  834

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  835  LSVEAVCA  842



>gb|ABY71826.1| beta-galactosidase [Prunus salicina]
Length=836

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 133/188 (71%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A  + C  C YAG +D++KC ++CGE SQRWYHVPRSWL  +GNLLV+FEEW
Sbjct  654  GRHWPAYTARGN-CGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTTSGNLLVVFEEW  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R  +SVCA +FE QP L N +  ASGK     RPK HL C   G+ I+ 
Sbjct  713  GGDPTKISLVERRTSSVCADIFEGQPTLTNSQKLASGKLN---RPKAHLWC-PPGQVISD  768

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G  +G CG FQ+GSCHA  S+D  ++ C+G  SC+V V PE FGGDPCP   KK
Sbjct  769  IKFASYGLSQGTCGSFQEGSCHAHKSYDAPKRNCIGKQSCSVTVAPEVFGGDPCPGSTKK  828

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  829  LSVEAVCS  836



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP+  C  CNYAG +   KC + CG+ +Q WYHVPRSWL+PT NLLV+FEE 
Sbjct  653  GRYWT-LLAPNGDCKGCNYAGTYRIPKCQTGCGQPTQLWYHVPRSWLQPTKNLLVVFEEL  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL+K+ ++SVCA + EW P + +W +Q+ G+ E   +PKVHL C   G+ I+A
Sbjct  712  GGDATKISLVKKSVSSVCADVSEWHPTIKSWHIQSYGQPEEYHKPKVHLRCA-SGQLISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+FQQG+CH+ +S    EK CVG   C V ++   FGGDPCP+VMK+
Sbjct  771  IKFASFGTPLGTCGNFQQGACHSPNSHTTLEKKCVGQQRCAVTISTNNFGGDPCPDVMKR  830

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  831  VAVEAVCS  838



>gb|KJB43424.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=854

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYWTAYAHGD--CNGCNYAGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVLFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW++++ GKA++  RPKVHL C   G++I+ 
Sbjct  715  GGDPTRISLVKRSVSSVCADVTEYHPNIKNWQIESYGKAQQLRRPKVHLRCSP-GQSISF  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I EK CVG   C V +    FG DPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGSYQQGPCHAPASYAIVEKKCVGKQRCVVTIANSNFGQDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>gb|KJB43422.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=850

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  653  GRYWTAYAHGD--CNGCNYAGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVLFEEL  710

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW++++ GKA++  RPKVHL C   G++I+ 
Sbjct  711  GGDPTRISLVKRSVSSVCADVTEYHPNIKNWQIESYGKAQQLRRPKVHLRCSP-GQSISF  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I EK CVG   C V +    FG DPCPNV+K+
Sbjct  770  IKFASFGTPLGTCGSYQQGPCHAPASYAIVEKKCVGKQRCVVTIANSNFGQDPCPNVLKR  829

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  830  LSVEAVCA  837



>gb|KJB43419.1| hypothetical protein B456_007G198900 [Gossypium raimondii]
Length=859

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  662  GRYWTAYAHGD--CNGCNYAGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVLFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW++++ GKA++  RPKVHL C   G++I+ 
Sbjct  720  GGDPTRISLVKRSVSSVCADVTEYHPNIKNWQIESYGKAQQLRRPKVHLRCSP-GQSISF  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I EK CVG   C V +    FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGPCHAPASYAIVEKKCVGKQRCVVTIANSNFGQDPCPNVLKR  838

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  839  LSVEAVCA  846



>gb|KFK30264.1| hypothetical protein AALP_AA7G238600 [Arabis alpina]
Length=849

 Score =   215 bits (547),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC S CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  655  GRYWTAFATGD--CSHCSYTGTYKPNKCQSGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I+A
Sbjct  713  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAISA  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  772  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  831

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  832  LTVEAVCA  839



>gb|KHG01120.1| Beta-galactosidase [Gossypium arboreum]
Length=837

 Score =   214 bits (546),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 131/187 (70%), Gaps = 5/187 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWPG  A  + C  C+Y+G + ++KC +NCG+ SQRWYHVPRSWL+P+GN LV+FEEW
Sbjct  655  GRHWPGYIAHGN-CDACDYSGTYSDQKCRTNCGQPSQRWYHVPRSWLKPSGNFLVVFEEW  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P GI+L KR   SVCA +FE QP +    M  +G   R   PK HL C  G K I+ 
Sbjct  714  GGDPNGIALAKRTTRSVCADIFEGQPTMKKRGMLIAG---RISSPKAHLWCPPGQK-ISK  769

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FAS+G PEG CG+F++GSCHA  S+D F+K C+G  SC+V V PE FGGDPCP   KK
Sbjct  770  INFASYGMPEGSCGNFREGSCHANKSYDAFQKNCIGKQSCSVTVAPEVFGGDPCPGSRKK  829

Query  275  VAVEVVC  255
            V+VE  C
Sbjct  830  VSVEAAC  836



>ref|XP_009145073.1| PREDICTED: beta-galactosidase 3 [Brassica rapa]
Length=856

 Score =   214 bits (546),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KCLS CG+ +QR+YHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCLSGCGQPTQRYYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I+A
Sbjct  720  GGNPSAVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFRRPKVHLKCSP-GQAISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGKCGSYQQGECHATTSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VCS
Sbjct  839  LTVEAVCS  846



>gb|AAQ21369.1| beta-galactosidase [Sandersonia aurantiaca]
Length=826

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (69%), Gaps = 9/187 (5%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP  KA    C  C+Y G ++E KC SNCG++SQRWYHVPRSWL PTGNL+V+FEEW
Sbjct  648  GRYWPAYKA-RGSCPKCDYEGTYEETKCQSNCGDSSQRWYHVPRSWLNPTGNLIVVFEEW  706

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P GISL+KR + S CA + + QP + NW  + +         KVHLSC  G K +T 
Sbjct  707  GGEPTGISLVKRSMRSACAYVSQGQPSMNNWHTKYA-------ESKVHLSCDPGLK-MTQ  758

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP+G C  + +G CHA  S+DIF+K C+G   C+V V PE FGGDPCP +MK 
Sbjct  759  IKFASYGTPQGACESYSEGRCHAHKSYDIFQKNCIGQQVCSVTVVPEVFGGDPCPGIMKS  818

Query  275  VAVEVVC  255
            VAV+  C
Sbjct  819  VAVQASC  825



>ref|XP_006838689.1| PREDICTED: beta-galactosidase 5 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A    C  C+Y G +   KC + CG  +QRWYHVPRSWL+PTGNLL++FEE 
Sbjct  653  GRYWPAYLAQGQ-CGACDYTGTYRPNKCQTGCGHPTQRWYHVPRSWLQPTGNLLIVFEEI  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GISL +R + SVCA + E+ P + NW +++ G+A+  ++PKVHL C   G++I+A
Sbjct  712  GGDVSGISLGRRSVESVCADVSEFHPVVKNWHIESYGRAQPVIKPKVHLHCSP-GQSISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG+CH+ +S D+ +K C+G   C+V ++   F GDPCPN+MK+
Sbjct  771  IKFASFGTPLGTCGSFQQGACHSPNSHDVLQKKCIGRQRCSVTISTNIF-GDPCPNIMKR  829

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  830  VAVEAVCS  837



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+Y+G F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  656  GRYW--TIYANGNCNGCSYSGTFRPPKCQIGCGQPTQRWYHVPRSWLKPTQNLLVVFEEI  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+  GISL+KR ++SVCA + EW P + NW++++ G+ +   RPKVHL C   G++I+A
Sbjct  714  GGDASGISLVKRSVSSVCADVSEWHPNIKNWQIESYGRTQEFHRPKVHLRCAP-GQSISA  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CHA  S+ + E+ CVG   C+V ++   FG DPCPNV+K+
Sbjct  773  IKFASFGTPLGTCGSFQQGICHAPTSYSVLEERCVGQERCSVTISNRNFGADPCPNVLKR  832

Query  275  VAVEVVCS  252
            + VE +C+
Sbjct  833  LTVEAICA  840



>ref|XP_010531064.1| PREDICTED: beta-galactosidase 3 [Tarenaya hassleriana]
Length=855

 Score =   213 bits (541),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG +   KC + CG+ +QRWYHVPRSWL+P  NLLVIFEE 
Sbjct  661  GRYWTAFATGN--CNHCSYAGTYKPTKCQTGCGQPTQRWYHVPRSWLKPGQNLLVIFEEL  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA++ E+ P + NW+++  GKAE    PKVHL C   G+ I++
Sbjct  719  GGNPSTISLVKRSVSSVCAEISEYHPNIKNWQIENYGKAEDFRTPKVHLRC-RPGQTISS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V V+   FG DPCPNV+K+
Sbjct  778  IKFASFGTPLGTCGSYQQGQCHAPASYAILERKCVGKQRCAVTVSNSNFGQDPCPNVLKR  837

Query  275  VAVEVVC  255
            ++VE VC
Sbjct  838  LSVEAVC  844



>ref|XP_008660537.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 5-like [Zea 
mays]
Length=842

 Score =   213 bits (541),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC S CG+ +QRWYHVP+SWL+PT NLLV+FEE 
Sbjct  656  GRYW--TAYADGDCKECSYTGTFRAPKCQSGCGQPTQRWYHVPKSWLQPTRNLLVVFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+KR ++SVCA + E  P + NW++++ G+ E   R KVHL C  G ++I+A
Sbjct  714  GGDSSKIALVKRSVSSVCADVSEDHPNIKNWQIESYGEREYH-RAKVHLRCARG-QSISA  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CGDFQQG CH+ +S  + EK C+G   C V ++PE+FGGDPCP+V K+
Sbjct  772  IKFASFGTPTGTCGDFQQGDCHSANSHTVLEKKCIGLQRCVVAISPESFGGDPCPSVTKR  831

Query  275  VAVEVVCS  252
            VAV+ VCS
Sbjct  832  VAVQAVCS  839



>ref|XP_007158611.1| hypothetical protein PHAVU_002G1672001g, partial [Phaseolus vulgaris]
 gb|ESW30605.1| hypothetical protein PHAVU_002G1672001g, partial [Phaseolus vulgaris]
Length=487

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A D  C  C+YAG F   KC   CG+ +QRWYHVPRSWL+P  NLLV+FEE 
Sbjct  297  GRYWTALAAGD--CKGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEEL  354

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL KR ++SVCA + E+Q  + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  355  GGDPSKISLAKRSVSSVCADVSEFQSNVRNWHIESYGKSEEFHPPKVHLHCS-SGQTISS  413

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG ++QG CH+  S+ I EK C+G   CTV V+   FG DPCPNV+K+
Sbjct  414  IKFASFGTPLGTCGSYEQGVCHSPSSYSILEKKCIGKPRCTVTVSNSNFGHDPCPNVLKR  473

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  474  LTVEAVCA  481



>gb|EPS60900.1| beta-galactosidase, partial [Genlisea aurea]
Length=205

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 124/187 (66%), Gaps = 3/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A +  C  C Y G F   KC   CG+ +QRWYH+PRSW++PT NL+V+ EE 
Sbjct  22   GRYWTAYAAGN--CGQCGYEGTFRPPKCQQGCGQPTQRWYHLPRSWIKPTQNLVVLLEEL  79

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I L+KR + SVCA + E+ P + NW+++  G+ E   +PK+HL CG  G+ I++
Sbjct  80   GGDPASIKLVKRSVRSVCADVTEFHPNIRNWQLENYGQPEAFHKPKIHLKCG-SGQTISS  138

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG F QG CHA  S+   EK CVG   C+V ++   FG DPCPNV+K+
Sbjct  139  IKFASFGTPMGTCGKFSQGPCHAPSSYSTLEKKCVGKERCSVTISTTNFGQDPCPNVLKR  198

Query  275  VAVEVVC  255
            ++VE  C
Sbjct  199  LSVEAAC  205



>dbj|BAJ34544.1| unnamed protein product [Thellungiella halophila]
Length=856

 Score =   211 bits (538),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC S CG+ +Q+WYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCNSGCGQPTQKWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I+A
Sbjct  720  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFRRPKVHLKCSP-GQAISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGDCHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_006412011.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
 gb|ESQ53464.1| hypothetical protein EUTSA_v10024387mg [Eutrema salsugineum]
Length=856

 Score =   211 bits (538),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC S CG+ +Q+WYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCNSGCGQPTQKWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I+A
Sbjct  720  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFRRPKVHLKCSP-GQAISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGDCHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_004509327.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=851

 Score =   211 bits (538),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ CNYAG F  +KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  659  GRYW--TAFANGNCNDCNYAGSFRPQKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA + E+ P + NW + + GK+E    PKVHL C   G+ I++
Sbjct  717  GGNPSKISLVKRSVSSVCADVSEYHPNIKNWHIDSYGKSEEFHAPKVHLHCS-PGQTISS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   C V V+   FG DPCP VMK+
Sbjct  776  IKFASFGTPLGTCGNYEQGACHSPTSYAILEKKCLGKPRCVVTVSNSNFGQDPCPRVMKR  835

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  836  LSVEAVCA  843



>ref|XP_006425593.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
 ref|XP_006466876.1| PREDICTED: beta-galactosidase 3-like [Citrus sinensis]
 gb|ESR38833.1| hypothetical protein CICLE_v10024881mg [Citrus clementina]
Length=854

 Score =   211 bits (538),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNY G +   KC   CG+ +QRWYHVPRSWL+PT N LV+FEE 
Sbjct  657  GRYWTAYAKGD--CNGCNYVGGYRPTKCQLGCGQPTQRWYHVPRSWLKPTQNFLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA++ E+ P + NW +++ GK E    PKVHL C   G  I++
Sbjct  715  GGNPSRISLVKRSVTSVCAEVAEYHPTIKNWHIESYGKPEEFHSPKVHLRCS-PGHTISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CH+  S+DI EK CVG   C V ++   FG DPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGSYQQGPCHSPTSYDILEKKCVGKQRCAVTISNSNFGVDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>gb|KDO71052.1| hypothetical protein CISIN_1g003044mg [Citrus sinensis]
Length=854

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ CNY G +   KC   CG+ +QRWYHVPRSWL+PT N LV+FEE 
Sbjct  657  GRYWTAYAKGD--CNGCNYVGGYRPTKCQLGCGQPTQRWYHVPRSWLKPTQNFLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA++ E+ P + NW +++ GK E    PKVHL C   G  I++
Sbjct  715  GGNPSRISLVKRSVTSVCAEVAEYHPTIKNWHIESYGKPEEFHSPKVHLRCS-PGHTISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CH+  S+DI EK CVG   C V ++   FG DPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGSYQQGPCHSPTSYDILEKKCVGKQRCAVTISNSNFGVDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>emb|CDY59693.1| BnaC07g51120D [Brassica napus]
Length=856

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KCLS CG+ +QR+YHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CDHCSYTGTYKPNKCLSGCGQPTQRYYHVPRSWLKPSQNLLVIFEEI  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
             GNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I+A
Sbjct  720  EGNPSAVSLVKRSVSGVCAEVSEYHPNIKNWQLESYGKGQTFHRPKVHLKCS-PGQAISA  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +Q+G CHA  S+ I EK CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGKCGSYQEGECHAATSYAILEKKCVGKARCAVTISNTNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VCS
Sbjct  839  LTVEAVCS  846



>emb|CAB16852.1| beta-galactosidase like protein [Arabidopsis thaliana]
 emb|CAB80302.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  659  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  717  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  776  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  835

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  836  LTVEAVCA  843



>ref|NP_568001.1| beta-galactosidase 3 [Arabidopsis thaliana]
 sp|Q9SCV9.1|BGAL3_ARATH RecName: Full=Beta-galactosidase 3; Short=Lactase 3; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64739.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAL07134.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AAM14371.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE86646.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=856

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_010446807.1| PREDICTED: beta-galactosidase 3 [Camelina sativa]
Length=856

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCQTGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGECHATTSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_010437358.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCQTGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGECHATTSYAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>gb|KDP32675.1| hypothetical protein JCGZ_13673 [Jatropha curcas]
Length=790

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  600  GRYWTAYATGN--CNGCSYAGSFRPPKCQVGCGQPTQRWYHVPRSWLKPTQNLLVVFEEL  657

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA++ E+ P + NW +++ G+AE    PKVH+ C   G++I+A
Sbjct  658  GGNPSRISLVKRAMTSVCAEVAEFHPTIKNWHIESYGRAEEFHSPKVHIRCSL-GQSISA  716

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CH+  S+ I EK CVG   CTV ++   FG DPCPNV+K+
Sbjct  717  IKFASFGTPLGTCGSYQQGPCHSPASYAIVEKKCVGKQRCTVTISNSNFGQDPCPNVLKR  776

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  777  LSVEAVCA  784



>ref|XP_011083163.1| PREDICTED: beta-galactosidase 3 [Sesamum indicum]
Length=845

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A D  CS C+Y G F  +KC   CG+ +QRWYH+PRSWL+PT NLLV+FEE 
Sbjct  658  GRYWTAYAAGD--CSGCSYTGIFKPQKCQVGCGQPTQRWYHLPRSWLKPTQNLLVLFEEI  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I L+KR + SVCA + E+ P + NW++++ GK E   +P+VHL CG  G++I++
Sbjct  716  GGDPTRIILVKRSVTSVCADVAEYHPNIKNWQVESYGKMEEFRKPRVHLHCGP-GQSISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG+CHA  S+ +  K C+G   C+V ++   FG DPCPN+ K+
Sbjct  775  IKFASFGTPLGTCGSFQQGTCHAPTSYTVLAKKCIGQQRCSVTISNRNFGRDPCPNISKR  834

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  835  LSVEAICA  842



>ref|XP_012078404.1| PREDICTED: beta-galactosidase 3 [Jatropha curcas]
Length=848

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  658  GRYWTAYATGN--CNGCSYAGSFRPPKCQVGCGQPTQRWYHVPRSWLKPTQNLLVVFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR + SVCA++ E+ P + NW +++ G+AE    PKVH+ C   G++I+A
Sbjct  716  GGNPSRISLVKRAMTSVCAEVAEFHPTIKNWHIESYGRAEEFHSPKVHIRCSL-GQSISA  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CH+  S+ I EK CVG   CTV ++   FG DPCPNV+K+
Sbjct  775  IKFASFGTPLGTCGSYQQGPCHSPASYAIVEKKCVGKQRCTVTISNSNFGQDPCPNVLKR  834

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  835  LSVEAVCA  842



>ref|XP_003548865.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W         C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  656  GRYW--TTFATGNCNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA + E+ P + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  714  GGNPSKISLVKRSVSSVCADVSEYHPNIKNWHIESYGKSEEFHPPKVHLHCSP-GQTISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   CTV V+   FG DPCP V+K+
Sbjct  773  IKFASFGTPLGTCGNYEQGACHSPASYAILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>gb|KHN27041.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W         C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  656  GRYW--TTFATGNCNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA + E+ P + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  714  GGNPSKISLVKRSVSSVCADVSEYHPNIKNWHIESYGKSEEFHPPKVHLHCSP-GQTISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   CTV V+   FG DPCP V+K+
Sbjct  773  IKFASFGTPLGTCGNYEQGACHSPASYAILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W  + + D  C+ C+Y G F   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  656  GRYWTIHASGD--CNGCSYTGTFRPPKCQTGCGQPTQRWYHVPRSWLKPTQNLLVVFEEI  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL+KR + ++CA + EW P + +W++++  + E   RPKVHL C   G++I+A
Sbjct  714  GGDASRISLVKRSVTTICADVSEWHPNIKSWQIESYDRTEEFHRPKVHLHCAP-GQSISA  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQ+G+CHA  S+ I +K C+G   C V ++   FG DPCPNV+K+
Sbjct  773  IKFASFGTPLGTCGSFQRGTCHAPTSYSILDKMCIGQERCAVTISNSNFGADPCPNVLKR  832

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  833  LSVEAVCS  840



>ref|XP_006283101.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
 gb|EOA15999.1| hypothetical protein CARUB_v10004117mg [Capsella rubella]
Length=856

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSSVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I  + CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGECHATTSYAILARKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_003612093.1| Beta-galactosidase [Medicago truncatula]
Length=504

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W         C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+   NLLV+FEE 
Sbjct  315  GRYW--TAIATGSCNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKQNHNLLVVFEEL  372

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL KR ++SVCA + E+ P L NW + + GK+E    PKVHL C + G+ I++
Sbjct  373  GGDPSKISLAKRSVSSVCADVSEYHPNLKNWHIDSYGKSENFRPPKVHLHC-NPGQAISS  431

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG ++QG+CH+  S+DI E+ C+G   C V V+   FG DPCPNV+K+
Sbjct  432  IKFASFGTPLGTCGSYEQGACHSSSSYDILEQKCIGKPRCIVTVSNSNFGRDPCPNVLKR  491

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  492  LSVEAVCA  499



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 131/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    AP+  C+ CNYAG +   KC + C + +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  653  GRYWT-LWAPNGDCNGCNYAGTYRTPKCQTGCSQPTQRWYHVPRSWLQPTENLLVVFEEL  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL K+ ++SVCA + EW P + N  +Q+ G+ E   +PK+HL C   G++I+A
Sbjct  712  GGDATKISLAKKSMSSVCADVSEWHPTIKNRHIQSYGQPEEYHKPKIHLRCAP-GQSISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+FQQG+CH+ +S    EK C+G   C V ++   FGGDPCP VMK 
Sbjct  771  IKFASFGTPLGTCGNFQQGTCHSPNSHSTLEKKCIGLQRCAVTISTNNFGGDPCPEVMKS  830

Query  275  VAVEVVCS  252
            VAVE +CS
Sbjct  831  VAVEAICS  838



>ref|XP_002465807.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
 gb|EER92805.1| hypothetical protein SORBIDRAFT_01g046160 [Sorghum bicolor]
Length=842

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  656  GRYW--TAYADGDCKECSYTGTFRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+KR ++SVCA + E  P + NW++++ G+ E   R KVHL C   G++I+A
Sbjct  714  GGDSSKIALVKRSVSSVCADVSEDHPNIKNWQIESYGEREYH-RAKVHLRCSP-GQSISA  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+FQQG CH+ +S  + EK C+G   C V ++PE+FGGDPCP V K+
Sbjct  772  IKFASFGTPMGTCGNFQQGDCHSANSHTVLEKKCIGLQRCAVAISPESFGGDPCPRVTKR  831

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  832  VAVEAVCS  839



>ref|XP_007046794.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
 gb|EOX90951.1| Beta-galactosidase 3 isoform 1 [Theobroma cacao]
Length=854

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  657  GRYWTAYAHGD--CNGCSYAGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            G +P  IS++KR ++SVCA++ E+ P + NW++++ GKAE   RPKVHL C + G+ I+ 
Sbjct  715  GADPSRISVMKRSVSSVCAEVSEYHPNIKNWQIESYGKAEEFHRPKVHLHC-NPGQAISF  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I EK C+G   C V +    FG DPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGSYQQGPCHAPASYAILEKKCIGKQRCAVTIANSNFGQDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE  C+
Sbjct  834  LSVEAACA  841



>ref|XP_002867020.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43279.1| hypothetical protein ARALYDRAFT_491000 [Arabidopsis lyrata subsp. 
lyrata]
Length=853

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QR+YHVPRSWL+P+ NLLVIFEE 
Sbjct  659  GRYWTAFATGD--CSQCSYTGTYKPNKCQTGCGQPTQRYYHVPRSWLKPSQNLLVIFEEL  716

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  717  GGNPSSVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  775

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  776  IKFASFGTPLGTCGSYQQGECHAATSYAILERKCVGKARCAVTISNTNFGKDPCPNVLKR  835

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  836  LTVEAVCA  843



>ref|XP_004985589.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Setaria italica]
Length=743

 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  557  GRYWTAYANGD--CKGCSYTGTFRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  614

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+KR ++SVCA + E  P +  W++++ G+ E   R KVHL C  G ++I+A
Sbjct  615  GGDSSKIALVKRSVSSVCADVSEDHPNIKKWQIESYGEREYH-RAKVHLKCAPG-QSISA  672

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++PE FGGDPCPNV K+
Sbjct  673  IKFASFGTPMGTCGSFQQGDCHSANSHTVLEKKCIGLQRCVVAISPENFGGDPCPNVTKR  732

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  733  VAVEAVCS  740



>ref|XP_010432182.1| PREDICTED: beta-galactosidase 3-like [Camelina sativa]
Length=856

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CGHCSYTGTYKPNKCQTGCGQPTQRWYHVPRSWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSTISLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++QQG CHA  S  I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGNYQQGECHATTSCAILERKCVGKARCAVTISNSNFGKDPCPNVLKR  838

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  839  LTVEAVCA  846



>ref|XP_007156097.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
 gb|ESW28091.1| hypothetical protein PHAVU_003G258300g [Phaseolus vulgaris]
Length=847

 Score =   209 bits (531),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+PT NLLVIFEE 
Sbjct  655  GRYWTAFATGN--CNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVIFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  713  GGDPSKISLVKRSVSSVCADVSEFHPNIKNWHIESYGKSEEFRPPKVHLHCSP-GQTISS  771

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++ QG+CH+  S+   EK CVG + CT+ V+   FG DPCPNV+K+
Sbjct  772  IKFASFGTPLGTCGNYVQGACHSPASYATLEKRCVGKSRCTITVSNSNFGQDPCPNVLKR  831

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  832  LSVEAVCA  839



>ref|XP_010649088.1| PREDICTED: beta-galactosidase 3 [Vitis vinifera]
 emb|CBI17431.3| unnamed protein product [Vitis vinifera]
Length=845

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C  C+Y+G +   KC   CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYW--TAYANGNCQGCSYSGTYRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R + SVCA +FE+ P + NW +++ GK E   +PKVHL CG  G++I++
Sbjct  715  GGDPSRISLVRRSMTSVCADVFEYHPNIKNWHIESYGKTEELHKPKVHLRCGP-GQSISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+GTP G CG F+QG CHA  S+ I EK C+G   C V ++   F  DPCPNV+K+
Sbjct  774  IKFASYGTPLGTCGSFEQGPCHAPDSYAIVEKRCIGRQRCAVTISNTNFAQDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>emb|CAA18137.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=853

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 131/191 (69%), Gaps = 6/191 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  656  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  714  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCS-PGQAIAS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKY---CVGWNSCTVPVTPEAFGGDPCPNV  285
            IKFASFGTP G CG +QQG CHA  S+ I E+Y   CVG   C V ++   FG DPCPNV
Sbjct  773  IKFASFGTPLGTCGSYQQGECHAATSYAILERYMQKCVGKARCAVTISNSNFGKDPCPNV  832

Query  284  MKKVAVEVVCS  252
            +K++ VE VC+
Sbjct  833  LKRLTVEAVCA  843



>ref|XP_010113483.1| Beta-galactosidase 3 [Morus notabilis]
 gb|EXC35510.1| Beta-galactosidase 3 [Morus notabilis]
Length=847

 Score =   209 bits (531),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 132/187 (71%), Gaps = 4/187 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ CNYAG F   KC   CG+ +QRWYHVPRSWLRPT NLLV+FEE 
Sbjct  656  GRYW--TAFANGNCNECNYAGGFKPTKCQFGCGQPTQRWYHVPRSWLRPTQNLLVLFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL++R +++VCA++ E+ P L NW +++ GK+E    PKVHL C + G+ I++
Sbjct  714  GGDPSRISLVRRSVSTVCAEVTEYHPTLKNWHIESYGKSEEFHSPKVHLRCSN-GQAISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CH+  S+ + EK C+G   C V +    F GDPCPNV+K+
Sbjct  773  IKFASFGTPLGTCGSYQQGTCHSAASYSVIEKKCIGKQRCAVTIANSNF-GDPCPNVLKR  831

Query  275  VAVEVVC  255
            ++VE VC
Sbjct  832  LSVEAVC  838



>gb|EYU24087.1| hypothetical protein MIMGU_mgv1a001258mg [Erythranthe guttata]
Length=851

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ C+Y G F   KC   CG+ +Q+WYH+PRSWL+PT NLLV+FEE 
Sbjct  664  GRYWTAYATGD--CNGCSYVGSFRPPKCQLGCGQPTQKWYHLPRSWLKPTENLLVLFEEL  721

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I ++KR + SVCA M E+ P   NW++++ GK E   +PKVHL CG  G++I++
Sbjct  722  GGDPTRIGVVKRSMTSVCADMAEYHPNFKNWQIESYGKPEEFRKPKVHLHCGP-GQSISS  780

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQ+G+CHA  S+ I EK C+G   C+V ++   FG DPCPNV+K+
Sbjct  781  IKFASFGTPLGTCGSFQKGTCHAPTSYAILEKKCIGKERCSVAISNSNFGHDPCPNVLKR  840

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  841  LSVEAICA  848



>ref|XP_004985588.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Setaria italica]
Length=841

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  655  GRYWTAYANGD--CKGCSYTGTFRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+KR ++SVCA + E  P +  W++++ G+ E   R KVHL C  G ++I+A
Sbjct  713  GGDSSKIALVKRSVSSVCADVSEDHPNIKKWQIESYGEREYH-RAKVHLKCAPG-QSISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++PE FGGDPCPNV K+
Sbjct  771  IKFASFGTPMGTCGSFQQGDCHSANSHTVLEKKCIGLQRCVVAISPENFGGDPCPNVTKR  830

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  831  VAVEAVCS  838



>ref|XP_004512085.1| PREDICTED: beta-galactosidase 3-like [Cicer arietinum]
Length=847

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W  +      C+ C+YAG F   KC   CGE +QRWYHVPRSWL+P  NLLV+FEE 
Sbjct  657  GRYWTASAT--GSCNGCSYAGSFRPPKCQLGCGEPTQRWYHVPRSWLKPNHNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW + + GK+E    PKVHL C + G+ I++
Sbjct  715  GGDPSKISLVKRSVSSVCADVSEYHPNIKNWHIDSYGKSEEFHPPKVHLHC-NPGQAISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   C V V+   FG DPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGNYEQGACHSSASYAILEKKCIGKQRCIVTVSNSNFGQDPCPNVLKR  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>ref|XP_003520277.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=848

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+ T NLLVIFEE 
Sbjct  656  GRYWTAFATGN--CNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA + E+ P + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  714  GGNPSKISLVKRSVSSVCADVSEYHPNIKNWHIESYGKSEEFRPPKVHLHCSP-GQTISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   CTV V+   FG DPCP V+K+
Sbjct  773  IKFASFGTPLGTCGNYEQGACHSPASYVILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>gb|KGN48881.1| hypothetical protein Csa_6G504610 [Cucumis sativus]
Length=750

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = -1

Query  737  KCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKREIASVCAQMFEWQP  558
            KC   CG+ +QRWYHVPR+WL+P  NLLV+FEE GGNP  ISL+KR +  VCA + E+ P
Sbjct  578  KCQQGCGQPTQRWYHVPRAWLKPKDNLLVVFEELGGNPTSISLVKRSVTGVCADVSEYHP  637

Query  557  QLMNWEMQASGKAERALRPKVHLSCGHGGKNITAIKFASFGTPEGICGDFQQGSCHAFHS  378
             L NW +++ GK+E   RPKVHL C   G +IT+IKFASFGTP G CG +QQG+CHA  S
Sbjct  638  TLKNWHIESYGKSEDLHRPKVHLKCS-AGYSITSIKFASFGTPLGTCGSYQQGTCHAPMS  696

Query  377  FDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
            +DI EK C+G   C V ++   FG DPCPNV+K+++VEVVC+
Sbjct  697  YDILEKRCIGKQRCAVTISNTNFGQDPCPNVLKRLSVEVVCA  738



>gb|KHN00504.1| Beta-galactosidase 3 [Glycine soja]
Length=848

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+ T NLLVIFEE 
Sbjct  656  GRYWTAFATGN--CNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKTTQNLLVIFEEL  713

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  ISL+KR ++SVCA + E+ P + NW +++ GK+E    PKVHL C   G+ I++
Sbjct  714  GGNPSKISLVKRSVSSVCADVSEYHPNIKNWHIESYGKSEEFRPPKVHLHCSP-GQTISS  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG+++QG+CH+  S+ I EK C+G   CTV V+   FG DPCP V+K+
Sbjct  773  IKFASFGTPLGTCGNYEQGACHSPASYVILEKRCIGKPRCTVTVSNSNFGQDPCPKVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>ref|NP_849506.1| beta-galactosidase 3 [Arabidopsis thaliana]
 gb|AEE86647.1| beta-galactosidase 3 [Arabidopsis thaliana]
Length=855

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G +   KC + CG+ +QRWYHVPR+WL+P+ NLLVIFEE 
Sbjct  662  GRYWTAFATGD--CSHCSYTGTYKPNKCQTGCGQPTQRWYHVPRAWLKPSQNLLVIFEEL  719

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GGNP  +SL+KR ++ VCA++ E+ P + NW++++ GK +   RPKVHL C   G+ I +
Sbjct  720  GGNPSTVSLVKRSVSGVCAEVSEYHPNIKNWQIESYGKGQTFHRPKVHLKCSP-GQAIAS  778

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG CHA  S+ I E+ CVG   C V ++   FG DPCPNV+K+
Sbjct  779  IKFASFGTPLGTCGSYQQGECHAATSYAILER-CVGKARCAVTISNSNFGKDPCPNVLKR  837

Query  275  VAVEVVCS  252
            + VE VC+
Sbjct  838  LTVEAVCA  845



>ref|XP_006649450.1| PREDICTED: beta-galactosidase 5-like [Oryza brachyantha]
Length=841

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 129/188 (69%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  655  GRYWTAYAEGD--CKECSYTGTFRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L+KR ++ VCA + E+ P + NW++++ G+ E     KVHL C   G+ I+A
Sbjct  713  GGDSSKIALVKRSVSGVCADVSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAP-GQTISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++P +FGGDPCP VMK+
Sbjct  771  IKFASFGTPLGTCGTFQQGECHSSNSHSVLEKKCIGLQRCVVAISPNSFGGDPCPEVMKR  830

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  831  VAVEAVCS  838



>ref|XP_011100972.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=848

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W         C+ C+Y G +   KC   CG+ +QRWYH+PRSWL+PT NLLV+FEE 
Sbjct  661  GRYWTAYAT--GHCNGCSYTGSYRPPKCQLGCGQPTQRWYHLPRSWLKPTQNLLVLFEEL  718

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I+L+KR + SVCA + E+ P + NW++++ G+ E   +PKVHL CG  G++I++
Sbjct  719  GGDPTRITLVKRSMTSVCADVAEYHPNIRNWQIESYGRPEEFHKPKVHLRCGP-GQSISS  777

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG+CHA  S+ I EK C+G   C+V ++   FG DPCP V+K+
Sbjct  778  IKFASFGTPLGTCGSFQQGTCHAPTSYAILEKKCIGQQKCSVTISNSNFGQDPCPKVLKR  837

Query  275  VAVEVVCS  252
            ++VE +C+
Sbjct  838  LSVEAICA  845



>gb|AAG12249.1|AF184080_1 beta-galactosidase [Prunus armeniaca]
Length=376

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  CS C+Y G F   KC   CG+ +QRWYHVPRSWL+PT NL+V+FEE 
Sbjct  180  GRYWMAYANGD--CSLCSYIGTFRPTKCQLGCGQPTQRWYHVPRSWLKPTKNLMVMFEEL  237

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  I+L+KR +A VCA + E  P    +++ +  +++   + +VHL C   G++I++
Sbjct  238  GGDPSKITLVKRSVAGVCADLQEHHPNAEKFDIDSHEESKTLHQAQVHLQC-VPGQSISS  296

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG+CHA +S  I EK C+G  SC V V+   FG DPCPNV+K+
Sbjct  297  IKFASFGTPTGTCGSFQQGTCHATNSHAIVEKNCIGRESCLVTVSNSIFGTDPCPNVLKR  356

Query  275  VAVEVVCS  252
            ++VE VCS
Sbjct  357  LSVEAVCS  364



>ref|XP_008230925.1| PREDICTED: beta-galactosidase-like [Prunus mume]
Length=808

 Score =   206 bits (524),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 125/188 (66%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A    C +C YAG ++E KCL+ CGE SQRWYHVPR WL P+GNLLV FEEW
Sbjct  626  GRHWPAYTA-HGACHYCYYAGTYNENKCLTKCGEPSQRWYHVPRGWLNPSGNLLVAFEEW  684

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  I+L +R  + VCA +FE QP L + +  AS K  +A   K HL C   G+ I+ 
Sbjct  685  GGEPTKIALAQRATSCVCADIFEGQPTLQSSQKLASAKLIKA---KAHLRC-QPGQIISD  740

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG F++GSCHA  S+D   + C+G   CT+PV P  FGGDPCP   KK
Sbjct  741  IKFASYGWPQGTCGSFKEGSCHAHKSYDFPRRICIGKQFCTIPVAPAYFGGDPCPGSAKK  800

Query  275  VAVEVVCS  252
             +VE VCS
Sbjct  801  FSVEAVCS  808



>ref|XP_007217046.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
 gb|EMJ18245.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
Length=835

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 125/188 (66%), Gaps = 5/188 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GRHWP   A    C  C YAG ++E KC + CGE SQRWYHVPR WL P+GNLLV+FEEW
Sbjct  653  GRHWPAYTA-HGACRDCYYAGTYNENKCRTKCGEPSQRWYHVPRGWLNPSGNLLVVFEEW  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG P  I+L +R  +SVCA +FE QP L + +  AS K  +A   K HL C   G+ I+ 
Sbjct  712  GGEPTKIALAQRATSSVCADIFEGQPTLQSSQKLASAKLIKA---KAHLRC-QPGQIISD  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFAS+G P+G CG F++GSCHA  S+D   + C+G   CT+PV P  FGGDPCP   KK
Sbjct  768  IKFASYGWPQGTCGSFKEGSCHAHKSYDFPRRVCIGKQFCTIPVAPAYFGGDPCPGSAKK  827

Query  275  VAVEVVCS  252
             +VE VCS
Sbjct  828  FSVEAVCS  835



>ref|XP_008337843.1| PREDICTED: beta-galactosidase 3 [Malus domestica]
 ref|XP_008363095.1| PREDICTED: beta-galactosidase 3-like [Malus domestica]
Length=853

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG F   KC S CG+ +QR+YHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYW--TAFANGNCNGCSYAGGFRPTKCQSGCGQPTQRYYHVPRSWLKPTQNLLVLFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVC+++ E+ P + NW +++ GK E    PKVHL C + G+ I++
Sbjct  715  GGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHIESYGKVEDFXSPKVHLRC-NPGQAISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQG+CHA  S+ + +K C+G   C V ++   F GDPCPNV+K+
Sbjct  774  IKFASFGTPLGTCGSYQQGTCHATTSYSVLQKKCIGKQRCAVTISNSNF-GDPCPNVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>ref|XP_003558743.1| PREDICTED: beta-galactosidase 5 [Brachypodium distachyon]
Length=839

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -1

Query  776  CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKRE  597
            C  C+YAG +   KC + CG+ +QRWYHVP+SWL+P+ NLLV+FEE GG+   ISL+KR 
Sbjct  664  CKACSYAGSYRAPKCQAGCGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDSSKISLVKRS  723

Query  596  IASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITAIKFASFGTPEGIC  417
            ++SVCA + E+   + NW+++ +G+ E   RPKVHL C   G+ I+AIKFASFGTP G C
Sbjct  724  VSSVCADVSEYHTNIKNWQIENAGEVEFH-RPKVHLRCAP-GQTISAIKFASFGTPLGTC  781

Query  416  GDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
            G+FQQG CH+  S  + EK C+G   C V ++P+ FGGDPCP  MKKVAVE VCS
Sbjct  782  GNFQQGDCHSTKSHAVLEKNCIGQQRCAVTISPDNFGGDPCPKEMKKVAVEAVCS  836



>ref|XP_003612092.1| Beta-galactosidase [Medicago truncatula]
 gb|AES95050.1| beta-galactosidase [Medicago truncatula]
Length=843

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W         C+ CNYAG F   KC   CG+ +QRWYHVPRSWL+   NLLV+FEE 
Sbjct  654  GRYW--TAIATGSCNDCNYAGSFRPPKCQLGCGQPTQRWYHVPRSWLKQNHNLLVVFEEL  711

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL KR ++SVCA + E+ P L NW + + GK+E    PKVHL C + G+ I++
Sbjct  712  GGDPSKISLAKRSVSSVCADVSEYHPNLKNWHIDSYGKSENFRPPKVHLHC-NPGQAISS  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG ++QG+CH+  S+DI E+ C+G   C V V+   FG DPCPNV+K+
Sbjct  771  IKFASFGTPLGTCGSYEQGACHSSSSYDILEQKCIGKPRCIVTVSNSNFGRDPCPNVLKR  830

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  831  LSVEAVCA  838



>gb|ABR16628.1| unknown [Picea sitchensis]
Length=836

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 131/189 (69%), Gaps = 2/189 (1%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+WP   A       C+Y G +   KC +NCG++SQRWYHVPRSWL+P+GN LV+FEE 
Sbjct  649  GRYWPSYLAEGVCSDGCSYEGTYRPHKCDTNCGQSSQRWYHVPRSWLQPSGNTLVLFEEI  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMN-WEMQASGKAERALRPKVHLSCGHGGKNIT  459
            GGNP G+SL+ R + SVCA + E   Q +N W ++++ + ++   PKVHL C   G+ I+
Sbjct  709  GGNPSGVSLVTRSVDSVCAHVSESHSQSINFWRLESTDQVQKLHIPKVHLQCSK-GQRIS  767

Query  458  AIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMK  279
            AIKFASFGTP+G+CG FQQG CH+ +S    +K C+G   C++ V+ + FGGDPCP V K
Sbjct  768  AIKFASFGTPQGLCGSFQQGDCHSPNSVATIQKKCMGLRKCSLSVSEKIFGGDPCPGVRK  827

Query  278  KVAVEVVCS  252
             VA+E VCS
Sbjct  828  GVAIEAVCS  836



>gb|EMT10014.1| Beta-galactosidase 5 [Aegilops tauschii]
Length=851

 Score =   204 bits (518),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 3/176 (2%)
 Frame = -1

Query  776  CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKRE  597
            C   +Y G F   KC + CG+ +QRWYHVP+SWL+P+ NLLV+FEE GG+   ISL+KR 
Sbjct  675  CKDYSYTGSFRATKCQAGCGQPTQRWYHVPKSWLQPSRNLLVVFEELGGDTSKISLVKRS  734

Query  596  IASVCAQMFEWQPQLMNWEMQASGKAERAL-RPKVHLSCGHGGKNITAIKFASFGTPEGI  420
            ++SVCA + E+ P + NW+ ++SG+A+  L R KVHL C   G++I+AIKFASFGTP G 
Sbjct  735  VSSVCADVSEFHPSIKNWQTESSGEAKPELRRSKVHLRCAP-GQSISAIKFASFGTPSGT  793

Query  419  CGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
            CG F+QG CH+  S  + EK C+G   C V ++P+ FGGDPCPNVMK+VAVE VCS
Sbjct  794  CGSFEQGECHSTKSQTVLEK-CIGKQRCAVAISPDNFGGDPCPNVMKRVAVEAVCS  848



>ref|NP_001049068.1| Os03g0165400 [Oryza sativa Japonica Group]
 sp|Q10RB4.1|BGAL5_ORYSJ RecName: Full=Beta-galactosidase 5; Short=Lactase 5; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABF94149.1| Beta-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10982.1| Os03g0165400 [Oryza sativa Japonica Group]
 dbj|BAG95436.1| unnamed protein product [Oryza sativa Japonica Group]
Length=841

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  655  GRYWTAYAEGD--CKGCHYTGSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  712

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L KR ++ VCA + E+ P + NW++++ G+ E     KVHL C  G + I+A
Sbjct  713  GGDSSKIALAKRTVSGVCADVSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAPG-QTISA  770

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++P  FGGDPCP VMK+
Sbjct  771  IKFASFGTPLGTCGTFQQGECHSINSNSVLEKKCIGLQRCVVAISPSNFGGDPCPEVMKR  830

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  831  VAVEAVCS  838



>gb|AAM22973.1|AF499737_1 beta-galactosidase [Oryza sativa Japonica Group]
 gb|AAM34271.1|AF508799_1 beta-galactosidase [Oryza sativa Japonica Group]
Length=843

 Score =   203 bits (517),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  657  GRYWTAYAEGD--CKGCHYTGSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L KR ++ VCA + E+ P + NW++++ G+ E     KVHL C  G + I+A
Sbjct  715  GGDSSKIALAKRTVSGVCADVSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAPG-QTISA  772

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++P  FGGDPCP VMK+
Sbjct  773  IKFASFGTPLGTCGTFQQGECHSINSNSVLEKKCIGLQRCVVAISPSNFGGDPCPEVMKR  832

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  833  VAVEAVCS  840



>gb|EEE58382.1| hypothetical protein OsJ_09539 [Oryza sativa Japonica Group]
Length=851

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  665  GRYWTAYAEGD--CKGCHYTGSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  722

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L KR ++ VCA + E+ P + NW++++ G+ E     KVHL C  G + I+A
Sbjct  723  GGDSSKIALAKRTVSGVCADVSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAPG-QTISA  780

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + EK C+G   C V ++P  FGGDPCP VMK+
Sbjct  781  IKFASFGTPLGTCGTFQQGECHSINSNSVLEKKCIGLQRCVVAISPSNFGGDPCPEVMKR  840

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  841  VAVEAVCS  848



>ref|XP_004287850.1| PREDICTED: beta-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=853

 Score =   203 bits (516),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C+ C+YAG F   KC + CG+ +QR+YHVPRSWL+PT NLLVIFEE 
Sbjct  657  GRYWTAFANGD--CNGCSYAGGFKPTKCQTGCGQPTQRYYHVPRSWLKPTQNLLVIFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  +S++KR +++VCA++ E+ P + NW +++ GK +    PKVHL C + G++I++
Sbjct  715  GGDPSRVSIVKRSVSTVCAEVAEYHPTIKNWHIESYGKVQDFHSPKVHLRC-NPGQSISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +QQGSCHA  S+ + EK C+G   C V ++   F GDPCP V+K+
Sbjct  774  IKFASFGTPFGTCGTYQQGSCHASTSYSVIEKKCIGKQRCAVTISNTNF-GDPCPKVLKR  832

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  833  LSVEAVCA  840



>dbj|BAJ96054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -1

Query  776  CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKRE  597
            C  C+Y G F   KC + CG+ +QRWYHVP+SWL+PT NLLV+FEE GG+   ISL+KR 
Sbjct  671  CKDCSYTGSFRAIKCQAGCGQPTQRWYHVPKSWLQPTRNLLVVFEELGGDTSKISLVKRS  730

Query  596  IASVCAQMFEWQPQLMNWEMQASGKAERAL-RPKVHLSCGHGGKNITAIKFASFGTPEGI  420
            +++VCA + E+ P + NW+ + SG+A+  L R KVHL C   G++I+AIKFASFGTP G 
Sbjct  731  VSNVCADVSEFHPSIKNWQTENSGEAKPELRRSKVHLRCAP-GQSISAIKFASFGTPLGT  789

Query  419  CGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
            CG F+QG CH+  S  + E  C+G   C V ++P+ FGGDPCPNVMK+VAVE VCS
Sbjct  790  CGSFEQGQCHSTKSQTVLEN-CIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCS  844



>emb|CDP01954.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+Y G F   KC   CG+ +QRWYHVPRSWL+PT NL+V+FEE 
Sbjct  657  GRYWTAYATGN--CNECSYTGTFRPPKCQLGCGQPTQRWYHVPRSWLKPTQNLVVLFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW +++ G++E   +PKVHL C   G++I++
Sbjct  715  GGDPTRISLVKRTVSSVCADITEYHPTIKNWHIESYGRSEEFHKPKVHLHCA-PGQSISS  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGT  G CG FQQG+CHA  S+   E+ C+G   C+V ++   FG DPCP V+K+
Sbjct  774  IKFASFGTAMGTCGSFQQGTCHAPTSYTTMERRCLGRQRCSVTISNSNFGQDPCPKVLKR  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>gb|EEC74580.1| hypothetical protein OsI_10152 [Oryza sativa Indica Group]
Length=851

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G +   KC + CG+ +QRWYHVPRSWL+PT NLLV+FEE 
Sbjct  665  GRYWTAYAEGD--CKGCHYTGSYRAPKCQAGCGQPTQRWYHVPRSWLQPTRNLLVVFEEL  722

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   I+L KR ++ VCA + E+ P + NW++++ G+ E     KVHL C   G+ I+A
Sbjct  723  GGDSSKIALAKRTVSGVCADVSEYHPNIKNWQIESYGEPEFH-TAKVHLKCAP-GQTISA  780

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG FQQG CH+ +S  + E+ C+G   C V ++P  FGGDPCP VMK+
Sbjct  781  IKFASFGTPLGTCGTFQQGECHSINSNSVLERKCIGLERCVVAISPSNFGGDPCPEVMKR  840

Query  275  VAVEVVCS  252
            VAVE VCS
Sbjct  841  VAVEAVCS  848



>gb|KHN36067.1| Beta-galactosidase 3 [Glycine soja]
Length=849

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+P  NLLV+FEE 
Sbjct  663  GRYWTALAAGN--CNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPDHNLLVVFEEL  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW + + GK+E    PKVHL C   G+ I++
Sbjct  721  GGDPSKISLVKRSVSSVCADVSEYHPNIRNWHIDSYGKSEEFHPPKVHLHCSP-GQTISS  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++G CH+  S    EK C+G   CTV V+   FG DPCPNV+K+
Sbjct  780  IKFASFGTPLGTCGNYEKGVCHSSTSHATLEKKCIGKPRCTVTVSNSNFGQDPCPNVLKR  839

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  840  LSVEAVCA  847



>ref|XP_003517202.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=849

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W    A +  C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+P  NLLV+FEE 
Sbjct  663  GRYWTALAAGN--CNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPDHNLLVVFEEL  720

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVCA + E+ P + NW + + GK+E    PKVHL C   G+ I++
Sbjct  721  GGDPSKISLVKRSVSSVCADVSEYHPNIRNWHIDSYGKSEEFHPPKVHLHCSP-GQTISS  779

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG++++G CH+  S    EK C+G   CTV V+   FG DPCPNV+K+
Sbjct  780  IKFASFGTPLGTCGNYEKGVCHSSTSHATLEKKCIGKPRCTVTVSNSNFGQDPCPNVLKR  839

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  840  LSVEAVCA  847



>ref|XP_003538867.1| PREDICTED: beta-galactosidase 3-like [Glycine max]
Length=853

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDG-CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEE  639
            GR+W    AP  G C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+P  NLLV+FEE
Sbjct  663  GRYW---TAPAAGICNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEE  719

Query  638  WGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNIT  459
             GG+P  ISL+KR ++S+CA + E+ P + NW + + GK+E    PKVHL C    + I+
Sbjct  720  LGGDPSKISLVKRSVSSICADVSEYHPNIRNWHIDSYGKSEEFHPPKVHLHCSP-SQAIS  778

Query  458  AIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMK  279
            +IKFASFGTP G CG++++G CH+  S+   EK C+G   CTV V+   FG DPCPNV+K
Sbjct  779  SIKFASFGTPLGTCGNYEKGVCHSPTSYATLEKKCIGKPRCTVTVSNSNFGQDPCPNVLK  838

Query  278  KVAVEVVCS  252
            +++VE VCS
Sbjct  839  RLSVEAVCS  847



>gb|KHN41933.1| Beta-galactosidase 3 [Glycine soja]
Length=862

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 131/189 (69%), Gaps = 5/189 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDG-CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEE  639
            GR+W    AP  G C+ C+YAG F   KC   CG+ +QRWYHVPRSWL+P  NLLV+FEE
Sbjct  672  GRYW---TAPAAGICNGCSYAGTFRPPKCQVGCGQPTQRWYHVPRSWLKPNHNLLVVFEE  728

Query  638  WGGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNIT  459
             GG+P  ISL+KR ++S+CA + E+ P + NW + + GK+E    PKVHL C    + I+
Sbjct  729  LGGDPSKISLVKRSVSSICADVSEYHPNIRNWHIDSYGKSEEFHPPKVHLHCS-PSQAIS  787

Query  458  AIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMK  279
            +IKFASFGTP G CG++++G CH+  S+   EK C+G   CTV V+   FG DPCPNV+K
Sbjct  788  SIKFASFGTPLGTCGNYEKGVCHSPTSYATLEKKCIGKPRCTVTVSNSNFGQDPCPNVLK  847

Query  278  KVAVEVVCS  252
            +++VE VCS
Sbjct  848  RLSVEAVCS  856



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG F   KC S CG+ +QR+YHVPRSWL+PT NLLV+FEE 
Sbjct  501  GRYW--TAFANGNCNGCSYAGGFRPTKCQSGCGKPTQRYYHVPRSWLKPTQNLLVLFEEL  558

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVC+++ E+ P + NW +++ GK E    PKVHL C + G+ I++
Sbjct  559  GGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHIESYGKVEDFHSPKVHLRC-NPGQAISS  617

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +Q+G+CHA  S+ + +K C+G   C V ++   F GDPCP V+K+
Sbjct  618  IKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKCIGKQRCAVTISNSNF-GDPCPKVLKR  676

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  677  LSVEAVCA  684



>gb|AHL69742.1| beta-galactosidase [Hylocereus undatus]
Length=835

 Score =   201 bits (510),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 127/188 (68%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W  N A  + C+ CNYAG +  + C S CG  +QRWYHVPRSWL+P  NL+V+FEE 
Sbjct  651  GRYWT-NYAKGN-CNSCNYAGTYRPKNCQSGCGSPTQRWYHVPRSWLKPRQNLMVVFEEL  708

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL+KR ++ VCA  +E  P   NW +  +G  E   + KVHL CG  G++I+ 
Sbjct  709  GGDASKISLVKRSVSRVCADAYEHHPMAENWRVNDAGDTEILHQAKVHLQCGP-GQSISN  767

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I+FASFGTP G CG F QG+CHA  S  + EK CVG   C+V +  + FGGDPCPNV+K+
Sbjct  768  IQFASFGTPSGTCGSFLQGTCHAQESHAVIEKMCVGRERCSVTIANKNFGGDPCPNVLKR  827

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  828  LSVEAICS  835



>dbj|BAK07157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=847

 Score =   201 bits (510),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = -1

Query  776  CSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEWGGNPYGISLLKRE  597
            C  C+Y G F   KC + CG+ +QRWYHVP+ WL+PT NLLV+FEE GG+   ISL+KR 
Sbjct  671  CKDCSYTGSFRAIKCQAGCGQPTQRWYHVPKPWLQPTRNLLVVFEELGGDTSKISLVKRS  730

Query  596  IASVCAQMFEWQPQLMNWEMQASGKAERAL-RPKVHLSCGHGGKNITAIKFASFGTPEGI  420
            +++VCA + E+ P + NW+ + SG+A+  L R KVHL C   G++I+AIKFASFGTP G 
Sbjct  731  VSNVCADVSEFHPSIKNWQTENSGEAKPELRRSKVHLRCAP-GQSISAIKFASFGTPLGT  789

Query  419  CGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKKVAVEVVCS  252
            CG F+QG CH+  S  + E  C+G   C V ++P+ FGGDPCPNVMK+VAVE VCS
Sbjct  790  CGSFEQGQCHSTKSQTVLEN-CIGKQRCAVTISPDNFGGDPCPNVMKRVAVEAVCS  844



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   201 bits (510),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 129/188 (69%), Gaps = 3/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C  C+YAG F   KC  +CG+ +QRWYHVPRSWL+PT NL+V+FEE 
Sbjct  657  GRYWMAYS--NGNCGVCHYAGTFRATKCQRSCGQPTQRWYHVPRSWLQPTQNLIVLFEEL  714

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+   ISL+KR  A VCA  FE +P + N+++Q++  ++   + K+HLSC   G++I+A
Sbjct  715  GGDASKISLVKRTTAGVCANAFEHRPSVANYQIQSTSASKMLHQAKIHLSCSP-GQSISA  773

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            I FASFGTP G CG F+ G+CHA +S  + EK CVG  SC + V+   FG DPCP V+KK
Sbjct  774  ITFASFGTPTGTCGSFRLGNCHAQNSHSVVEKMCVGMESCKLAVSNSYFGADPCPRVLKK  833

Query  275  VAVEVVCS  252
            ++VE +CS
Sbjct  834  LSVEAICS  841



>dbj|BAD91082.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=854

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      +  C+ C+YAG F   KC S CG+ +QR+YHVPRSWL+PT NLLV+FEE 
Sbjct  658  GRYW--TAFANGNCNGCSYAGGFRPTKCQSGCGKPTQRYYHVPRSWLKPTQNLLVLFEEL  715

Query  635  GGNPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNITA  456
            GG+P  ISL+KR ++SVC+++ E+ P + NW +++ GK E    PKVHL C + G+ I++
Sbjct  716  GGDPSRISLVKRAVSSVCSEVAEYHPTIKNWHIESYGKVEDFHSPKVHLRC-NPGQAISS  774

Query  455  IKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMKK  276
            IKFASFGTP G CG +Q+G+CHA  S+ + +K C+G   C V ++   F GDPCP V+K+
Sbjct  775  IKFASFGTPLGTCGSYQEGTCHATTSYSVVQKKCIGKQRCAVTISNSNF-GDPCPKVLKR  833

Query  275  VAVEVVCS  252
            ++VE VC+
Sbjct  834  LSVEAVCA  841



>ref|NP_001168664.1| uncharacterized protein LOC100382452 [Zea mays]
 gb|ACN29095.1| unknown [Zea mays]
Length=815

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 129/189 (68%), Gaps = 5/189 (3%)
 Frame = -1

Query  815  GRHWPGNKAPDDGCSFCNYAGWFDERKCLSNCGEASQRWYHVPRSWLRPTGNLLVIFEEW  636
            GR+W      D  C  C+Y G F   KC + CG+ +QRWYHVPRSWL+P+ NLLV+ EE 
Sbjct  628  GRYW--TAYADGDCKGCSYTGTFRAPKCQAGCGQPTQRWYHVPRSWLQPSRNLLVVLEEL  685

Query  635  GG-NPYGISLLKREIASVCAQMFEWQPQLMNWEMQASGKAERALRPKVHLSCGHGGKNIT  459
            GG +   I+L KR ++SVCA + E  P +  W++++ G+ E   R KVHL C HG ++I+
Sbjct  686  GGGDSSKIALAKRSVSSVCADVSEDHPNIKKWQIESYGEREHR-RAKVHLRCAHG-QSIS  743

Query  458  AIKFASFGTPEGICGDFQQGSCHAFHSFDIFEKYCVGWNSCTVPVTPEAFGGDPCPNVMK  279
            AI+FASFGTP G CG+FQQG CH+  S  + EK C+G   C V ++P+ FGGDPCP+V K
Sbjct  744  AIRFASFGTPVGTCGNFQQGGCHSASSHAVLEKRCIGLQRCVVAISPDNFGGDPCPSVTK  803

Query  278  KVAVEVVCS  252
            +VAVE VCS
Sbjct  804  RVAVEAVCS  812



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1922415464620