BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6972

Length=773
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762903.1|  PREDICTED: protein S-acyltransferase 24            201   3e-56   Nicotiana sylvestris
ref|XP_009621389.1|  PREDICTED: protein S-acyltransferase 24            199   2e-55   Nicotiana tomentosiformis
ref|XP_011084071.1|  PREDICTED: protein S-acyltransferase 24-like       195   6e-54   Sesamum indicum [beniseed]
ref|XP_006359506.1|  PREDICTED: protein S-acyltransferase 24-like       194   2e-53   Solanum tuberosum [potatoes]
emb|CAN67938.1|  hypothetical protein VITISV_014238                     186   4e-53   Vitis vinifera
emb|CDP10489.1|  unnamed protein product                                192   8e-53   Coffea canephora [robusta coffee]
gb|KDO73420.1|  hypothetical protein CISIN_1g006702mg                   183   2e-50   Citrus sinensis [apfelsine]
ref|XP_010323275.1|  PREDICTED: protein S-acyltransferase 24 isof...    184   3e-50   
ref|XP_002262878.1|  PREDICTED: protein S-acyltransferase 24            184   4e-50   Vitis vinifera
ref|XP_004242727.1|  PREDICTED: protein S-acyltransferase 24 isof...    184   6e-50   Solanum lycopersicum
ref|XP_008343921.1|  PREDICTED: protein S-acyltransferase 24-like       184   6e-50   
ref|XP_008362882.1|  PREDICTED: protein S-acyltransferase 24-like       184   6e-50   
ref|XP_006381078.1|  hypothetical protein POPTR_0006s06050g             183   7e-50   
ref|XP_011020239.1|  PREDICTED: protein S-acyltransferase 24-like       183   9e-50   Populus euphratica
gb|KDO73419.1|  hypothetical protein CISIN_1g006702mg                   183   1e-49   Citrus sinensis [apfelsine]
ref|XP_006453127.1|  hypothetical protein CICLE_v10007734mg             183   1e-49   Citrus clementina [clementine]
ref|XP_008384910.1|  PREDICTED: protein S-acyltransferase 24            182   2e-49   
ref|XP_002532314.1|  zinc finger protein, putative                      176   3e-49   
gb|EYU38308.1|  hypothetical protein MIMGU_mgv1a002757mg                182   3e-49   Erythranthe guttata [common monkey flower]
ref|XP_009363933.1|  PREDICTED: protein S-acyltransferase 24-like       179   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_004287249.1|  PREDICTED: protein S-acyltransferase 24            179   5e-48   Fragaria vesca subsp. vesca
ref|XP_007013621.1|  Ankyrin repeat family protein with DHHC zinc...    178   1e-47   
ref|XP_006389402.1|  hypothetical protein POPTR_0025s00390g             177   2e-47   
ref|XP_010928284.1|  PREDICTED: protein S-acyltransferase 24-like...    176   2e-47   
ref|XP_010928283.1|  PREDICTED: protein S-acyltransferase 24-like...    176   2e-47   
ref|XP_009358538.1|  PREDICTED: protein S-acyltransferase 24-like       176   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_009338389.1|  PREDICTED: protein S-acyltransferase 24-like       176   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_008361110.1|  PREDICTED: protein S-acyltransferase 24-like       176   3e-47   
ref|XP_010112497.1|  S-acyltransferase TIP1                             176   4e-47   
ref|XP_010928281.1|  PREDICTED: protein S-acyltransferase 24-like...    176   5e-47   
ref|XP_011017904.1|  PREDICTED: protein S-acyltransferase 24-like       175   9e-47   Populus euphratica
gb|KCW83017.1|  hypothetical protein EUGRSUZ_C043982                    175   2e-46   Eucalyptus grandis [rose gum]
gb|KCW83018.1|  hypothetical protein EUGRSUZ_C043982                    174   2e-46   Eucalyptus grandis [rose gum]
gb|KEH32152.1|  palmitoyltransferase TIP1                               172   2e-46   Medicago truncatula
ref|XP_010050124.1|  PREDICTED: protein S-acyltransferase 24-like       174   3e-46   Eucalyptus grandis [rose gum]
gb|KCW83019.1|  hypothetical protein EUGRSUZ_C043982                    174   3e-46   Eucalyptus grandis [rose gum]
gb|KCW83016.1|  hypothetical protein EUGRSUZ_C043982                    174   3e-46   Eucalyptus grandis [rose gum]
ref|XP_010913354.1|  PREDICTED: protein S-acyltransferase 24-like       173   5e-46   Elaeis guineensis
ref|XP_010687832.1|  PREDICTED: protein S-acyltransferase 24            172   9e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003609480.1|  S-acyltransferase TIP1                             172   1e-45   Medicago truncatula
ref|XP_008788793.1|  PREDICTED: protein S-acyltransferase 24-like       171   2e-45   Phoenix dactylifera
ref|XP_012081141.1|  PREDICTED: protein S-acyltransferase 24            169   1e-44   Jatropha curcas
ref|XP_004508416.1|  PREDICTED: S-acyltransferase TIP1-like             166   2e-43   Cicer arietinum [garbanzo]
ref|XP_010454339.1|  PREDICTED: protein S-acyltransferase 24            164   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010244896.1|  PREDICTED: protein S-acyltransferase 24-like       163   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010535848.1|  PREDICTED: protein S-acyltransferase 24            163   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_007204229.1|  hypothetical protein PRUPE_ppa002724mg             162   2e-42   Prunus persica
ref|XP_010493140.1|  PREDICTED: protein S-acyltransferase 24-like       162   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008795826.1|  PREDICTED: protein S-acyltransferase 24 isof...    162   3e-42   Phoenix dactylifera
gb|KHN47119.1|  S-acyltransferase TIP1                                  162   3e-42   Glycine soja [wild soybean]
ref|XP_008242880.1|  PREDICTED: protein S-acyltransferase 24            162   3e-42   Prunus mume [ume]
ref|XP_009126441.1|  PREDICTED: protein S-acyltransferase 24            162   4e-42   Brassica rapa
ref|NP_197535.2|  S-acyltransferase TIP1                                162   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250284.1|  PREDICTED: protein S-acyltransferase 24-like       161   8e-42   Nelumbo nucifera [Indian lotus]
gb|KJB23676.1|  hypothetical protein B456_004G109200                    160   1e-41   Gossypium raimondii
gb|KJB23675.1|  hypothetical protein B456_004G109200                    160   1e-41   Gossypium raimondii
emb|CDY45091.1|  BnaA02g04850D                                          160   1e-41   Brassica napus [oilseed rape]
ref|XP_008457291.1|  PREDICTED: protein S-acyltransferase 24            160   2e-41   Cucumis melo [Oriental melon]
gb|KFK33845.1|  hypothetical protein AALP_AA5G067400                    160   2e-41   Arabis alpina [alpine rockcress]
ref|XP_003549717.1|  PREDICTED: protein S-acyltransferase 24-like       160   2e-41   Glycine max [soybeans]
gb|KHN15025.1|  S-acyltransferase TIP1                                  160   2e-41   Glycine soja [wild soybean]
ref|XP_010420875.1|  PREDICTED: protein S-acyltransferase 24-like       159   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004139278.1|  PREDICTED: protein S-acyltransferase 24            159   4e-41   Cucumis sativus [cucumbers]
gb|KHG18334.1|  Palmitoyltransferase akr1                               158   7e-41   Gossypium arboreum [tree cotton]
ref|XP_011078543.1|  PREDICTED: LOW QUALITY PROTEIN: protein S-ac...    158   9e-41   
ref|XP_010520556.1|  PREDICTED: protein S-acyltransferase 24-like...    158   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_010520557.1|  PREDICTED: protein S-acyltransferase 24-like...    158   1e-40   Tarenaya hassleriana [spider flower]
ref|XP_003563307.1|  PREDICTED: protein S-acyltransferase 24            156   5e-40   Brachypodium distachyon [annual false brome]
gb|KFK26273.1|  hypothetical protein AALP_AA8G225500                    155   1e-39   Arabis alpina [alpine rockcress]
ref|XP_002437346.1|  hypothetical protein SORBIDRAFT_10g025310          155   1e-39   Sorghum bicolor [broomcorn]
ref|XP_009392141.1|  PREDICTED: protein S-acyltransferase 24-like       155   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155091.1|  hypothetical protein PHAVU_003G172300g             155   1e-39   Phaseolus vulgaris [French bean]
ref|XP_006400604.1|  hypothetical protein EUTSA_v10012979mg             154   2e-39   Eutrema salsugineum [saltwater cress]
emb|CDX70923.1|  BnaC03g10070D                                          153   4e-39   
ref|XP_004965751.1|  PREDICTED: S-acyltransferase TIP1-like             153   4e-39   Setaria italica
emb|CDY68411.1|  BnaAnng27190D                                          150   5e-39   Brassica napus [oilseed rape]
emb|CDY51852.1|  BnaA03g56190D                                          152   7e-39   Brassica napus [oilseed rape]
emb|CDX92467.1|  BnaA10g15060D                                          152   8e-39   
ref|NP_001046105.1|  Os02g0184000                                       152   9e-39   
ref|XP_009120814.1|  PREDICTED: protein S-acyltransferase 24-like       152   1e-38   Brassica rapa
gb|EEC72626.1|  hypothetical protein OsI_06124                          152   1e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_008659786.1|  PREDICTED: protein S-acyltransferase 24-like       152   1e-38   Zea mays [maize]
ref|XP_008795828.1|  PREDICTED: protein S-acyltransferase 24 isof...    152   1e-38   Phoenix dactylifera
gb|EEE56453.1|  hypothetical protein OsJ_05649                          152   2e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KJB64639.1|  hypothetical protein B456_010G059000                    150   2e-38   Gossypium raimondii
ref|XP_008649039.1|  PREDICTED: protein S-acyltransferase 24            151   2e-38   Zea mays [maize]
ref|XP_006657184.1|  PREDICTED: protein S-acyltransferase 24-like       150   3e-38   
gb|KJB64635.1|  hypothetical protein B456_010G059000                    150   5e-38   Gossypium raimondii
gb|KJB64638.1|  hypothetical protein B456_010G059000                    150   5e-38   Gossypium raimondii
gb|EMT15309.1|  S-acyltransferase TIP1                                  148   8e-38   
ref|XP_006287281.1|  hypothetical protein CARUB_v10000476mg             149   8e-38   Capsella rubella
gb|KHG04996.1|  Palmitoyltransferase AKR1                               148   3e-37   Gossypium arboreum [tree cotton]
ref|XP_009398663.1|  PREDICTED: protein S-acyltransferase 24-like...    148   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006648383.1|  PREDICTED: protein S-acyltransferase 24-like       147   3e-37   
emb|CDY56864.1|  BnaC09g54140D                                          147   5e-37   Brassica napus [oilseed rape]
gb|EMS53285.1|  S-acyltransferase TIP1                                  147   7e-37   Triticum urartu
gb|KHG15624.1|  Palmitoyltransferase akr1                               145   2e-36   Gossypium arboreum [tree cotton]
dbj|BAJ88769.1|  predicted protein                                      142   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAE53911.1|  hypothetical protein KIAA0946                          141   3e-36   Triticum aestivum [Canadian hard winter wheat]
gb|EMT32654.1|  S-acyltransferase TIP1                                  140   1e-34   
ref|XP_002453418.1|  hypothetical protein SORBIDRAFT_04g005696          140   2e-34   
gb|KJB53968.1|  hypothetical protein B456_009G014100                    140   2e-34   Gossypium raimondii
ref|XP_008645330.1|  PREDICTED: protein S-acyltransferase 24-like...    140   3e-34   
ref|XP_008645331.1|  PREDICTED: protein S-acyltransferase 24-like...    140   3e-34   
gb|EEC81067.1|  hypothetical protein OsI_23878                          140   4e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001058187.1|  Os06g0644500                                       139   5e-34   
gb|AFW70468.1|  hypothetical protein ZEAMMB73_665644                    137   6e-34   
ref|XP_004951654.1|  PREDICTED: S-acyltransferase TIP1-like isofo...    138   9e-34   Setaria italica
gb|EMS65580.1|  S-acyltransferase TIP1                                  138   2e-33   Triticum urartu
gb|KJB83231.1|  hypothetical protein B456_013G236500                    136   4e-33   Gossypium raimondii
ref|XP_003570824.1|  PREDICTED: protein S-acyltransferase 24-like       136   6e-33   Brachypodium distachyon [annual false brome]
gb|KHF98454.1|  akr1                                                    132   8e-32   Gossypium arboreum [tree cotton]
gb|ERN14295.1|  hypothetical protein AMTR_s00033p00182370               131   5e-31   Amborella trichopoda
ref|XP_011626400.1|  PREDICTED: protein S-acyltransferase 24            130   5e-31   Amborella trichopoda
ref|XP_010050291.1|  PREDICTED: protein S-acyltransferase 24-like       123   9e-31   Eucalyptus grandis [rose gum]
ref|XP_010050341.1|  PREDICTED: protein S-acyltransferase 24            125   4e-29   
gb|KCW79060.1|  hypothetical protein EUGRSUZ_C00485                     124   4e-29   Eucalyptus grandis [rose gum]
ref|XP_010042866.1|  PREDICTED: probable protein S-acyltransferas...    112   4e-27   Eucalyptus grandis [rose gum]
gb|AFK40586.1|  unknown                                                 111   2e-26   Lotus japonicus
ref|XP_010939302.1|  PREDICTED: probable protein S-acyltransferas...    114   2e-25   Elaeis guineensis
ref|XP_001764782.1|  predicted protein                                  109   5e-25   
ref|XP_002969220.1|  hypothetical protein SELMODRAFT_35692              109   6e-25   
ref|XP_008790390.1|  PREDICTED: probable protein S-acyltransferas...    112   2e-24   Phoenix dactylifera
ref|XP_001771908.1|  predicted protein                                  110   2e-24   
ref|XP_010029900.1|  PREDICTED: probable protein S-acyltransferas...    111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_002518303.1|  Palmitoyltransferase TIP1, putative                111   3e-24   Ricinus communis
ref|XP_002960582.1|  hypothetical protein SELMODRAFT_140081             110   3e-24   
ref|XP_010268638.1|  PREDICTED: probable protein S-acyltransferas...    110   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010268637.1|  PREDICTED: probable protein S-acyltransferas...    110   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008237079.1|  PREDICTED: probable protein S-acyltransferas...    110   4e-24   Prunus mume [ume]
ref|XP_008237078.1|  PREDICTED: probable protein S-acyltransferas...    110   5e-24   Prunus mume [ume]
ref|XP_009394300.1|  PREDICTED: probable protein S-acyltransferas...    110   6e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199780.1|  hypothetical protein PRUPE_ppa003909mg             110   7e-24   Prunus persica
ref|XP_007041468.1|  Palmitoyltransferase TIP1, putative isoform 1      109   1e-23   
gb|ADN34259.1|  palmitoyltransferase TIP1                               107   1e-23   Cucumis melo subsp. melo
emb|CDO97340.1|  unnamed protein product                                108   2e-23   Coffea canephora [robusta coffee]
ref|XP_011658843.1|  PREDICTED: probable protein S-acyltransferas...    107   2e-23   Cucumis sativus [cucumbers]
ref|XP_009769043.1|  PREDICTED: probable protein S-acyltransferas...    108   3e-23   Nicotiana sylvestris
ref|XP_010936252.1|  PREDICTED: probable protein S-acyltransferas...    108   4e-23   Elaeis guineensis
ref|XP_008455110.1|  PREDICTED: probable protein S-acyltransferas...    108   4e-23   Cucumis melo [Oriental melon]
ref|XP_010936253.1|  PREDICTED: probable protein S-acyltransferas...    108   4e-23   Elaeis guineensis
ref|XP_004136905.1|  PREDICTED: probable protein S-acyltransferas...    107   5e-23   Cucumis sativus [cucumbers]
gb|EPS74107.1|  hypothetical protein M569_00641                         106   1e-22   Genlisea aurea
ref|XP_010691489.1|  PREDICTED: probable protein S-acyltransferas...    105   1e-22   
ref|XP_009609761.1|  PREDICTED: probable protein S-acyltransferas...    106   1e-22   Nicotiana tomentosiformis
ref|XP_006361977.1|  PREDICTED: probable protein S-acyltransferas...    106   1e-22   Solanum tuberosum [potatoes]
ref|XP_010092531.1|  putative S-acyltransferase                         106   2e-22   Morus notabilis
ref|XP_006852720.1|  PREDICTED: probable protein S-acyltransferas...    106   2e-22   Amborella trichopoda
ref|XP_004230654.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-22   Solanum lycopersicum
ref|XP_009366346.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-22   
ref|XP_009379579.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_010691487.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010691488.1|  PREDICTED: probable protein S-acyltransferas...    105   2e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH44378.1|  DHHC-type zinc finger protein                           105   5e-22   Medicago truncatula
ref|XP_003529272.1|  PREDICTED: probable protein S-acyltransferas...    104   7e-22   Glycine max [soybeans]
ref|XP_006583781.1|  PREDICTED: probable protein S-acyltransferas...    104   8e-22   Glycine max [soybeans]
tpg|DAA42114.1|  TPA: hypothetical protein ZEAMMB73_763279            99.0    1e-21   
ref|XP_003531002.1|  PREDICTED: probable protein S-acyltransferas...    103   1e-21   Glycine max [soybeans]
gb|KHN46224.1|  Putative S-acyltransferase                              103   1e-21   Glycine soja [wild soybean]
gb|KJB16072.1|  hypothetical protein B456_002G211400                    101   6e-21   Gossypium raimondii
ref|XP_012074546.1|  PREDICTED: probable protein S-acyltransferas...    101   8e-21   
gb|ACS32303.1|  palmitoyl transferase                                   101   8e-21   Jatropha curcas
ref|XP_012074545.1|  PREDICTED: probable protein S-acyltransferas...    101   8e-21   
ref|XP_010527025.1|  PREDICTED: probable protein S-acyltransferas...    100   9e-21   Tarenaya hassleriana [spider flower]
ref|XP_007159187.1|  hypothetical protein PHAVU_002G216500g             101   9e-21   Phaseolus vulgaris [French bean]
ref|XP_010527024.1|  PREDICTED: probable protein S-acyltransferas...    101   1e-20   Tarenaya hassleriana [spider flower]
ref|NP_001068072.1|  Os11g0549700                                     99.8    2e-20   
ref|XP_008668352.1|  PREDICTED: hypothetical protein isoform X1         100   3e-20   Zea mays [maize]
ref|XP_006663520.1|  PREDICTED: probable protein S-acyltransferas...  99.4    3e-20   
ref|XP_002270505.1|  PREDICTED: probable protein S-acyltransferas...  99.8    3e-20   Vitis vinifera
gb|EAY81271.1|  hypothetical protein OsI_36450                        99.8    3e-20   Oryza sativa Indica Group [Indian rice]
gb|ABA94183.1|  ankryin repeat S-palmitoyl transferase, putative,...  99.8    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422675.1|  hypothetical protein CICLE_v10028145mg           99.0    5e-20   Citrus clementina [clementine]
gb|KDO67953.1|  hypothetical protein CISIN_1g009183mg                 99.0    5e-20   Citrus sinensis [apfelsine]
gb|EYU18368.1|  hypothetical protein MIMGU_mgv1a004168mg              99.0    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_007041469.1|  Palmitoyltransferase TIP1, putative isoform 2    98.6    7e-20   
gb|KHG18337.1|  Palmitoyltransferase AKR1                             98.2    1e-19   Gossypium arboreum [tree cotton]
ref|XP_002449668.1|  hypothetical protein SORBIDRAFT_05g021380        97.8    1e-19   
ref|XP_004504881.1|  PREDICTED: probable S-acyltransferase At2g14...  97.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_007041462.1|  Palmitoyltransferase TIP1, putative              97.1    2e-19   
gb|KEH44377.1|  translation initiation factor IF-3                    97.8    3e-19   Medicago truncatula
ref|XP_011088009.1|  PREDICTED: probable protein S-acyltransferas...  96.7    4e-19   Sesamum indicum [beniseed]
ref|XP_011030252.1|  PREDICTED: probable protein S-acyltransferas...  96.3    4e-19   Populus euphratica
ref|XP_002300301.2|  hypothetical protein POPTR_0001s29380g           96.3    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009112234.1|  PREDICTED: probable protein S-acyltransferas...  96.3    5e-19   Brassica rapa
gb|EMS48259.1|  hypothetical protein TRIUR3_25112                     93.2    7e-19   Triticum urartu
ref|XP_010547926.1|  PREDICTED: probable protein S-acyltransferas...  95.5    9e-19   
ref|XP_010237656.1|  PREDICTED: probable protein S-acyltransferas...  95.5    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_010517465.1|  PREDICTED: probable protein S-acyltransferas...  95.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010517459.1|  PREDICTED: probable protein S-acyltransferas...  95.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004979451.1|  PREDICTED: probable S-acyltransferase At2g14...  95.1    1e-18   Setaria italica
gb|KFK39958.1|  hypothetical protein AALP_AA3G311600                  94.4    2e-18   Arabis alpina [alpine rockcress]
ref|XP_006409659.1|  hypothetical protein EUTSA_v10022988mg           93.6    4e-18   Eutrema salsugineum [saltwater cress]
emb|CDY37217.1|  BnaA09g08380D                                        91.7    4e-18   Brassica napus [oilseed rape]
emb|CDX81456.1|  BnaC09g08670D                                        93.2    5e-18   
ref|XP_002883831.1|  predicted protein                                90.9    5e-18   
gb|ABO31375.1|  TIP1-like protein                                     87.8    5e-18   Gossypium hirsutum [American cotton]
ref|XP_010467225.1|  PREDICTED: probable protein S-acyltransferas...  92.4    8e-18   Camelina sativa [gold-of-pleasure]
gb|EPS69086.1|  palmitoyl transferase                                 85.9    9e-18   Genlisea aurea
ref|XP_004290297.1|  PREDICTED: probable protein S-acyltransferas...  92.0    1e-17   Fragaria vesca subsp. vesca
ref|XP_010488876.1|  PREDICTED: probable protein S-acyltransferas...  91.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|NP_973453.2|  Ankyrin repeat family protein with DHHC zinc fi...  91.7    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488875.1|  PREDICTED: probable protein S-acyltransferas...  91.7    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDY67866.1|  BnaA09g52690D                                        91.7    2e-17   Brassica napus [oilseed rape]
ref|XP_008391971.1|  PREDICTED: probable protein S-acyltransferas...  91.3    2e-17   Malus domestica [apple tree]
gb|KCW79059.1|  hypothetical protein EUGRSUZ_C00485                   90.9    3e-17   Eucalyptus grandis [rose gum]
ref|XP_007041467.1|  Palmitoyltransferase TIP1, putative              87.0    1e-16   
ref|XP_003608335.1|  Palmitoyltransferase                             86.3    2e-16   
ref|XP_009368343.1|  PREDICTED: probable protein S-acyltransferas...  88.2    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_009368345.1|  PREDICTED: probable protein S-acyltransferas...  87.8    3e-16   Pyrus x bretschneideri [bai li]
emb|CAN71650.1|  hypothetical protein VITISV_003283                   86.3    6e-16   Vitis vinifera
gb|AES90531.2|  palmitoyltransferase TIP1                             86.3    9e-16   Medicago truncatula
gb|AES90530.2|  palmitoyltransferase TIP1                             86.7    9e-16   Medicago truncatula
ref|XP_003608333.1|  Palmitoyltransferase                             86.3    1e-15   
ref|XP_005651193.1|  ankyrin                                          74.3    9e-12   Coccomyxa subellipsoidea C-169
gb|KIY98503.1|  S-acyltransferase TIP1                                72.0    3e-11   Monoraphidium neglectum
ref|XP_001419599.1|  predicted protein                                64.7    1e-08   Ostreococcus lucimarinus CCE9901
ref|XP_002507459.1|  palmitoyltransferase                             63.2    5e-08   Micromonas commoda
ref|XP_007510567.1|  predicted protein                                62.4    9e-08   Bathycoccus prasinos
ref|XP_001698472.1|  predicted protein                                61.6    1e-07   Chlamydomonas reinhardtii
gb|KDD72068.1|  hypothetical protein H632_c3917p0                     59.7    3e-07   Helicosporidium sp. ATCC 50920
ref|XP_011398384.1|  Protein S-acyltransferase 24                     59.3    8e-07   Auxenochlorella protothecoides
ref|XP_003081298.1|  ankyrin repeat-containing protein-like (ISS)     56.2    1e-05   
emb|CEF99127.1|  Ankyrin repeat                                       55.8    1e-05   Ostreococcus tauri
ref|XP_003055353.1|  palmitoyltransferase                             55.8    1e-05   Micromonas pusilla CCMP1545
emb|CCA27763.1|  palmitoyltransferase putative                        53.5    8e-05   Albugo laibachii Nc14
ref|XP_008872198.1|  hypothetical protein, variant                    51.2    5e-04   Aphanomyces invadans
ref|XP_008872199.1|  hypothetical protein H310_08286                  51.2    5e-04   Aphanomyces invadans
emb|CBY31307.1|  unnamed protein product                              50.4    9e-04   Oikopleura dioica



>ref|XP_009762903.1| PREDICTED: protein S-acyltransferase 24 [Nicotiana sylvestris]
Length=631

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWLNHAGT HIGA+ FL ADFFLF GV VLT  QASQIS NITTNEMAN +RY+YL
Sbjct  452  SSFGAWLNHAGTHHIGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYL  511

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYN+D+E  EES E EGIGM+Q+  SS+LQNG  H
Sbjct  512  RGPGGRFRNPYDHGCKKNCSDFLINGYNDDVEYIEESVESEGIGMMQIPRSSSLQNGGSH  571

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S Q NGN H VI       + + +  H    +  ++ K+KT+SVP+GLG GLGRNA RTA
Sbjct  572  SNQINGNGHHVI---NMNNNQNSHQGHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARTA  628

Query  236  VVS  228
            + S
Sbjct  629  ISS  631



>ref|XP_009621389.1| PREDICTED: protein S-acyltransferase 24 [Nicotiana tomentosiformis]
Length=631

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWLNHAGT HIGA+ FL ADFFLF GV VLT  QASQIS NITTNEMAN +RY+YL
Sbjct  452  SSFGAWLNHAGTHHIGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYL  511

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNED+E  +ES E EGIGM+Q+  SS+LQN A H
Sbjct  512  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDVEYVQESIESEGIGMMQIPRSSSLQNIASH  571

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S Q NGN H VI       + + +  H    +  ++ K+KT+SVP+GLG GLGRNA RTA
Sbjct  572  SNQINGNGHHVI---NMNNNQNSHQGHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARTA  628

Query  236  VVS  228
            + S
Sbjct  629  LSS  631



>ref|XP_011084071.1| PREDICTED: protein S-acyltransferase 24-like [Sesamum indicum]
Length=634

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAW++HAG QH+GA+ FL+ADFFL SGV VLT  QASQI+RNITTNE+AN LRY+YL
Sbjct  454  STFGAWISHAGNQHVGALSFLVADFFLLSGVGVLTCVQASQIARNITTNEIANVLRYSYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG  GRFRNPYDHGCKKNCSDFLINGYNEDIEC EES E EGIGM+ M  +S L NG  H
Sbjct  514  RGPSGRFRNPYDHGCKKNCSDFLINGYNEDIECIEESTESEGIGMMHMTRNSNLPNGVSH  573

Query  416  SQQ-TNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
            + Q TNGN H+VI+VNKN+ S H +   S   + H+ S+    +VPLGLG GLGRN  R 
Sbjct  574  AHQTTNGNGHLVIDVNKNSNSHHGHVHSSHCSHSHSQSQG---TVPLGLGIGLGRNVARP  630

Query  239  AVVS  228
            A VS
Sbjct  631  AAVS  634



>ref|XP_006359506.1| PREDICTED: protein S-acyltransferase 24-like [Solanum tuberosum]
Length=631

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 140/183 (77%), Gaps = 3/183 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG WL+HAGT HIGA+ FL ADFFLF GV VLT  QASQIS NITTNEMAN +RY+YL
Sbjct  451  SSFGGWLSHAGTHHIGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYL  510

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNED+E  EES E EGIGM+Q+  SS++QNG  H
Sbjct  511  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDVEFIEESVESEGIGMMQIPHSSSMQNGTGH  570

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S   NGN H V  +N +  + + +  H    +  ++ K+KT+SVP+GLG GLGRNA RTA
Sbjct  571  SHPINGNGHHV--INISNNNQNSHQAHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARTA  628

Query  236  VVS  228
            + S
Sbjct  629  LPS  631



>emb|CAN67938.1| hypothetical protein VITISV_014238 [Vitis vinifera]
Length=341

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+AG  HIGAI FL+ DFFLF GV  LTV QASQISRNITTNEMANA+RY+YL
Sbjct  163  SSFGAWMNYAGRHHIGAISFLIVDFFLFFGVAALTVVQASQISRNITTNEMANAMRYSYL  222

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYD G +KNCSDFLINGYNED E  EE    +GIGM+QMA +S LQNG   
Sbjct  223  RGPGGRFRNPYDRGLRKNCSDFLINGYNEDEEHIEEPAHSDGIGMMQMARNSNLQNGDAL  282

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S  TNGN HV I    N  +S  +H H    +  +S+  KTESVPLGLG GLGRN  R+ 
Sbjct  283  SHHTNGNGHVAI----NVKNSRSHHGHVHSSHCSHSNHGKTESVPLGLGIGLGRNNTRSV  338

Query  236  VVS  228
            V S
Sbjct  339  VAS  341



>emb|CDP10489.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 143/189 (76%), Gaps = 9/189 (5%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG WL+HA  +H+GAI F+++D FLFSGV +LT  QASQISRNITTNE+AN +RY+YL
Sbjct  457  SSFGGWLSHAANEHVGAIAFIVSDIFLFSGVAILTAVQASQISRNITTNEVANIMRYSYL  516

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCK+NCSDFLI GYNEDIE  EESGE EG+ M+Q+  +S LQNGACH
Sbjct  517  RGPGGRFRNPYDHGCKRNCSDFLITGYNEDIERDEESGESEGLRMVQIGRASNLQNGACH  576

Query  416  SQQTNGND-----HVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGL-GR  255
            S QTNGN      HVV+  N N +S+ H     S    H+ +  KT+SVP+GLG GL GR
Sbjct  577  SHQTNGNTEGNGGHVVV--NVNKSSNTHQSHVHSSYCTHHKNNQKTDSVPVGLGIGLGGR  634

Query  254  NAGRTAVVS  228
            N+GR+ + S
Sbjct  635  NSGRSVIAS  643



>gb|KDO73420.1| hypothetical protein CISIN_1g006702mg [Citrus sinensis]
Length=472

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+++A T HIGA+ FL+ADF LF GV VLT  QASQISRNITTNEMANALRYNYL
Sbjct  290  SSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYL  349

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RGAGGRFRNPYDHGCK+NCSDFLING+NED+EC E+S   EGIGM+ M+ +S LQNG  H
Sbjct  350  RGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGH  409

Query  416  SQQTNGNDHVVI  381
                NGN HV I
Sbjct  410  IHHANGNGHVAI  421



>ref|XP_010323275.1| PREDICTED: protein S-acyltransferase 24 isoform X2 [Solanum lycopersicum]
Length=556

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWL+HAGT H+GA+ FL ADFFLF GV VLT  QASQIS NITTNEMAN +RY+YL
Sbjct  376  SSFGAWLSHAGTHHVGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYL  435

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNEDIEC EES E EGIGM+Q+  SS++QNG  H
Sbjct  436  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDIECVEESVESEGIGMMQIPHSSSMQNGTGH  495

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S Q NGN H V  +N +  + + +  H    +  ++ K+KT+SVP+GLG GLGRNA R A
Sbjct  496  SHQINGNGHHV--INISNNNQNSHQAHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARAA  553

Query  236  VVS  228
            + S
Sbjct  554  LPS  556



>ref|XP_002262878.1| PREDICTED: protein S-acyltransferase 24 [Vitis vinifera]
 emb|CBI25565.3| unnamed protein product [Vitis vinifera]
Length=635

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+AG  HIGAI FL+ DFFLF GV  LTV QASQISRNITTNEMANA+RY+YL
Sbjct  457  SSFGAWMNYAGRHHIGAISFLIVDFFLFFGVAALTVVQASQISRNITTNEMANAMRYSYL  516

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYD G +KNCSDFLINGYNED E  EE    +GIGM+QMA +S LQNG   
Sbjct  517  RGPGGRFRNPYDRGLRKNCSDFLINGYNEDEEHIEEPAHSDGIGMMQMARNSNLQNGDAL  576

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S  TNGN HV I    N  +S  +H H    +  +S+  KTESVPLGLG GLGRN  R+ 
Sbjct  577  SHHTNGNGHVAI----NVKNSRSHHGHVHSSHCSHSNHGKTESVPLGLGIGLGRNNTRSV  632

Query  236  VVS  228
            V S
Sbjct  633  VAS  635



>ref|XP_004242727.1| PREDICTED: protein S-acyltransferase 24 isoform X1 [Solanum lycopersicum]
Length=631

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWL+HAGT H+GA+ FL ADFFLF GV VLT  QASQIS NITTNEMAN +RY+YL
Sbjct  451  SSFGAWLSHAGTHHVGALAFLFADFFLFVGVAVLTGVQASQISHNITTNEMANMMRYSYL  510

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNEDIEC EES E EGIGM+Q+  SS++QNG  H
Sbjct  511  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDIECVEESVESEGIGMMQIPHSSSMQNGTGH  570

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S Q NGN H V  +N +  + + +  H    +  ++ K+KT+SVP+GLG GLGRNA R A
Sbjct  571  SHQINGNGHHV--INISNNNQNSHQAHVHSAHCSHNVKSKTDSVPVGLGVGLGRNAARAA  628

Query  236  VVS  228
            + S
Sbjct  629  LPS  631



>ref|XP_008343921.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N   T+H+GA+ F + DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINFVATRHVGALSFFIMDFFLFFGVVVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG ++NCSDFLI GYNED+E  EE   + EGIGM  + SS LQ G  +
Sbjct  514  RGPGGRFRNPFDHGIRRNCSDFLIKGYNEDVEHIEEPAHDEEGIGMRDINSSNLQKGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S +TNGN HV I+VN N+T  H +   +   + +N  K+KTE++P+GLG GLGRN+ R+ 
Sbjct  574  SHRTNGNSHVAIDVNSNSTPHHGHVHSAHCSHSNNHGKSKTENIPVGLGLGLGRNSARSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_008362882.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N   T+H+GA+ F + DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINFVATRHVGALSFFIMDFFLFFGVVVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG ++NCSDFLI GYNED+E  EE   + EGIGM  + SS LQ G  +
Sbjct  514  RGPGGRFRNPFDHGIRRNCSDFLIKGYNEDVEHIEEPAHDEEGIGMRDINSSNLQKGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S +TNGN HV I+VN N+T  H +   +   + +N  K+KTE++P+GLG GLGRN+ R+ 
Sbjct  574  SHRTNGNSHVAIDVNSNSTPHHGHVHSAHCSHSNNHGKSKTENIPVGLGLGLGRNSARSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_006381078.1| hypothetical protein POPTR_0006s06050g [Populus trichocarpa]
 gb|ERP58875.1| hypothetical protein POPTR_0006s06050g [Populus trichocarpa]
Length=611

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS GAW+NHAG+ HIGAI FL+ DFFLF GV VLTV QASQISRNITTNEMANALRY+YL
Sbjct  429  SSLGAWVNHAGSHHIGAISFLIMDFFLFFGVAVLTVVQASQISRNITTNEMANALRYSYL  488

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNED++ +E+S   EGIGM+ M+ +S LQNG  H
Sbjct  489  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDVDYNEDSPHSEGIGMMHMSRNSNLQNGDAH  548

Query  416  SQQTNGNDHVVI  381
            S   NGN HV I
Sbjct  549  SHHMNGNGHVAI  560



>ref|XP_011020239.1| PREDICTED: protein S-acyltransferase 24-like [Populus euphratica]
Length=638

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS GAW+NHAG+ HIGAI FL+ DFFLF GV VLTV QASQISRNITTNEMANALRY+YL
Sbjct  456  SSLGAWVNHAGSHHIGAISFLIMDFFLFFGVAVLTVVQASQISRNITTNEMANALRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGCKKNCSDFLINGYNED++ +E+S   EGIGM+ M+ +S LQNG  H
Sbjct  516  RGPGGRFRNPYDHGCKKNCSDFLINGYNEDVDYNEDSPHSEGIGMMHMSRNSNLQNGDAH  575

Query  416  SQQTNGNDHVVI  381
            S   NGN HV I
Sbjct  576  SHHMNGNGHVAI  587



>gb|KDO73419.1| hypothetical protein CISIN_1g006702mg [Citrus sinensis]
Length=634

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+++A T HIGA+ FL+ADF LF GV VLT  QASQISRNITTNEMANALRYNYL
Sbjct  452  SSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYL  511

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RGAGGRFRNPYDHGCK+NCSDFLING+NED+EC E+S   EGIGM+ M+ +S LQNG  H
Sbjct  512  RGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGH  571

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
                NGN HV INVN N T+SHH H+HSSHCNH N  K+KT+SVPLGLG GLGR++ R+ 
Sbjct  572  IHHANGNGHVAINVNSNNTNSHHGHLHSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSV  631

Query  236  VVS  228
            V S
Sbjct  632  VAS  634



>ref|XP_006453127.1| hypothetical protein CICLE_v10007734mg [Citrus clementina]
 ref|XP_006474378.1| PREDICTED: protein S-acyltransferase 24-like [Citrus sinensis]
 gb|ESR66367.1| hypothetical protein CICLE_v10007734mg [Citrus clementina]
Length=634

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+++A T HIGA+ FL+ADF LF GV VLT  QASQISRNITTNEMANALRYNYL
Sbjct  452  SSFGAWMSYASTHHIGALSFLIADFSLFFGVAVLTAVQASQISRNITTNEMANALRYNYL  511

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RGAGGRFRNPYDHGCK+NCSDFLING+NED+EC E+S   EGIGM+ M+ +S LQNG  H
Sbjct  512  RGAGGRFRNPYDHGCKRNCSDFLINGFNEDVECVEDSAGTEGIGMMHMSRNSNLQNGDGH  571

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
                NGN HV INVN N T+SHH H+HSSHCNH N  K+KT+SVPLGLG GLGR++ R+ 
Sbjct  572  IHHANGNGHVAINVNSNNTNSHHGHLHSSHCNHSNHGKSKTDSVPLGLGLGLGRSSARSV  631

Query  236  VVS  228
            V S
Sbjct  632  VAS  634



>ref|XP_008384910.1| PREDICTED: protein S-acyltransferase 24 [Malus domestica]
Length=636

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N   T+H+GA+ F + DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINFVATRHVGALSFFIMDFFLFFGVVVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG + NCSDFLI GYNED+E  EE   + EGIGM  + SS LQ G  +
Sbjct  514  RGPGGRFRNPFDHGIRXNCSDFLIKGYNEDVEHIEEPAHDEEGIGMRDINSSNLQKGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S +TNGN HV I+VN N+T  H +   +   + +N  K+KTE++P+GLG GLGRN+ R+ 
Sbjct  574  SHRTNGNSHVAIDVNSNSTPHHGHVHSAHCSHSNNHGKSKTENIPVGLGLGLGRNSARSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_002532314.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF30066.1| zinc finger protein, putative [Ricinus communis]
Length=302

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAW+NHAGT H+GAI FL+ DF +F GV VLTV QASQIS NITTNEMANA+RY+YL
Sbjct  117  STFGAWINHAGTHHVGAISFLIVDFLMFFGVAVLTVVQASQISHNITTNEMANAMRYSYL  176

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLINGYNEDIE  E+S   EGIG++ M  + + QNG  H
Sbjct  177  RGPGGRFRNPYDHGLRKNCSDFLINGYNEDIEYVEDSAHSEGIGLMHMTRNPSSQNGDAH  236

Query  416  SQQTNGNDHVVI  381
            S   NGN HV I
Sbjct  237  SHHMNGNGHVAI  248



>gb|EYU38308.1| hypothetical protein MIMGU_mgv1a002757mg [Erythranthe guttata]
Length=641

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 144/192 (75%), Gaps = 14/192 (7%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAWL+HAG QH+GA+ F++ DFFL SGV VLT  Q SQI+RNITTNEMAN +RY+YL
Sbjct  454  STFGAWLSHAGNQHVGAVSFIITDFFLLSGVGVLTCVQVSQIARNITTNEMANIMRYSYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA---SSALQNGA  423
            RG  GRFRNPYDHGCKKNCSDFLINGYNED+E +EES E EGIGM+QM    ++ L NG 
Sbjct  514  RGPNGRFRNPYDHGCKKNCSDFLINGYNEDVEYTEESTEPEGIGMMQMTRNNNAELPNG-  572

Query  422  CHSQQTNGND---HVVInvnknttsshhnh----vhsshcnhhnssknkTESVPLGLGSG  264
                QTNG+D   H VI+VN N  SS+ +     VHSSHC+H +S  N   +VPLGLG G
Sbjct  573  ---HQTNGHDNNHHHVIDVNNNKNSSNSHQGGGHVHSSHCSHSHSQSNSNSNVPLGLGVG  629

Query  263  LGRNAGRTAVVS  228
            LGRN  R AVVS
Sbjct  630  LGRNVSRPAVVS  641



>ref|XP_009363933.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N   T+H+GA+ F + DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINFVATRHVGALSFFIMDFFLFFGVAVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GG FRNP+DHG +KNCSDFL+ GYNED+E  EE   + EGIGM  + SS LQ G  +
Sbjct  514  RGPGGGFRNPFDHGIRKNCSDFLVKGYNEDVEHIEEPAHDEEGIGMRDINSSNLQKGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S + NGN HV I+VN N+T  H +   +   + +N  K+KTE+VP+GLG GLGRN+ R+ 
Sbjct  574  SHRRNGNSHVAIDVNSNSTPHHGHVHSAHCSHSNNHGKSKTENVPVGLGLGLGRNSARSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_004287249.1| PREDICTED: protein S-acyltransferase 24 [Fragaria vesca subsp. 
vesca]
Length=634

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 131/179 (73%), Gaps = 1/179 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWLNH GT H GAI FL+ DFFLF GV VLTV QASQI+RNITTNEMANA+RYNYL
Sbjct  455  SSFGAWLNHVGTNHFGAISFLIVDFFLFFGVAVLTVVQASQIARNITTNEMANAMRYNYL  514

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            RG GG FRNPYDHG KKNCSDFLI GYNED+E  EES   EG GM  M +SALQNG  HS
Sbjct  515  RGPGGHFRNPYDHGTKKNCSDFLIKGYNEDVELIEESARDEGTGMRHMTNSALQNGDSHS  574

Query  413  QQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
              TNGN HV INVN N ++   +   +   + ++      ++VPLGLG GLGRNA R A
Sbjct  575  HHTNGNGHVAINVNSNASAHQGHVHSAHCSHGNHGKPKT-DNVPLGLGLGLGRNASRPA  632



>ref|XP_007013621.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
1 [Theobroma cacao]
 gb|EOY31240.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
1 [Theobroma cacao]
Length=640

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+NHAGT HIGAI FL+ DFFLF GV VLTV QASQISRNITTNEMAN +RY+YL
Sbjct  459  SSFLPWMNHAGTHHIGAISFLIVDFFLFFGVAVLTVVQASQISRNITTNEMANVMRYSYL  518

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHGC+KNCSDFLINGYNED+  +E+S   EGIGM+QM+  S LQNG  H
Sbjct  519  RGPGGRFRNPYDHGCQKNCSDFLINGYNEDLRATEDSVHSEGIGMVQMSRDSNLQNGDMH  578

Query  416  SQQTNGNDHVVI  381
            + Q NGN H+ I
Sbjct  579  T-QANGNGHIAI  589



>ref|XP_006389402.1| hypothetical protein POPTR_0025s00390g [Populus trichocarpa]
 gb|ERP48316.1| hypothetical protein POPTR_0025s00390g [Populus trichocarpa]
Length=638

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS GAW+NHA + HIGAI FL+ DFFLF GV VLT+ QASQISRNITTNEMAN LRY+YL
Sbjct  456  SSLGAWINHAVSHHIGAISFLIMDFFLFFGVAVLTIVQASQISRNITTNEMANVLRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNP+DHGCKKNCSDFLINGYNED+E  E+S   EGIGM+ M+ +S LQNG  H
Sbjct  516  RGPGGRFRNPFDHGCKKNCSDFLINGYNEDVEYFEDSPHSEGIGMMHMSRNSNLQNGDAH  575

Query  416  SQQTNGNDHVVI  381
            S   NGN HV I
Sbjct  576  SHHMNGNGHVSI  587



>ref|XP_010928284.1| PREDICTED: protein S-acyltransferase 24-like isoform X3 [Elaeis 
guineensis]
Length=508

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GAI FLL +FFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  327  TSFGAWLSHSATHHPGAISFLLMEFFLFFGVAVLTVVQASQISRNITTNEMANAMRYSYL  386

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG  GRFRNPYDHG +KNCSDFLINGYNED+EC E++   E +GMIQM  S  LQNG  H
Sbjct  387  RGPAGRFRNPYDHGIRKNCSDFLINGYNEDVECPEQASPSEELGMIQMTRSTNLQNGEGH  446

Query  416  SQQTNGNDHVVI  381
            SQ  N N HV I
Sbjct  447  SQHGNSNGHVCI  458



>ref|XP_010928283.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Elaeis 
guineensis]
Length=540

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GAI FLL +FFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  359  TSFGAWLSHSATHHPGAISFLLMEFFLFFGVAVLTVVQASQISRNITTNEMANAMRYSYL  418

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG  GRFRNPYDHG +KNCSDFLINGYNED+EC E++   E +GMIQM  S  LQNG  H
Sbjct  419  RGPAGRFRNPYDHGIRKNCSDFLINGYNEDVECPEQASPSEELGMIQMTRSTNLQNGEGH  478

Query  416  SQQTNGNDHVVI  381
            SQ  N N HV I
Sbjct  479  SQHGNSNGHVCI  490



>ref|XP_009358538.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+  T H+GA+ FL+ DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINYVATSHVGALSFLIVDFFLFFGVAVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E  EES  + EGIGM  + SS LQNG  +
Sbjct  514  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEFIEESAHDEEGIGMRHINSSNLQNGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
              +TNGN HV INVN N+T  H +   +   + ++  K KTE+VPLGLG GLGRN+GR+ 
Sbjct  574  PHRTNGNSHVAINVNSNSTGHHGHVHSAHCSHSNSQGKPKTENVPLGLGLGLGRNSGRSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_009338389.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+  T H+GA+ FL+ DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINYVATSHVGALSFLIVDFFLFFGVAVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E  EES  + EGIGM  + SS LQNG  +
Sbjct  514  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEFIEESAHDEEGIGMRHINSSNLQNGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
              +TNGN HV INVN N+T  H +   +   + ++  K KTE+VPLGLG GLGRN+GR+ 
Sbjct  574  PHRTNGNSHVAINVNSNSTGHHGHVHSAHCSHSNSQGKPKTENVPLGLGLGLGRNSGRSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_008361110.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 138/183 (75%), Gaps = 1/183 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+  T H+GA+ FL+ DF LF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  454  SSFGAWINYVATSHVGALSFLIVDFLLFFGVAVLTVVQASQISRNITTNEMANMMRYNYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG-EVEGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E  EES  + EGIGM  + SS LQNG  +
Sbjct  514  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEFIEESAHDEEGIGMRHINSSNLQNGDAY  573

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
              +TNGN HV INVN N+T  H +   +   + ++  K KTE+VPLGLG GLGRN+GR+ 
Sbjct  574  PHRTNGNSHVAINVNSNSTGHHGHVHSAHCSHSNSQGKPKTENVPLGLGLGLGRNSGRSV  633

Query  236  VVS  228
            V S
Sbjct  634  VAS  636



>ref|XP_010112497.1| S-acyltransferase TIP1 [Morus notabilis]
 gb|EXC33817.1| S-acyltransferase TIP1 [Morus notabilis]
Length=619

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+AGT H+GA+ FL ADFFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  436  SSFGAWINYAGTNHVGALAFLFADFFLFFGVAVLTVVQASQISRNITTNEMANAMRYSYL  495

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG GGRFRNPYDHG KKNCSDFLINGYNED+E  E+  + EGIGM+ +  +  LQNG  H
Sbjct  496  RGPGGRFRNPYDHGIKKNCSDFLINGYNEDVEYIEQPADAEGIGMMHIPKNPNLQNGDSH  555

Query  416  SQQTNGNDHVVI  381
            S   NG  HV I
Sbjct  556  SHHANGCRHVAI  567



>ref|XP_010928281.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Elaeis 
guineensis]
Length=626

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GAI FLL +FFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  445  TSFGAWLSHSATHHPGAISFLLMEFFLFFGVAVLTVVQASQISRNITTNEMANAMRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG  GRFRNPYDHG +KNCSDFLINGYNED+EC E++   E +GMIQM  S  LQNG  H
Sbjct  505  RGPAGRFRNPYDHGIRKNCSDFLINGYNEDVECPEQASPSEELGMIQMTRSTNLQNGEGH  564

Query  416  SQQTNGNDHVVI  381
            SQ  N N HV I
Sbjct  565  SQHGNSNGHVCI  576



>ref|XP_011017904.1| PREDICTED: protein S-acyltransferase 24-like [Populus euphratica]
Length=638

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+ GAW+NHA + HIGAI FL+ DFFLF GV VLTV QASQISRNITTNEMANALRY+YL
Sbjct  456  STLGAWINHAVSHHIGAISFLIMDFFLFFGVAVLTVVQASQISRNITTNEMANALRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNP+DHGCKKNCSDFLINGYNED+E  E+S   E IGM+ M+ +S LQNG  H
Sbjct  516  RGPGGRFRNPFDHGCKKNCSDFLINGYNEDVEYFEDSPHSEEIGMMHMSRNSNLQNGDAH  575

Query  416  SQQTNGNDHVVI  381
            S   NGN HV I
Sbjct  576  SHNMNGNGHVSI  587



>gb|KCW83017.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=727

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+WL+H GTQHIGA+ F LADF LF GV VLT  QASQIS NITTNEMANA+RY+YL
Sbjct  544  SSFGSWLSHVGTQHIGALSFFLADFSLFFGVAVLTAVQASQISHNITTNEMANAMRYSYL  603

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GGRFRNPYDHG KKNCSDFLINGYNED+E  E+S   EGIGM+ M  +S LQNG  H
Sbjct  604  KGPGGRFRNPYDHGFKKNCSDFLINGYNEDVEYVEDSSHAEGIGMMHMGRTSNLQNGDVH  663

Query  416  SQQTNGNDHVVI  381
            S Q   N H+ I
Sbjct  664  SHQPAENGHIAI  675



>gb|KCW83018.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=700

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+WL+H GTQHIGA+ F LADF LF GV VLT  QASQIS NITTNEMANA+RY+YL
Sbjct  517  SSFGSWLSHVGTQHIGALSFFLADFSLFFGVAVLTAVQASQISHNITTNEMANAMRYSYL  576

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GGRFRNPYDHG KKNCSDFLINGYNED+E  E+S   EGIGM+ M  +S LQNG  H
Sbjct  577  KGPGGRFRNPYDHGFKKNCSDFLINGYNEDVEYVEDSSHAEGIGMMHMGRTSNLQNGDVH  636

Query  416  SQQTNGNDHVVI  381
            S Q   N H+ I
Sbjct  637  SHQPAENGHIAI  648



>gb|KEH32152.1| palmitoyltransferase TIP1 [Medicago truncatula]
Length=469

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 141/186 (76%), Gaps = 12/186 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+AG  HIGAI FL+ADFFLF GV  LT  QASQISRNITTNEMANALRY+YL
Sbjct  278  SSFGAWINYAGKNHIGAISFLIADFFLFFGVFALTAVQASQISRNITTNEMANALRYSYL  337

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMAS-SALQNGAC  420
            RG GGRFRNPYDHG KKNCSDFLINGYNED+E  EESG   EG+GM+ MA  S + NG  
Sbjct  338  RGPGGRFRNPYDHGIKKNCSDFLINGYNEDLEYVEESGNSEEGLGMMHMARGSTITNGDS  397

Query  419  HSQQT----NGNDHVVInvnknttsshhn------hvhsshcnhhnssknkTESVPLGLG  270
            HS       NGN HVVINV+ N+T+S  +      HVHSSHC+H N  K + +S+P+GLG
Sbjct  398  HSHSDHANGNGNGHVVINVDSNSTNSKTHHGHSNGHVHSSHCSHSNQGKTRNDSIPVGLG  457

Query  269  SGLGRN  252
             GLGRN
Sbjct  458  LGLGRN  463



>ref|XP_010050124.1| PREDICTED: protein S-acyltransferase 24-like [Eucalyptus grandis]
Length=639

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+WL+H GTQHIGA+ F LADF LF GV VLT  QASQIS NITTNEMANA+RY+YL
Sbjct  456  SSFGSWLSHVGTQHIGALSFFLADFSLFFGVAVLTAVQASQISHNITTNEMANAMRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GGRFRNPYDHG KKNCSDFLINGYNED+E  E+S   EGIGM+ M  +S LQNG  H
Sbjct  516  KGPGGRFRNPYDHGFKKNCSDFLINGYNEDVEYVEDSSHAEGIGMMHMGRTSNLQNGDVH  575

Query  416  SQQTNGNDHVVI  381
            S Q   N H+ I
Sbjct  576  SHQPAENGHIAI  587



>gb|KCW83019.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=694

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+WL+H GTQHIGA+ F LADF LF GV VLT  QASQIS NITTNEMANA+RY+YL
Sbjct  511  SSFGSWLSHVGTQHIGALSFFLADFSLFFGVAVLTAVQASQISHNITTNEMANAMRYSYL  570

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GGRFRNPYDHG KKNCSDFLINGYNED+E  E+S   EGIGM+ M  +S LQNG  H
Sbjct  571  KGPGGRFRNPYDHGFKKNCSDFLINGYNEDVEYVEDSSHAEGIGMMHMGRTSNLQNGDVH  630

Query  416  SQQTNGNDHVVI  381
            S Q   N H+ I
Sbjct  631  SHQPAENGHIAI  642



>gb|KCW83016.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=674

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+WL+H GTQHIGA+ F LADF LF GV VLT  QASQIS NITTNEMANA+RY+YL
Sbjct  517  SSFGSWLSHVGTQHIGALSFFLADFSLFFGVAVLTAVQASQISHNITTNEMANAMRYSYL  576

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GGRFRNPYDHG KKNCSDFLINGYNED+E  E+S   EGIGM+ M  +S LQNG  H
Sbjct  577  KGPGGRFRNPYDHGFKKNCSDFLINGYNEDVEYVEDSSHAEGIGMMHMGRTSNLQNGDVH  636

Query  416  SQQTNGNDHVVI  381
            S Q   N H+ I
Sbjct  637  SHQPAENGHIAI  648



>ref|XP_010913354.1| PREDICTED: protein S-acyltransferase 24-like [Elaeis guineensis]
Length=620

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GA++FL+ DFFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  445  TSFGAWLSHSATYHPGAVLFLIMDFFLFFGVAVLTVVQASQISRNITTNEMANAVRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG GGRFRNPYDHG +KNCSDFL+NGYNED+EC E++     +GMIQM     +QNG  H
Sbjct  505  RGPGGRFRNPYDHGIRKNCSDFLLNGYNEDVECPEQTTPSAEMGMIQMTRRTNIQNGGTH  564

Query  416  SQQTNGNDHVVI  381
            SQ+ NGN HV I
Sbjct  565  SQRGNGNGHVCI  576



>ref|XP_010687832.1| PREDICTED: protein S-acyltransferase 24 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   172 bits (437),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWL+HAGT H+GAI FLLADFFLF GV VLTV QASQISRNITTNEMAN +RY+YL
Sbjct  462  SSFGAWLSHAGTHHVGAISFLLADFFLFFGVAVLTVVQASQISRNITTNEMANVMRYSYL  521

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG  GRFRNP+DHG ++NC+DFL NGYNED+E +E+S   E IGM+QM  +  +QNG  H
Sbjct  522  RGPSGRFRNPFDHGTRRNCTDFLFNGYNEDVERAEDSAHDEEIGMVQMGCNPNMQNGLVH  581

Query  416  SQQTNGNDHVVI  381
              +TNGN H+ +
Sbjct  582  PHKTNGNGHIAV  593



>ref|XP_003609480.1| S-acyltransferase TIP1 [Medicago truncatula]
 gb|AES91677.1| palmitoyltransferase TIP1 [Medicago truncatula]
Length=642

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 141/186 (76%), Gaps = 12/186 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+N+AG  HIGAI FL+ADFFLF GV  LT  QASQISRNITTNEMANALRY+YL
Sbjct  451  SSFGAWINYAGKNHIGAISFLIADFFLFFGVFALTAVQASQISRNITTNEMANALRYSYL  510

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMAS-SALQNGAC  420
            RG GGRFRNPYDHG KKNCSDFLINGYNED+E  EESG   EG+GM+ MA  S + NG  
Sbjct  511  RGPGGRFRNPYDHGIKKNCSDFLINGYNEDLEYVEESGNSEEGLGMMHMARGSTITNGDS  570

Query  419  HSQQT----NGNDHVVInvnknttsshhn------hvhsshcnhhnssknkTESVPLGLG  270
            HS       NGN HVVINV+ N+T+S  +      HVHSSHC+H N  K + +S+P+GLG
Sbjct  571  HSHSDHANGNGNGHVVINVDSNSTNSKTHHGHSNGHVHSSHCSHSNQGKTRNDSIPVGLG  630

Query  269  SGLGRN  252
             GLGRN
Sbjct  631  LGLGRN  636



>ref|XP_008788793.1| PREDICTED: protein S-acyltransferase 24-like [Phoenix dactylifera]
Length=626

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG+WL+H+ T H GAI FL+ DFFL  GV VLT  QASQISRNITTNEMANALRY+YL
Sbjct  445  TSFGSWLSHSATYHPGAISFLMMDFFLIFGVAVLTAVQASQISRNITTNEMANALRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLINGYNED+EC E++   E +GMI M  S  LQNG  H
Sbjct  505  RGPGGRFRNPYDHGIRKNCSDFLINGYNEDVECPEQASPSEEMGMIPMTRSTNLQNGDGH  564

Query  416  SQQTNGNDHVVI  381
            SQ  N N HV I
Sbjct  565  SQHGNSNGHVCI  576



>ref|XP_012081141.1| PREDICTED: protein S-acyltransferase 24 [Jatropha curcas]
 gb|KDP30210.1| hypothetical protein JCGZ_16992 [Jatropha curcas]
Length=636

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FG+W+NHA  QH GA+ FL+ DFFLF GV VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  455  STFGSWINHAVVQHTGAVSFLIVDFFLFFGVAVLTVVQASQISRNITTNEMANAMRYSYL  514

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQ-MASSALQNGACH  417
            RG  GRFRNPYDHG +KNCSDFLINGYNED+E  E+S   EGI M+  M +S+ QNG  H
Sbjct  515  RGPSGRFRNPYDHGVRKNCSDFLINGYNEDVEYIEDSPHSEGIAMMHVMRNSSTQNGDVH  574

Query  416  SQQTNGNDHVVI  381
            S   NGN H+ I
Sbjct  575  SPHINGNGHIAI  586



>ref|XP_004508416.1| PREDICTED: S-acyltransferase TIP1-like [Cicer arietinum]
Length=640

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 142/186 (76%), Gaps = 12/186 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW N+ G  HIGAI FL+ADFFLF GV  LTV QASQISRNITTNE+AN +RY+YL
Sbjct  447  SSFGAWFNYVGKNHIGAISFLIADFFLFFGVFALTVVQASQISRNITTNEVANIMRYSYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA-SSALQNGAC  420
            RG GGRFRNPYDHG KKNCSDFLINGYNED++  EE G+  EG+GM+ ++ SS ++NG  
Sbjct  507  RGPGGRFRNPYDHGIKKNCSDFLINGYNEDLQYVEELGQSDEGVGMMHISRSSNVRNGDS  566

Query  419  HSQ----QTNGNDHVVInvnknttsshhn------hvhsshcnhhnssknkTESVPLGLG  270
            HSQ    + NGN HVVINVN N+T+   +      HVHSSHC+H N  K + +S+P+GLG
Sbjct  567  HSQSEYAKGNGNGHVVINVNSNSTNPKTHHGHINGHVHSSHCSHSNQGKTRNDSIPVGLG  626

Query  269  SGLGRN  252
             GLGRN
Sbjct  627  LGLGRN  632



>ref|XP_010454339.1| PREDICTED: protein S-acyltransferase 24 [Camelina sativa]
Length=620

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 121/182 (66%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  T H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVATNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE      EGI M+QM  +       
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDATQRQEGINMMQMQRN-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
              +  NGN HV INVN    S   +   S+  + HNS     + VPLGLG GL RN  R 
Sbjct  559  -PELQNGNGHVAINVNPVHNSQSTHGHSSNCSHSHNSKSKS-DKVPLGLGLGLARNPTRP  616

Query  239  AV  234
             V
Sbjct  617  VV  618



>ref|XP_010244896.1| PREDICTED: protein S-acyltransferase 24-like [Nelumbo nucifera]
Length=629

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+++  TQHIGA+ FL+ DFFLF GV VLT+ QASQISRNITTNEMANA+RY YL
Sbjct  453  SSFGAWMSYVSTQHIGAMSFLIVDFFLFFGVAVLTIVQASQISRNITTNEMANAMRYGYL  512

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMAS-SALQNGACH  417
            RG  G FRNPYD G KKNCSDFLINGYNED+E  EES   E  GMIQM   S LQ G  H
Sbjct  513  RGPSGHFRNPYDRGVKKNCSDFLINGYNEDVEFVEESNHSEETGMIQMTRCSNLQEGGNH  572

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAG  246
            S   N N HV  + + +  ++  N+   +   H+++S  K    PLGLG GLGRN+ 
Sbjct  573  SHHVNTNGHV--STDVDPKNTRPNNGRINSSQHNHNSHGKGNGFPLGLGIGLGRNSA  627



>ref|XP_010535848.1| PREDICTED: protein S-acyltransferase 24 [Tarenaya hassleriana]
Length=634

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAWL H  T H+GA+ FL+ +  LF  V +LTV QASQISRNITTNEMANA+RY+YL
Sbjct  447  SAFGAWLGHVATNHVGAMSFLIVECCLFFSVAILTVIQASQISRNITTNEMANAMRYSYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSA-LQNG-  426
            RG GGRFRNPYDHGC++NCSDFLI GYNEDIEC EE  S   EGIGMIQM  +   Q+G 
Sbjct  507  RGPGGRFRNPYDHGCRRNCSDFLIKGYNEDIECREETSSPREEGIGMIQMQHNPNFQDGT  566

Query  425  ACHSQQTNGNDHVVI  381
            + +S   NG+ HV I
Sbjct  567  SVNSGNANGSSHVAI  581



>ref|XP_007204229.1| hypothetical protein PRUPE_ppa002724mg [Prunus persica]
 gb|EMJ05428.1| hypothetical protein PRUPE_ppa002724mg [Prunus persica]
Length=639

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAW+N+  T H+GA+ F + DFFLF GV VLTV QASQISRNITTNEMAN +RYNYL
Sbjct  456  STFGAWMNYVTTSHVGALSFFIMDFFLFFGVAVLTVVQASQISRNITTNEMANVMRYNYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQM-ASSALQNGA  423
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E  EES   E EGIGM  M  +S +QNG 
Sbjct  516  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEYIEESARDEEEGIGMRHMLKNSNVQNGD  575

Query  422  CHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGR  243
             +S  TNGN  V INVN N+TS H +   +   ++++      ++VPLGLG GLGRN  R
Sbjct  576  AYSHHTNGNSQVAINVNSNSTSHHGHAHSAQCSHNNHGKTKS-DNVPLGLGLGLGRNTAR  634

Query  242  TAVVS  228
            + V S
Sbjct  635  SVVAS  639



>ref|XP_010493140.1| PREDICTED: protein S-acyltransferase 24-like [Camelina sativa]
Length=620

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 121/182 (66%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE      EGI M+QM  +       
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDATQRQEGISMMQMQRN-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
              +  NGN HV INVN    S   +   S+  + HNS     + VP+GLG GL RN  R 
Sbjct  559  -PELQNGNGHVAINVNPVHNSQSTHGHSSNCSHSHNSKSKT-DKVPVGLGLGLARNPTRP  616

Query  239  AV  234
             V
Sbjct  617  VV  618



>ref|XP_008795826.1| PREDICTED: protein S-acyltransferase 24 isoform X1 [Phoenix dactylifera]
Length=621

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GAI+FL+ DFFLF GV VLTV QASQISRNITTNEMAN +RY+YL
Sbjct  445  TSFGAWLSHSATYHPGAILFLMMDFFLFFGVAVLTVIQASQISRNITTNEMANFMRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GG FRNPYDHG +KNCS FL+NGYNED+EC E++   E +GMIQMA SS +Q G  H
Sbjct  505  KGRGGWFRNPYDHGIRKNCSGFLLNGYNEDVECPEQTTPSEEMGMIQMARSSNIQVGGTH  564

Query  416  SQQTNGNDHV  387
            SQ  +GN HV
Sbjct  565  SQHGSGNGHV  574



>gb|KHN47119.1| S-acyltransferase TIP1 [Glycine soja]
Length=677

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 104/136 (76%), Gaps = 6/136 (4%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+ +    H GAI FL+ADFFLF GV  LTV QASQISRNITTNEMANALRYNYLR
Sbjct  486  SFGAWIQYVANNHTGAISFLIADFFLFFGVFTLTVVQASQISRNITTNEMANALRYNYLR  545

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA-SSALQNGACH  417
            G GGRFRNPYDHG KKNCSDFLINGYNEDIEC EE G   EGIGM+ MA SS L NG  H
Sbjct  546  GPGGRFRNPYDHGIKKNCSDFLINGYNEDIECIEELGSSEEGIGMMHMARSSNLANGDSH  605

Query  416  SQ----QTNGNDHVVI  381
            +     + NGN H VI
Sbjct  606  NHSEYARGNGNGHHVI  621



>ref|XP_008242880.1| PREDICTED: protein S-acyltransferase 24 [Prunus mume]
Length=639

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 134/185 (72%), Gaps = 4/185 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAW+N+    H+GA+ F + DFFLF GV VLTV QASQISRN+TTNEMANA+RYNYL
Sbjct  456  STFGAWINYVAISHVGALSFFIMDFFLFFGVAVLTVVQASQISRNVTTNEMANAMRYNYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQM-ASSALQNGA  423
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E  EES   E EGIGM  M  +S +QNG 
Sbjct  516  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEYIEESARDEEEGIGMRHMLKNSNVQNGD  575

Query  422  CHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGR  243
             +S  TNGN  V INVN N+TS H +   +   ++++      ++VPLGLG GLGRN  R
Sbjct  576  AYSHHTNGNSQVAINVNSNSTSHHGHAHSAQCSHNNHGKTKS-DNVPLGLGLGLGRNTAR  634

Query  242  TAVVS  228
            + V S
Sbjct  635  SVVAS  639



>ref|XP_009126441.1| PREDICTED: protein S-acyltransferase 24 [Brassica rapa]
Length=617

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGA ++H  + H+GA+ FL+ +F LF  V VLT+ QASQISRNITTNEMANALRY+YL
Sbjct  443  SSFGALVSHVASNHVGALSFLVIEFCLFFSVAVLTIVQASQISRNITTNEMANALRYSYL  502

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYDHGC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  503  RGPGGRFRNPYDHGCRRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRS-------  555

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV I+VN    S   +   S+  + H+S     +SVPLGLG G+GRN  R 
Sbjct  556  -SNLQNGNGHVAIDVNPVHNSQSAHVHSSNCSHSHSSKSKS-DSVPLGLGLGIGRNPTRP  613

Query  239  AV  234
             V
Sbjct  614  VV  615



>ref|NP_197535.2| S-acyltransferase TIP1 [Arabidopsis thaliana]
 sp|Q52T38.1|ZDH22_ARATH RecName: Full=Protein S-acyltransferase 24; AltName: Full=Ankyrin 
repeat-containing S-palmitoyltransferase; AltName: Full=Palmitoyltransferase 
TIP1; AltName: Full=Protein TIP GROWTH 
DEFECTIVE 1; Short=AtTIP1; AltName: Full=Zinc finger DHHC domain-containing 
protein TIP1 [Arabidopsis thaliana]
 gb|AAX89384.1| ankryin repeat S-palmitoyl transferase [Arabidopsis thaliana]
 dbj|BAF00511.1| ankyrin-repeat protein [Arabidopsis thaliana]
 gb|AED92834.1| S-acyltransferase TIP1 [Arabidopsis thaliana]
 gb|AFI41207.1| ankyrin protein, partial [Arabidopsis thaliana]
Length=620

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 123/183 (67%), Gaps = 13/183 (7%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQMASSA-LQNGA  423
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE      EGI M+QM  +  LQNG 
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDATQRPEGISMMQMQRNPNLQNG-  564

Query  422  CHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGR  243
                    N HV I+VN    S   +   ++  + HNS     ++VPLGLG GL RN  R
Sbjct  565  --------NGHVAIDVNPTHNSQSAHVHSANCSHSHNSKSKS-DNVPLGLGLGLSRNPTR  615

Query  242  TAV  234
              V
Sbjct  616  PVV  618



>ref|XP_010250284.1| PREDICTED: protein S-acyltransferase 24-like [Nelumbo nucifera]
Length=631

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+NHAGTQHIG + FL+ D FLF GV  LT+ QASQISRNITTNEMANA+RY YL
Sbjct  453  SSFGAWMNHAGTQHIGTVSFLIVDVFLFFGVAALTIVQASQISRNITTNEMANAMRYGYL  512

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            R  GG F+NPYDHG +KNCSDF I GYNED+E +EE     G GM+QMA SS LQN   H
Sbjct  513  RDPGGHFKNPYDHGIRKNCSDFFIKGYNEDVEYTEEPNH-SGTGMMQMARSSNLQNRENH  571

Query  416  SQQTNGNDHVVI  381
            S     N HV I
Sbjct  572  SHHIRSNAHVSI  583



>gb|KJB23676.1| hypothetical protein B456_004G109200 [Gossypium raimondii]
Length=667

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S F  W+NHA T HIGAI FL+ DFFLF GV  LTV QASQI+RNITTNEMAN +RY+YL
Sbjct  465  SPFFPWINHAFTHHIGAITFLIVDFFLFFGVAALTVVQASQIARNITTNEMANVMRYSYL  524

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            R A GRFRNPYDHGC+KNCSDFLINGYNED++ SEE    EGIGM+QM     L+NG   
Sbjct  525  RSATGRFRNPYDHGCRKNCSDFLINGYNEDVQISEEPAHFEGIGMVQMGRDLNLENGDLE  584

Query  416  SQQTNGNDHVVI  381
            +   N N H+ I
Sbjct  585  T-AANRNGHIAI  595



>gb|KJB23675.1| hypothetical protein B456_004G109200 [Gossypium raimondii]
Length=662

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S F  W+NHA T HIGAI FL+ DFFLF GV  LTV QASQI+RNITTNEMAN +RY+YL
Sbjct  460  SPFFPWINHAFTHHIGAITFLIVDFFLFFGVAALTVVQASQIARNITTNEMANVMRYSYL  519

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            R A GRFRNPYDHGC+KNCSDFLINGYNED++ SEE    EGIGM+QM     L+NG   
Sbjct  520  RSATGRFRNPYDHGCRKNCSDFLINGYNEDVQISEEPAHFEGIGMVQMGRDLNLENGDLE  579

Query  416  SQQTNGNDHVVI  381
            +   N N H+ I
Sbjct  580  T-AANRNGHIAI  590



>emb|CDY45091.1| BnaA02g04850D [Brassica napus]
Length=630

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 122/182 (67%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG  ++H  + H+GA+ FL+ +  LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  456  SSFGELVSHVASNHVGALSFLVIEICLFFSVAVLTVVQASQISRNITTNEMANALRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYDHGC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  516  RGPGGRFRNPYDHGCRRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRS-------  568

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV I+VN    S   +   S+  + H+S     +SVPLGLG G+GRN  R 
Sbjct  569  -SNLQNGNGHVAIDVNPVHNSQSAHVHSSNCSHSHSSKSKS-DSVPLGLGLGIGRNPTRP  626

Query  239  AV  234
             V
Sbjct  627  VV  628



>ref|XP_008457291.1| PREDICTED: protein S-acyltransferase 24 [Cucumis melo]
Length=632

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+NH G  H+GAI FL+ DFFLF GV VLT+ QASQISRNITTNEMANA+RY+YL
Sbjct  450  SSFGAWINHVGNHHVGAISFLIVDFFLFFGVAVLTIVQASQISRNITTNEMANAMRYSYL  509

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECS-EESGEVEGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLI GYNED+E +   S   E   M    +S +QNG  H
Sbjct  510  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDVEYNESSSHSEEMEAMSSPMNSVMQNGDSH  569

Query  416  SQQTNGNDHVVI  381
            S  TNGN+H+ I
Sbjct  570  SHHTNGNNHIAI  581



>gb|KFK33845.1| hypothetical protein AALP_AA5G067400 [Arabis alpina]
Length=624

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 101/137 (74%), Gaps = 11/137 (8%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+FGAW+ H    H+GA+ FL+ +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  447  STFGAWMRHVAATHVGALSFLVVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES---GEVEG--IGMIQMAS-SALQ  432
            RG GGRFRNPYDHGC++NCSDFL+ GYNEDIEC +E    GE EG   GMIQM     LQ
Sbjct  507  RGPGGRFRNPYDHGCRRNCSDFLVKGYNEDIECRDEDPSNGEEEGERTGMIQMQQIPKLQ  566

Query  431  NGACHSQQTNGNDHVVI  381
            NG      TNGN H+ +
Sbjct  567  NG-----NTNGNGHIAL  578



>ref|XP_003549717.1| PREDICTED: protein S-acyltransferase 24-like [Glycine max]
Length=633

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 104/136 (76%), Gaps = 6/136 (4%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+ +    HIGAI FL+ADFFLF GV  LTV QASQISRNITTNEMANA+RY+YLR
Sbjct  440  SFGAWIQYVANNHIGAISFLIADFFLFFGVFTLTVVQASQISRNITTNEMANAMRYSYLR  499

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA-SSALQNGACH  417
            G GGRFRNPYDHG KKNCSDFLINGYNED+EC EE G   EGIGM+ MA SS L NG  H
Sbjct  500  GPGGRFRNPYDHGIKKNCSDFLINGYNEDVECIEELGNSEEGIGMMHMARSSNLANGDSH  559

Query  416  SQ----QTNGNDHVVI  381
            +     + NGN H  I
Sbjct  560  THTEYARGNGNGHHAI  575



>gb|KHN15025.1| S-acyltransferase TIP1 [Glycine soja]
Length=613

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 104/136 (76%), Gaps = 6/136 (4%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+ +    HIGAI FL+ADFFLF GV  LTV QASQISRNITTNEMANA+RY+YLR
Sbjct  420  SFGAWIQYVANNHIGAISFLIADFFLFFGVFTLTVVQASQISRNITTNEMANAMRYSYLR  479

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA-SSALQNGACH  417
            G GGRFRNPYDHG KKNCSDFLINGYNED+EC EE G   EGIGM+ MA SS L NG  H
Sbjct  480  GPGGRFRNPYDHGIKKNCSDFLINGYNEDVECIEELGNSEEGIGMMHMARSSNLANGDSH  539

Query  416  SQ----QTNGNDHVVI  381
            +     + NGN H  I
Sbjct  540  THTEYARGNGNGHHAI  555



>ref|XP_010420875.1| PREDICTED: protein S-acyltransferase 24-like [Camelina sativa]
Length=619

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 127/183 (69%), Gaps = 14/183 (8%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQMASSA-LQNGA  423
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE      EGI M+QM  +  LQNG 
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDATQRQEGISMMQMQRNPELQNG-  564

Query  422  CHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGR  243
                  NG    V        +S   H HSS+C+H ++SK+K++ VPLGLG GL RN  R
Sbjct  565  ------NG----VAINVNPVHNSQSTHGHSSNCSHSHNSKSKSDKVPLGLGLGLARNPTR  614

Query  242  TAV  234
              V
Sbjct  615  PVV  617



>ref|XP_004139278.1| PREDICTED: protein S-acyltransferase 24 [Cucumis sativus]
 ref|XP_011648716.1| PREDICTED: protein S-acyltransferase 24 [Cucumis sativus]
 gb|KGN60728.1| hypothetical protein Csa_2G008680 [Cucumis sativus]
Length=632

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+NH G  H+GAI FL+ DFFLF GV VLT+ QASQISRNITTNEMANA+RY+YL
Sbjct  450  SSFGAWINHIGNHHVGAISFLIVDFFLFFGVAVLTIVQASQISRNITTNEMANAMRYSYL  509

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECS-EESGEVEGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFLI GYNEDIE +   S   E   M    +S LQNG  H
Sbjct  510  RGPGGRFRNPYDHGIRKNCSDFLIKGYNEDIEYNESSSHSEEMEAMSSPMNSVLQNGDSH  569

Query  416  SQQTNGNDHVVI  381
            S   NGN+H+ I
Sbjct  570  SHHANGNNHIAI  581



>gb|KHG18334.1| Palmitoyltransferase akr1 [Gossypium arboreum]
Length=654

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A T HIGAI FL+ DFFLF GV  LTV QASQI+RNITTNEMAN +RY+YL
Sbjct  460  SSFFPWINNAFTHHIGAITFLIVDFFLFFGVAALTVVQASQIARNITTNEMANVMRYSYL  519

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSA-LQNGACH  417
            R A GRFRNPYDHGC+KNCSDFLINGYNED++ SEE    EGIGM+QM     L+NG   
Sbjct  520  RSATGRFRNPYDHGCRKNCSDFLINGYNEDVQISEELAHFEGIGMVQMGRDLNLENGDLQ  579

Query  416  SQQTNGNDHVVI  381
            +   N N H+ I
Sbjct  580  T-AANRNGHIAI  590



>ref|XP_011078543.1| PREDICTED: LOW QUALITY PROTEIN: protein S-acyltransferase 24 
[Sesamum indicum]
Length=619

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 119/183 (65%), Gaps = 11/183 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW NH G QHIGA+ F++AD F+ SGV  LT  QASQI+RNITTNE+AN +RY+YL
Sbjct  444  SSFGAWWNHVGGQHIGALSFVIADLFILSGVVALTCVQASQIARNITTNELANVMRYDYL  503

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSE-ESGEVEGIGMIQMASSALQNGAC-  420
            RG G +F NPYDHGCK NCSDFLI GYNEDIE  E  S E EGIGMIQ     L N    
Sbjct  504  RGPGDQFHNPYDHGCKNNCSDFLIKGYNEDIELLEAPSTEHEGIGMIQPHCGNLPNAIVG  563

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S +TNGN HV I       +   +  ++   +H +S   K ES PL    G GRN+ R 
Sbjct  564  LSHKTNGNAHVAI-----DVNISKHDGYNHCSHHDHSHSRKIESGPL----GFGRNSARP  614

Query  239  AVV  231
            AVV
Sbjct  615  AVV  617



>ref|XP_010520556.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Tarenaya 
hassleriana]
Length=635

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 7/187 (4%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWL+H GT H+GA+ FL+ +F LF  V VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  447  SSFGAWLSHVGTNHVGAMSFLIVEFCLFFSVAVLTVVQASQISRNITTNEMANAMRYSYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVE-----GIGMIQMASSA-LQ  432
            RG GGRFRNP+DHGC++NCSDFL+ GYNEDIEC EES         GI M+QM  +  L+
Sbjct  507  RGPGGRFRNPFDHGCRRNCSDFLLKGYNEDIECREESPSPREEEEGGISMVQMQRNLNLE  566

Query  431  NG-ACHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGR  255
            NG +  S  TNG+ HV I+VN      HH+   S+  +     K+K++SVPLGLG GLGR
Sbjct  567  NGTSISSHNTNGSSHVAIDVNNIDHHGHHHVHSSNCSHGSKHVKSKSDSVPLGLGLGLGR  626

Query  254  NAGRTAV  234
            N  R  V
Sbjct  627  NPSRPVV  633



>ref|XP_010520557.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Tarenaya 
hassleriana]
Length=630

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 133/187 (71%), Gaps = 7/187 (4%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAWL+H GT H+GA+ FL+ +F LF  V VLTV QASQISRNITTNEMANA+RY+YL
Sbjct  442  SSFGAWLSHVGTNHVGAMSFLIVEFCLFFSVAVLTVVQASQISRNITTNEMANAMRYSYL  501

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVE-----GIGMIQMASSA-LQ  432
            RG GGRFRNP+DHGC++NCSDFL+ GYNEDIEC EES         GI M+QM  +  L+
Sbjct  502  RGPGGRFRNPFDHGCRRNCSDFLLKGYNEDIECREESPSPREEEEGGISMVQMQRNLNLE  561

Query  431  NG-ACHSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGR  255
            NG +  S  TNG+ HV I+VN      HH+   S+  +     K+K++SVPLGLG GLGR
Sbjct  562  NGTSISSHNTNGSSHVAIDVNNIDHHGHHHVHSSNCSHGSKHVKSKSDSVPLGLGLGLGR  621

Query  254  NAGRTAV  234
            N  R  V
Sbjct  622  NPSRPVV  628



>ref|XP_003563307.1| PREDICTED: protein S-acyltransferase 24 [Brachypodium distachyon]
Length=638

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 116/188 (62%), Gaps = 7/188 (4%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL ++   H GA+ F   D FLF GV  LTV QASQI+RNITTNEM N++RY+YL
Sbjct  456  ASFGAWLGYSAVHHPGAVSFFFMDLFLFCGVAGLTVVQASQIARNITTNEMVNSMRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG +KNC+DFL+NGYNED+E  E +    E IGMIQM S+  QNG   
Sbjct  516  RGPGGRFRNPFDHGVRKNCADFLLNGYNEDVERLEHTSHTDEEIGMIQMTSAVSQNGEGS  575

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRN-AGRT  240
            S   NG DH  +      + +  N       +       K +  P GLG GLGRN A R 
Sbjct  576  SHHGNGTDHACV-----DSHASSNSHSQVSSSQCCDHSKKNDRTPFGLGLGLGRNSASRQ  630

Query  239  AVVS*LML  216
             V S L L
Sbjct  631  YVRSLLPL  638



>gb|KFK26273.1| hypothetical protein AALP_AA8G225500 [Arabis alpina]
Length=626

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  T H+GA+ FLL +F LF  V VLTV Q SQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVATNHVGALSFLLIEFCLFFSVAVLTVIQGSQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMA-SSALQNGA  423
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM  +S LQNG 
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECQEEDSTPRQEGISMMQMQRNSNLQNGN  565

Query  422  CH  417
             H
Sbjct  566  GH  567



>ref|XP_002437346.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor]
 gb|EER88713.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor]
Length=640

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++++  QH G + FL  D FLF GV VLTV QASQI+RNITTNEMAN++RY YL
Sbjct  458  SSFGAWIHYSAFQHPGVVSFLALDCFLFFGVAVLTVVQASQIARNITTNEMANSMRYAYL  517

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFL NGYNED E  +++    E +GMIQM S+  QNG  H
Sbjct  518  RGPGGRFRNPYDHGIRKNCSDFLFNGYNEDTERLDQALHTDEEMGMIQMTSAVSQNGDNH  577

Query  416  SQQTNGNDH  390
                NG DH
Sbjct  578  LHHANGTDH  586



>ref|XP_009392141.1| PREDICTED: protein S-acyltransferase 24-like [Musa acuminata 
subsp. malaccensis]
Length=626

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
             SFG WL+H  ++H GAI FL+ DFFLF GV VLT  QASQISRNITTNEMANA+RY+YL
Sbjct  448  PSFGGWLSHNASEHPGAISFLIMDFFLFFGVAVLTAVQASQISRNITTNEMANAMRYSYL  507

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            RG GGRFRNPYDHG +KNC DF I GYNED+E  +++   EG GMIQM  S+ LQNG  H
Sbjct  508  RGPGGRFRNPYDHGIRKNCLDFFIKGYNEDVELPDQTQPSEGTGMIQMTRSTDLQNGENH  567

Query  416  SQQTNGNDHVVI  381
              Q+ GN H+ +
Sbjct  568  LHQS-GNGHICV  578



>ref|XP_007155091.1| hypothetical protein PHAVU_003G172300g [Phaseolus vulgaris]
 gb|ESW27085.1| hypothetical protein PHAVU_003G172300g [Phaseolus vulgaris]
Length=635

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 6/136 (4%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+ + G  H GAI FL+ADFFLF GV  LTV QASQISRNITTNEMANA+RY+YLR
Sbjct  447  SFGAWIQYVGKNHTGAISFLIADFFLFFGVFALTVVQASQISRNITTNEMANAMRYSYLR  506

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA-SSALQNGACH  417
            G+GGRFRNPYDHG KKNCSDFLINGYNED+EC EE G   EG+GM+ +  SS L NG  H
Sbjct  507  GSGGRFRNPYDHGIKKNCSDFLINGYNEDVECIEELGRTEEGVGMMNIGRSSNLANGDSH  566

Query  416  SQ----QTNGNDHVVI  381
            ++    + +GN   VI
Sbjct  567  TRGEYARGHGNGQYVI  582



>ref|XP_006400604.1| hypothetical protein EUTSA_v10012979mg [Eutrema salsugineum]
 dbj|BAJ33877.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42057.1| hypothetical protein EUTSA_v10012979mg [Eutrema salsugineum]
Length=619

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  + H+GA+ FLL +F LF  V VLTV Q SQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLTVIQGSQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRS-------  558

Query  419  HSQQTNGNDHVVI  381
             S   NGN HV I
Sbjct  559  -SNIQNGNGHVAI  570



>emb|CDX70923.1| BnaC03g10070D [Brassica napus]
Length=602

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 98/133 (74%), Gaps = 10/133 (8%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFG+W+++  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  456  SSFGSWISYVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GG FRNPYDHGCK+NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  516  RGPGGGFRNPYDHGCKRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRS-------  568

Query  419  HSQQTNGNDHVVI  381
             S   NGN HV I
Sbjct  569  -SNTQNGNGHVSI  580



>ref|XP_004965751.1| PREDICTED: S-acyltransferase TIP1-like [Setaria italica]
Length=643

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 9/137 (7%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++++  QH G + FL  DFFLF GV VLTV QASQI+RNITTNEMAN++RY YL
Sbjct  465  SSFGAWIHYSAFQHPGVVSFLAMDFFLFFGVAVLTVVQASQIARNITTNEMANSMRYAYL  524

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNG---  426
            RG GGRFRNPYDHG +KNCSDFL+NGYNEDIE  E++    E +GMIQM  +  QNG   
Sbjct  525  RGPGGRFRNPYDHGIRKNCSDFLLNGYNEDIERLEQTSRTDEEMGMIQMTGAVSQNGDHG  584

Query  425  -----ACHSQQTNGNDH  390
                 +C   QTN   H
Sbjct  585  NGTDHSCTDSQTNSKSH  601



>emb|CDY68411.1| BnaAnng27190D, partial [Brassica napus]
Length=386

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGA L+H  + H+GA+ FL+ +F LF  VTVLTV QASQISRNITTNEMANALRY+YL
Sbjct  212  SSFGALLSHVASNHVGALSFLVIEFCLFFSVTVLTVVQASQISRNITTNEMANALRYSYL  271

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG  GRFRNPYDHGC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  272  RGPAGRFRNPYDHGCRRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRS-------  324

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV I+V+    S   +   S+  + H+S     +SVPLGLG GLGRN  R 
Sbjct  325  -SNLQNGNGHVAIDVSPVHNSQSAHVHSSNCSHSHSSKSKS-DSVPLGLGLGLGRNPTRP  382

Query  239  AV  234
             V
Sbjct  383  VV  384



>emb|CDY51852.1| BnaA03g56190D [Brassica napus]
Length=594

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 97/133 (73%), Gaps = 10/133 (8%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW+++  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  448  SSFGAWISYVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  507

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GG FRNPYDHGC++NCSDFL+ GYNEDIEC EE  +   EGI M+QM          
Sbjct  508  RGPGGGFRNPYDHGCRRNCSDFLVKGYNEDIECHEEDTTPRQEGISMMQMQRD-------  560

Query  419  HSQQTNGNDHVVI  381
             S   NGN HV I
Sbjct  561  -SNTQNGNGHVAI  572



>emb|CDX92467.1| BnaA10g15060D [Brassica napus]
Length=620

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 121/182 (66%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  T H+GA+ FL+ +  LF  V VLTV Q SQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWISHVATNHVGALSFLIVESCLFFSVAVLTVIQGSQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GCK+NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  506  RGPGGRFRNPYDLGCKRNCSDFLLKGYNEDIECQEEDTTPRQEGISMMQMQRS-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV I+VN    S   +   S   + H+S     +SVPLGLG GLGRN  R 
Sbjct  559  -SNLQNGNGHVAIDVNPIHNSQSGHVHSSKCSHGHSSKPKS-DSVPLGLGLGLGRNPTRA  616

Query  239  AV  234
             V
Sbjct  617  VV  618



>ref|NP_001046105.1| Os02g0184000 [Oryza sativa Japonica Group]
 dbj|BAD25064.1| putative ankyrin repeat-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08019.1| Os02g0184000 [Oryza sativa Japonica Group]
 dbj|BAG93047.1| unnamed protein product [Oryza sativa Japonica Group]
Length=654

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ D FLF GV  LTV QASQISRN+TTNEMANA+RY+YL
Sbjct  460  ASFGGWLNYSATNHPWVVSFVVMDLFLFFGVITLTVVQASQISRNLTTNEMANAMRYSYL  519

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDFL+ GYNEDIE  E++ +  E +GMIQM  SA+ QNG  
Sbjct  520  RGPGGRFRNPFDHGVRKNCSDFLLKGYNEDIERVEQTLQPDEELGMIQMTRSAVSQNGES  579

Query  419  HSQQTNGNDH  390
             S   NG DH
Sbjct  580  MSLHANGTDH  589



>ref|XP_009120814.1| PREDICTED: protein S-acyltransferase 24-like [Brassica rapa]
Length=620

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 124/184 (67%), Gaps = 12/184 (7%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  T H+GA+ FL+ +  LF  V VLTV Q SQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWISHVATNHVGALSFLIVESCLFFSVAVLTVIQGSQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GCK+NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  506  RGPGGRFRNPYDLGCKRNCSDFLLKGYNEDIECQEEDTTPRQEGISMMQMQRS-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV I+VN    S   +   S   + H+S     +SVPLGLG GLGRN  R 
Sbjct  559  -SNLQNGNGHVAIDVNPIHNSQSGHVHSSKCSHGHSSKPKS-DSVPLGLGLGLGRNLTR-  615

Query  239  AVVS  228
            AVVS
Sbjct  616  AVVS  619



>gb|EEC72626.1| hypothetical protein OsI_06124 [Oryza sativa Indica Group]
Length=654

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ D FLF GV  LTV QASQISRN+TTNEMANA+RY+YL
Sbjct  460  ASFGGWLNYSATNHPWVVSFVVMDLFLFFGVITLTVVQASQISRNLTTNEMANAMRYSYL  519

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDFL+ GYNEDIE  E++ +  E +GMIQM  SA+ QNG  
Sbjct  520  RGPGGRFRNPFDHGVRKNCSDFLLKGYNEDIERVEQTLQPDEELGMIQMTRSAVSQNGES  579

Query  419  HSQQTNGNDH  390
             S   NG DH
Sbjct  580  MSLHANGTDH  589



>ref|XP_008659786.1| PREDICTED: protein S-acyltransferase 24-like [Zea mays]
 gb|AFW87295.1| hypothetical protein ZEAMMB73_866253 [Zea mays]
Length=639

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++++  QH G + FL  D FLF GV VLTV QASQI+RNITTNEMAN++RY YL
Sbjct  456  SSFGAWIHYSAFQHPGVVSFLALDCFLFFGVAVLTVVQASQIARNITTNEMANSMRYAYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASS-ALQNGAC  420
            RG GGRFRNPYDHG +KNCSDFL+NGYNED E  E++    E +GMIQM S+ + QNG  
Sbjct  516  RGPGGRFRNPYDHGIRKNCSDFLLNGYNEDTERLEQTLPTDEEMGMIQMTSAVSQQNGDN  575

Query  419  HSQQTNGNDH  390
            H    NG DH
Sbjct  576  HLHHGNGTDH  585



>ref|XP_008795828.1| PREDICTED: protein S-acyltransferase 24 isoform X2 [Phoenix dactylifera]
Length=591

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL+H+ T H GAI+FL+ DFFLF GV VLTV QASQISRNITTNEMAN +RY+YL
Sbjct  445  TSFGAWLSHSATYHPGAILFLMMDFFLFFGVAVLTVIQASQISRNITTNEMANFMRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            +G GG FRNPYDHG +KNCS FL+NGYNED+EC E++   E +GMIQMA S+  N  C+ 
Sbjct  505  KGRGGWFRNPYDHGIRKNCSGFLLNGYNEDVECPEQTTPSEEMGMIQMARSS--NIQCNH  562

Query  413  QQTNG  399
             +++G
Sbjct  563  SRSDG  567



>gb|EEE56453.1| hypothetical protein OsJ_05649 [Oryza sativa Japonica Group]
Length=634

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ D FLF GV  LTV QASQISRN+TTNEMANA+RY+YL
Sbjct  440  ASFGGWLNYSATNHPWVVSFVVMDLFLFFGVITLTVVQASQISRNLTTNEMANAMRYSYL  499

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDFL+ GYNEDIE  E++ +  E +GMIQM  SA+ QNG  
Sbjct  500  RGPGGRFRNPFDHGVRKNCSDFLLKGYNEDIERVEQTLQPDEELGMIQMTRSAVSQNGES  559

Query  419  HSQQTNGNDH  390
             S   NG DH
Sbjct  560  MSLHANGTDH  569



>gb|KJB64639.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=448

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A + H+GAI FL+ +FFLF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  280  SSFFPWMNYAVSHHVGAISFLIVNFFLFFGVAALTVIQASQISRNITTNEMANVMRYSYL  339

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            +G GGRFRNPYDHGC KNCSDFLI GYNEDI+  E++   EGIGM+QM     +NG+   
Sbjct  340  KGPGGRFRNPYDHGCWKNCSDFLIKGYNEDIQVIEDAAHSEGIGMVQMTR---ENGSL--  394

Query  413  QQTNGNDHVVI  381
               N N H+ I
Sbjct  395  --GNKNGHIAI  403



>ref|XP_008649039.1| PREDICTED: protein S-acyltransferase 24 [Zea mays]
 gb|AFW76198.1| hypothetical protein ZEAMMB73_209183 [Zea mays]
Length=638

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++++  QH G + FL  D FLF GV VLTV+QASQI+RNITTNEMAN++RY YL
Sbjct  456  SSFGAWIHYSAFQHPGVVSFLALDCFLFFGVAVLTVSQASQIARNITTNEMANSMRYAYL  515

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDFL+NGYNED E  +++    E +GMIQM  +  QNG  H
Sbjct  516  RGPGGRFRNPYDHGIRKNCSDFLLNGYNEDTERLDQTLHTDEEMGMIQMTRAVSQNGDNH  575

Query  416  SQQTNGNDH  390
                NG +H
Sbjct  576  LHHGNGTEH  584



>ref|XP_006657184.1| PREDICTED: protein S-acyltransferase 24-like [Oryza brachyantha]
Length=547

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 119/186 (64%), Gaps = 7/186 (4%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SF  WL+++   H GA+ FL+ D FLF GV VLTV QASQI++NITTNEMAN++RY+YL
Sbjct  366  ASFVPWLSYSAFNHPGALSFLIMDLFLFFGVAVLTVVQASQIAKNITTNEMANSMRYSYL  425

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG +KNCS+FLINGYNEDIE  + +    E IGMIQM S+  QNG   
Sbjct  426  RGPGGRFRNPFDHGVRKNCSEFLINGYNEDIERLDHTSHADEEIGMIQMTSTVSQNGEGP  485

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S   NG  H          S  ++  HS   +       KT+  PLGLG GLGRN+    
Sbjct  486  SHLGNGTGHAC------ADSHANSTSHSPSSSQCCDHSKKTDRTPLGLGPGLGRNSASRQ  539

Query  236  VVS*LM  219
             V  L+
Sbjct  540  FVRSLL  545



>gb|KJB64635.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=627

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A + H+GAI FL+ +FFLF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  459  SSFFPWMNYAVSHHVGAISFLIVNFFLFFGVAALTVIQASQISRNITTNEMANVMRYSYL  518

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            +G GGRFRNPYDHGC KNCSDFLI GYNEDI+  E++   EGIGM+QM     +NG+   
Sbjct  519  KGPGGRFRNPYDHGCWKNCSDFLIKGYNEDIQVIEDAAHSEGIGMVQMTR---ENGSL--  573

Query  413  QQTNGNDHVVI  381
               N N H+ I
Sbjct  574  --GNKNGHIAI  582



>gb|KJB64638.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=633

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A + H+GAI FL+ +FFLF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  465  SSFFPWMNYAVSHHVGAISFLIVNFFLFFGVAALTVIQASQISRNITTNEMANVMRYSYL  524

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            +G GGRFRNPYDHGC KNCSDFLI GYNEDI+  E++   EGIGM+QM     +NG+   
Sbjct  525  KGPGGRFRNPYDHGCWKNCSDFLIKGYNEDIQVIEDAAHSEGIGMVQMTR---ENGSL--  579

Query  413  QQTNGNDHVVI  381
               N N H+ I
Sbjct  580  --GNKNGHIAI  588



>gb|EMT15309.1| S-acyltransferase TIP1 [Aegilops tauschii]
Length=445

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 112/186 (60%), Gaps = 6/186 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL ++   H GA+ F + D F+F GV  LT  QA QI+RNITTNEMAN++RY YL
Sbjct  263  ASFGDWLGYSVVYHTGAVSFFMMDLFIFFGVACLTGVQAYQIARNITTNEMANSMRYTYL  322

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNP+DHG +KNCSDFL+NGYNED+E  E +    E IGMIQM S+  QNG  H
Sbjct  323  RGPAGRFRNPFDHGVRKNCSDFLVNGYNEDVERLEHASRTDEEIGMIQMTSAVSQNGEGH  382

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S   N +DH         + ++ N       +       K E  P GLG GLGRN+    
Sbjct  383  SHHGNCDDHAC-----ADSHANSNSHTQGGSSQCCDHSKKNERTPFGLGLGLGRNSASRQ  437

Query  236  VVS*LM  219
             +  L+
Sbjct  438  YIRNLL  443



>ref|XP_006287281.1| hypothetical protein CARUB_v10000476mg [Capsella rubella]
 gb|EOA20179.1| hypothetical protein CARUB_v10000476mg [Capsella rubella]
Length=620

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 122/182 (67%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  + H+GA+ FLL +F LF  V VLTV QASQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLTVIQASQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESG--EVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD GC++NCSDFL+ GYNEDIEC EE      EGI M+QM  +       
Sbjct  506  RGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHEEDATQRQEGISMMQMQRN-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV INVN    S   +   S+  + HN+     + VPLGLG GLGRN  R 
Sbjct  559  -SDLQNGNGHVAINVNPIHNSQSTHVHSSNCSHSHNNKSKS-DKVPLGLGLGLGRNPTRP  616

Query  239  AV  234
             V
Sbjct  617  VV  618



>gb|KHG04996.1| Palmitoyltransferase AKR1 [Gossypium arboreum]
Length=622

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 7/131 (5%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A + H+GAI FL+ +FFLF GV  LT+ QASQISRNITTNEMAN +RY+YL
Sbjct  454  SSFFPWMNYAVSHHVGAISFLIVNFFLFFGVAALTIIQASQISRNITTNEMANVMRYSYL  513

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNGACHS  414
            +G GGRFRNPYDHGC KNCSDFLI GYNEDI+  E++   EGIGM+QM     +NG+   
Sbjct  514  KGPGGRFRNPYDHGCWKNCSDFLIKGYNEDIQVIEDAVHSEGIGMVQMTR---ENGSL--  568

Query  413  QQTNGNDHVVI  381
               N N H+ I
Sbjct  569  --GNKNGHIAI  577



>ref|XP_009398663.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=617

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
             SFG WLNH  T+H+GA+ FL+ DFFLF GV VLTV QASQIS+NITTNE+AN+ RY+YL
Sbjct  445  PSFGGWLNHNATEHLGALSFLIMDFFLFFGVAVLTVVQASQISQNITTNEVANSTRYSYL  504

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACH  417
            +G GG FRNPYDHG  KNCSDF I GYNED+E  E+    E +GMIQM  S+  QNG  H
Sbjct  505  KGPGGLFRNPYDHGIHKNCSDFWIKGYNEDVELPEQIPPSEEMGMIQMTRSTDSQNGESH  564

Query  416  SQQTN  402
            S Q+N
Sbjct  565  SHQSN  569



>ref|XP_006648383.1| PREDICTED: protein S-acyltransferase 24-like [Oryza brachyantha]
Length=554

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ D FLF GV  LTV QASQISRN+TTNEMANA+RY+YL
Sbjct  370  TSFGGWLNYSATNHPWVVSFVVMDLFLFFGVITLTVVQASQISRNLTTNEMANAMRYSYL  429

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG  KNCSDFL+ GYNEDIE  E++ +  E +GMIQM   A+ QNG  
Sbjct  430  RGPGGRFRNPFDHGVHKNCSDFLLKGYNEDIERVEQTLQPDEELGMIQMTRGAVSQNGES  489

Query  419  HSQQTNGNDH  390
                 NG DH
Sbjct  490  MPLHVNGTDH  499



>emb|CDY56864.1| BnaC09g54140D [Brassica napus]
Length=620

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 121/182 (66%), Gaps = 11/182 (6%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSFGAW++H  T H+GA+ FL+ +F LF  V VLTV Q SQISRNITTNEMANALRY+YL
Sbjct  446  SSFGAWISHVATNHVGALSFLIVEFCLFFSVAVLTVIQGSQISRNITTNEMANALRYSYL  505

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEE--SGEVEGIGMIQMASSALQNGAC  420
            RG GGRFRNPYD G K+NCSDFL+ GYNEDIEC EE  +   EGI M+QM  S       
Sbjct  506  RGPGGRFRNPYDLGYKRNCSDFLLKGYNEDIECQEEDSTPRQEGISMMQMQRS-------  558

Query  419  HSQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRT  240
             S   NGN HV ++VN    S   +   S   + H+S     +SVPLGLG GLGRN  R 
Sbjct  559  -SNLQNGNGHVAVDVNPIHNSQSGHVHSSKCSHGHSSKPKS-DSVPLGLGLGLGRNPTRA  616

Query  239  AV  234
             V
Sbjct  617  VV  618



>gb|EMS53285.1| S-acyltransferase TIP1 [Triticum urartu]
Length=548

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 112/186 (60%), Gaps = 6/186 (3%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL ++   H GA+ F + D F+F GV  LT  QA QI++NITTNEMAN++RY YL
Sbjct  366  ASFGDWLGYSVVYHTGAVSFFMMDLFIFFGVACLTGVQAYQIAKNITTNEMANSMRYTYL  425

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNP+DHG +KNCSDFL+NGYNED+E  E +    E IGMIQM S+  QNG  H
Sbjct  426  RGPAGRFRNPFDHGVRKNCSDFLVNGYNEDVERLEHASRTDEEIGMIQMTSAVSQNGEGH  485

Query  416  SQQTNGNDHVVInvnknttsshhnhvhsshcnhhnssknkTESVPLGLGSGLGRNAGRTA  237
            S   N +DH         + ++ N       +       K E  P GLG GLGRN+    
Sbjct  486  SHHGNCDDHAC-----ADSHANSNSHSQGGSSQCCDHSKKNERTPFGLGLGLGRNSASRQ  540

Query  236  VVS*LM  219
             +  L+
Sbjct  541  YIRNLL  546



>gb|KHG15624.1| Palmitoyltransferase akr1 [Gossypium arboreum]
Length=590

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+NHAG  HI AI FL+ DF LF GV  LT  QASQIS+NITTNEMAN +RY+YL
Sbjct  457  SSFLQWMNHAGIHHISAISFLIVDFLLFFGVATLTAVQASQISQNITTNEMANVMRYSYL  516

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASS-ALQNGACH  417
            RGAGG F+NPYDHGC+KNC+DFL  GYNED+E SE+    +GIG+ QM  +  LQNG   
Sbjct  517  RGAGGLFKNPYDHGCRKNCTDFLFKGYNEDVEASEDIEHSKGIGVAQMLRNLKLQNGDLQ  576

Query  416  SQQ  408
            S++
Sbjct  577  SRK  579



>dbj|BAJ88769.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++   H   + F++ D FLF GV  LTV QASQIS NITTNEMANA+RY+YL
Sbjct  185  ASFGGWLNYSAVNHPWVVSFVIMDLFLFFGVITLTVVQASQISGNITTNEMANAMRYSYL  244

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDF + GYNEDIE  E++    E + MI M  SA+ QNG  
Sbjct  245  RGPGGRFRNPFDHGVRKNCSDFFLKGYNEDIEKVEQTSHPDEEMAMIHMTRSAVSQNGES  304

Query  419  HSQQTNGNDHV  387
                 NG DHV
Sbjct  305  MPLHANGADHV  315



>emb|CAE53911.1| hypothetical protein KIAA0946 [Triticum aestivum]
Length=303

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ + FLF GV  LTV QASQIS NITTNEMANA+RY+YL
Sbjct  151  ASFGGWLNYSATNHPWVVSFVIMNLFLFFGVITLTVVQASQISGNITTNEMANAMRYSYL  210

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDF + GYNEDIE  E++    E + +I M  SA+ QNG  
Sbjct  211  RGPGGRFRNPFDHGVRKNCSDFFLKGYNEDIEKVEQTSHPDEEMAIIHMTRSAVSQNGES  270

Query  419  HSQQTNGNDHV  387
                 NG DHV
Sbjct  271  VPLHANGADHV  281



>gb|EMT32654.1| S-acyltransferase TIP1 [Aegilops tauschii]
Length=626

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++ T H   + F++ D FLF GV  LTV QASQIS NITTNEMANA+RY+YL
Sbjct  423  ASFGGWLNYSATNHPWVVSFVIMDLFLFFGVITLTVVQASQISGNITTNEMANAMRYSYL  482

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDF + GYNEDIE  E++    E + ++ M  SA+ QNG  
Sbjct  483  RGPGGRFRNPFDHGVRKNCSDFFLKGYNEDIEKVEQTSHPDEEMAIMHMTRSAVSQNGES  542

Query  419  HSQQTNGNDHV  387
                 NG DHV
Sbjct  543  VPLHANGADHV  553



>ref|XP_002453418.1| hypothetical protein SORBIDRAFT_04g005696 [Sorghum bicolor]
 gb|EES06394.1| hypothetical protein SORBIDRAFT_04g005696, partial [Sorghum bicolor]
Length=587

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL +    H   + F++ D  LF GV  LTV QASQISRNITTNEMANA+RY+YL
Sbjct  444  ASFGGWLGYTAINHSWVVSFVIMDLLLFFGVITLTVIQASQISRNITTNEMANAMRYSYL  503

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNPYDHG +KNCS+FL+ GYNEDIE + ++ +  E +G IQM S   QNG   
Sbjct  504  RGPSGRFRNPYDHGVRKNCSEFLLKGYNEDIENTVQTLQTDEEMGPIQMRSPVSQNGESI  563

Query  416  SQQTNGNDH  390
                NG DH
Sbjct  564  PPHVNGTDH  572



>gb|KJB53968.1| hypothetical protein B456_009G014100 [Gossypium raimondii]
Length=590

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+NHAG  HI AI FL+ DF LF GV  LT  QASQIS+NITTNEMAN +RY+YL
Sbjct  457  SSFLQWMNHAGIHHISAISFLIMDFLLFFGVASLTAVQASQISQNITTNEMANVMRYSYL  516

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASS-ALQNGACH  417
            RGAGG F+NPYDHGC KNC+DFL  GYNED+E  E+    +GIG+ QM  +  LQNG   
Sbjct  517  RGAGGLFKNPYDHGCCKNCTDFLFKGYNEDVEACEDIEHSKGIGVAQMLRNLKLQNGDSQ  576

Query  416  SQQ  408
            S++
Sbjct  577  SRK  579



>ref|XP_008645330.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Zea 
mays]
Length=657

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL +    H   + F++ D  LF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  487  ASFGGWLGYTAINHSWVVSFVIMDLLLFLGVITLTVIQASQISRNITTNEMANTIRYSYL  546

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNPYDHG ++NCSDFL+ GYNEDIE + ++ +  E +G IQM+S   QNG   
Sbjct  547  RGPSGRFRNPYDHGLRENCSDFLLKGYNEDIESTVQTLQSDEEMGPIQMSSPVSQNGESI  606

Query  416  SQQTNGNDH  390
                NG DH
Sbjct  607  PPHVNGTDH  615



>ref|XP_008645331.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Zea 
mays]
Length=656

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL +    H   + F++ D  LF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  486  ASFGGWLGYTAINHSWVVSFVIMDLLLFLGVITLTVIQASQISRNITTNEMANTIRYSYL  545

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNPYDHG ++NCSDFL+ GYNEDIE + ++ +  E +G IQM+S   QNG   
Sbjct  546  RGPSGRFRNPYDHGLRENCSDFLLKGYNEDIESTVQTLQSDEEMGPIQMSSPVSQNGESI  605

Query  416  SQQTNGNDH  390
                NG DH
Sbjct  606  PPHVNGTDH  614



>gb|EEC81067.1| hypothetical protein OsI_23878 [Oryza sativa Indica Group]
Length=649

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SF  WL+++   HIGA+ F + D FLF GV VL V QASQI++NITTNEMAN++RY+YL
Sbjct  467  ASFIPWLSYSAFNHIGALSFFIMDLFLFFGVAVLAVVQASQIAKNITTNEMANSMRYSYL  526

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG +KNCS+FL+NGY+EDIE  + +    E +GMIQM ++  QNG   
Sbjct  527  RGPGGRFRNPFDHGARKNCSEFLLNGYSEDIERLDHTSHTDEEMGMIQMTNAVSQNGEGP  586

Query  416  SQQTNGNDH  390
            S   NG  H
Sbjct  587  SHHGNGTGH  595



>ref|NP_001058187.1| Os06g0644500 [Oryza sativa Japonica Group]
 dbj|BAD37437.1| ankyrin repeat-containing protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF20101.1| Os06g0644500 [Oryza sativa Japonica Group]
 gb|EEE66105.1| hypothetical protein OsJ_22138 [Oryza sativa Japonica Group]
Length=649

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SF  WL+++   H GA+ F + D FLF GV VL V QASQI++NITTNEMAN++RY+YL
Sbjct  467  ASFIPWLSYSAFNHTGALSFFIMDLFLFFGVAVLAVVQASQIAKNITTNEMANSMRYSYL  526

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNP+DHG +KNCS+FL+NGYNEDIE  + +    E +GMIQM ++  QNG   
Sbjct  527  RGPGGRFRNPFDHGARKNCSEFLLNGYNEDIERLDHTSHTDEEMGMIQMTNAVSQNGEGP  586

Query  416  SQQTNGNDH  390
            S   NG  H
Sbjct  587  SHHGNGTGH  595



>gb|AFW70468.1| hypothetical protein ZEAMMB73_665644 [Zea mays]
Length=407

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL +    H   + F++ D  LF GV  LTV QASQISRNITTNEMAN +RY+YL
Sbjct  237  ASFGGWLGYTAINHSWVVSFVIMDLLLFLGVITLTVIQASQISRNITTNEMANTIRYSYL  296

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG  GRFRNPYDHG ++NCSDFL+ GYNEDIE + ++ +  E +G IQM+S   QNG   
Sbjct  297  RGPSGRFRNPYDHGLRENCSDFLLKGYNEDIESTVQTLQSDEEMGPIQMSSPVSQNGESI  356

Query  416  SQQTNGNDH  390
                NG DH
Sbjct  357  PPHVNGTDH  365



>ref|XP_004951654.1| PREDICTED: S-acyltransferase TIP1-like isoform X1 [Setaria italica]
Length=639

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WL +    H   + F++ D FLF G+  LTV QASQISRN+TTNEMANA+RY+YL
Sbjct  458  ASFGGWLGYTAINHSWVVSFVIMDLFLFFGIITLTVIQASQISRNVTTNEMANAMRYSYL  517

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSALQNGACH  417
            RG GGRFRNPYDHG +KNCSDF + GYNEDIE   ++ +  E +G IQM S+  QN    
Sbjct  518  RGPGGRFRNPYDHGVRKNCSDFFLKGYNEDIEKVVQTLQPDEEMGPIQMRSAVSQNSESV  577

Query  416  SQQTNGNDH  390
                NG+DH
Sbjct  578  PLHANGSDH  586



>gb|EMS65580.1| S-acyltransferase TIP1 [Triticum urartu]
Length=712

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN++   H   + F++ D FLF GV  LTV QASQIS NITTNEMANA+RY+YL
Sbjct  423  ASFGGWLNYSAMNHPWVVSFVIMDLFLFFGVITLTVVQASQISGNITTNEMANAMRYSYL  482

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDF + GYNEDIE  E++    E + +I M   A+ QNG  
Sbjct  483  RGPGGRFRNPFDHGVRKNCSDFFLKGYNEDIEKVEQTSHPDEEMAIIHMTRGAVSQNGES  542

Query  419  HSQQTNGNDHV  387
                 NG DHV
Sbjct  543  VPLHANGADHV  553



>gb|KJB83231.1| hypothetical protein B456_013G236500 [Gossypium raimondii]
Length=609

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = -1

Query  767  FGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRG  588
            F    +HA T HIGA+ FL+ D F F G +   V+QA+QISRNITTNEMAN +RY+YLRG
Sbjct  460  FSPMFSHASTHHIGALTFLIMDIFYFFGASAFVVSQATQISRNITTNEMANIMRYSYLRG  519

Query  587  AGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACHSQ  411
            A G+ RNPYDHGC KNCSDF+INGYNED+  +E+S   E  GMIQ+   S LQN   H+ 
Sbjct  520  ADGQLRNPYDHGCWKNCSDFVINGYNEDVPIAEDSANSEETGMIQIPRDSNLQNSNSHA-  578

Query  410  QTNGNDHVVI  381
             T+ N H+ +
Sbjct  579  PTDRNGHIAV  588



>ref|XP_003570824.1| PREDICTED: protein S-acyltransferase 24-like [Brachypodium distachyon]
 ref|XP_010233921.1| PREDICTED: protein S-acyltransferase 24-like [Brachypodium distachyon]
Length=632

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFG WLN+A T H   + F++ DF LF GV  LTV QASQIS NITTNEMANA+RY+YL
Sbjct  453  ASFGGWLNYAATNHPWVVSFVIMDFLLFFGVITLTVVQASQISGNITTNEMANAMRYSYL  512

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMASSAL-QNGAC  420
            RG GGRFRNP+DHG +KNCSDF + GYNEDIE  +++    E +  IQM  SA+ QN   
Sbjct  513  RGPGGRFRNPFDHGVRKNCSDFFLKGYNEDIEKVQQTLHPDEEMATIQMTRSAVSQNDES  572

Query  419  HSQQTNGNDH  390
                 N  DH
Sbjct  573  MPLHANCTDH  582



>gb|KHF98454.1| akr1 [Gossypium arboreum]
Length=609

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = -1

Query  767  FGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRG  588
            F    +HA T HIGA+ FL+ D F F G + L V+QA+QISRNIT+NEMAN +RY+YLRG
Sbjct  460  FSPMFSHASTHHIGALTFLIMDIFYFFGASALVVSQATQISRNITSNEMANIMRYSYLRG  519

Query  587  AGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMA-SSALQNGACHSQ  411
            A G+ RNPYDHGC KNCS F+INGYNED+  +E+S   E  GMIQ+   S LQN   H+ 
Sbjct  520  ADGQLRNPYDHGCWKNCSGFVINGYNEDVPIAEDSANSEETGMIQIPRDSNLQNSNSHA-  578

Query  410  QTNGNDHVVI  381
             T+ N H+ +
Sbjct  579  PTDINGHIAV  588



>gb|ERN14295.1| hypothetical protein AMTR_s00033p00182370 [Amborella trichopoda]
Length=634

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+N+A T H GA+ FL+ D  LF GV  LT  Q SQI+ NITTNEMANA+RY+YLR
Sbjct  441  SFGAWMNYAATHHSGALSFLIMDILLFFGVAGLTFAQGSQIAHNITTNEMANAMRYSYLR  500

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMAS  444
            G GGRFRNPYDHG  +NCSDFLING+NED E  E       +G IQM S
Sbjct  501  GPGGRFRNPYDHGVHQNCSDFLINGFNEDREYIERLASSSEVGGIQMGS  549



>ref|XP_011626400.1| PREDICTED: protein S-acyltransferase 24 [Amborella trichopoda]
Length=636

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFGAW+N+A T H GA+ FL+ D  LF GV  LT  Q SQI+ NITTNEMANA+RY+YLR
Sbjct  443  SFGAWMNYAATHHSGALSFLIMDILLFFGVAGLTFAQGSQIAHNITTNEMANAMRYSYLR  502

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMAS  444
            G GGRFRNPYDHG  +NCSDFLING+NED E  E       +G IQM S
Sbjct  503  GPGGRFRNPYDHGVHQNCSDFLINGFNEDREYIERLASSSEVGGIQMGS  551



>ref|XP_010050291.1| PREDICTED: protein S-acyltransferase 24-like [Eucalyptus grandis]
Length=155

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL HA + H GA+ FL+A+FFLF GV  LT  QA QISRNITTNE  N+ RY+YL
Sbjct  38   ASFGAWLKHAWSHHTGAMSFLIAEFFLFLGVAALTALQAYQISRNITTNERENSSRYSYL  97

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQ  432
            R  GGRFRNPYD G +KNC+DF + GY+ED+    +  + EGIGM  MA  + Q
Sbjct  98   RDPGGRFRNPYDRGFRKNCADFFLKGYDEDVGHIGDWTDSEGIGMTVMARRSDQ  151



>ref|XP_010050341.1| PREDICTED: protein S-acyltransferase 24 [Eucalyptus grandis]
Length=559

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL HA + H GA+ FL+A+FFLF GV  LT  QA QISRNITTNE  N+LRY+YL
Sbjct  442  ASFGAWLKHAWSHHTGAMSFLIAEFFLFLGVAALTALQAYQISRNITTNERENSLRYSYL  501

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQ  432
            R  GGRFRNPYD G +KNC++F ++GY+ED+E   +  + EGIGM  MA  + Q
Sbjct  502  RDLGGRFRNPYDRGFRKNCAEFFLSGYDEDVEHIGDWTDSEGIGMTVMARRSDQ  555



>gb|KCW79060.1| hypothetical protein EUGRSUZ_C00485 [Eucalyptus grandis]
Length=548

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL HA + H GA+ FL+A+FFLF GV  LT  QA QISRNITTNE  N+LRY+YL
Sbjct  431  ASFGAWLKHAWSHHTGAMSFLIAEFFLFLGVAALTALQAYQISRNITTNERENSLRYSYL  490

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQ  432
            R  GGRFRNPYD G +KNC++F ++GY+ED+E   +  + EGIGM  MA  + Q
Sbjct  491  RDLGGRFRNPYDRGFRKNCAEFFLSGYDEDVEHIGDWTDSEGIGMTVMARRSDQ  544



>ref|XP_010042866.1| PREDICTED: probable protein S-acyltransferase 23 [Eucalyptus 
grandis]
Length=127

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+++   QH G  +FLL D  +   VT LT  QASQI+RNITTNE+ANA+RY YLRG  
Sbjct  29   SWIHYVMVQHPGIAVFLLLDGIVLIAVTTLTTAQASQIARNITTNELANAIRYGYLRGPD  88

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HGC+KNC+DFLI+GY +D E +  S
Sbjct  89   GRFHNPYNHGCRKNCADFLIHGYTDDNEIAWPS  121



>gb|AFK40586.1| unknown [Lotus japonicus]
Length=144

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 93/144 (65%), Gaps = 12/144 (8%)
 Frame = -1

Query  623  MANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV-EGIGMIQMA  447
            MAN +RY+YLRG GGRFRNPYDHG KKNCSDFLINGYNED+E  EE G+  EG+GM+ M 
Sbjct  1    MANVMRYSYLRGPGGRFRNPYDHGIKKNCSDFLINGYNEDVEVVEELGQSEEGVGMMHMT  60

Query  446  -SSALQNGACHSQQTN----GNDHVVInvnknttsshhnhvhsshcnhhn------sskn  300
             +S L NG  HS   +    GN H +INVN N ++S  +H H +   H +        K 
Sbjct  61   RNSNLANGDSHSHSEHATGTGNGHHIINVNSNNSNSKTHHGHVNGHVHSSNCSHANQGKT  120

Query  299  kTESVPLGLGSGLGRNAGRTAVVS  228
            + +S P+GLG GLGRN+   A  S
Sbjct  121  RNDSTPVGLGLGLGRNSRSVAPSS  144



>ref|XP_010939302.1| PREDICTED: probable protein S-acyltransferase 23 [Elaeis guineensis]
Length=542

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H  T+H GA+ FL+ D F+ SG   LTV QA+QI+RN+TTNE+ANA RY YLRG  G
Sbjct  452  WIHHMVTEHPGAVTFLVLDVFVLSGAFTLTVAQATQIARNVTTNELANAYRYWYLRGPDG  511

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HGC+KNC+DFLI+GYN D
Sbjct  512  RFRNPYNHGCRKNCTDFLIHGYNND  536



>ref|XP_001764782.1| predicted protein [Physcomitrella patens]
 gb|EDQ70481.1| predicted protein, partial [Physcomitrella patens]
Length=228

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = -1

Query  764  GAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGA  585
            G +L H    H GA++FL+ D FL  G  +LT  QA QI+RNITTNEMAN+LRY YL+G+
Sbjct  140  GKFLRHVALYHSGALVFLIGDIFLLLGTGMLTGMQAMQIARNITTNEMANSLRYAYLKGS  199

Query  584  GGRFRNPYDHGCKKNCSDFLINGYNEDIE  498
             GRFRNPYD GC+KNC DFL+NGYNEDIE
Sbjct  200  DGRFRNPYDSGCRKNCVDFLLNGYNEDIE  228



>ref|XP_002969220.1| hypothetical protein SELMODRAFT_35692, partial [Selaginella moellendorffii]
 gb|EFJ29308.1| hypothetical protein SELMODRAFT_35692, partial [Selaginella moellendorffii]
Length=235

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+ G WL H  + H+GA+ F+LADFFLF GV + T  QA+QI+RNITTNEMANA RY YL
Sbjct  140  STPGDWLRHVASHHVGALSFVLADFFLFFGVAIFTGIQAAQIARNITTNEMANAARYVYL  199

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIE  498
            RG  G F NPYDHG  KNCS+FL+ GYNEDIE
Sbjct  200  RGPDGLFFNPYDHGFWKNCSNFLLLGYNEDIE  231



>ref|XP_008790390.1| PREDICTED: probable protein S-acyltransferase 23 [Phoenix dactylifera]
Length=546

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H  T H GA+ FL+ D FL SG  VLTV QASQI+RNITTNE+ANA RY+YLRG  G
Sbjct  449  WIHHMLTDHPGAVAFLVLDIFLLSGAFVLTVAQASQIARNITTNELANAARYSYLRGPEG  508

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RFRNPY+HG +KNC+DFLI+GY  D E +  S
Sbjct  509  RFRNPYNHGFRKNCTDFLIHGYISDDEIAWPS  540



>ref|XP_001771908.1| predicted protein [Physcomitrella patens]
 gb|EDQ63337.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -1

Query  764  GAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGA  585
            G +L H    H  A++FL+ D FL  GV  LT  QA QI+RNITTNEMAN+LRY YL+ A
Sbjct  263  GKFLQHVALYHSSALVFLIGDVFLLLGVGTLTGMQAVQIARNITTNEMANSLRYTYLKDA  322

Query  584  GGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVEGIGMIQMASSALQNG  426
             GRFRNPYD GC+KNC DF + GYNEDIE   E     G G+IQM   ++  G
Sbjct  323  EGRFRNPYDSGCRKNCVDFFLTGYNEDIEVPWEPIRQHG-GVIQMGDRSVAAG  374



>ref|XP_010029900.1| PREDICTED: probable protein S-acyltransferase 23 [Eucalyptus 
grandis]
 gb|KCW56855.1| hypothetical protein EUGRSUZ_I02519 [Eucalyptus grandis]
Length=546

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+++   QH G  +FLL D  +   VT LT  QASQI+RNITTNE+ANA+RY YLRG  
Sbjct  448  SWIHYVMVQHPGIAVFLLLDGIVLIAVTTLTTAQASQIARNITTNELANAIRYGYLRGPD  507

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HGC+KNC+DFLI+GY +D E +  S
Sbjct  508  GRFHNPYNHGCRKNCADFLIHGYTDDNEIAWPS  540



>ref|XP_002518303.1| Palmitoyltransferase TIP1, putative [Ricinus communis]
 gb|EEF44063.1| Palmitoyltransferase TIP1, putative [Ricinus communis]
Length=545

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   QH GA+ FL  D  +F   T LT+ QASQI+RNITTNE+ANA RY YLRG  G
Sbjct  448  WVHYLVVQHPGAVAFLFFDVIIFMAATTLTIAQASQIARNITTNELANAARYGYLRGPDG  507

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNCSDF+I GY +D E +
Sbjct  508  RFRNPYNHGCRKNCSDFIIQGYTDDDEIA  536



>ref|XP_002960582.1| hypothetical protein SELMODRAFT_140081 [Selaginella moellendorffii]
 gb|EFJ38121.1| hypothetical protein SELMODRAFT_140081 [Selaginella moellendorffii]
Length=444

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            S+ G WL H  + H+GA+ F+LADFFLF GV + T  QA+QI+RNITTNEMANA RY YL
Sbjct  261  STPGDWLRHVASHHVGALSFVLADFFLFFGVAIFTGIQAAQIARNITTNEMANAARYVYL  320

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGE  477
            RG  G F NPYDHG  KNCS+FL+ GYNEDIE + +  E
Sbjct  321  RGPDGLFFNPYDHGFWKNCSNFLLLGYNEDIEQAWQQNE  359



>ref|XP_010268638.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Nelumbo 
nucifera]
Length=534

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   QH G ++FL  D  +  G T LT++QASQI++NITTNE+ANA RY YL+G  G
Sbjct  437  WIHHLAVQHPGVLVFLFMDTIILIGATALTISQASQIAQNITTNELANARRYGYLQGPDG  496

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RFRNPY+HGC+KNC+DFLI+GY +D E +  +
Sbjct  497  RFRNPYNHGCRKNCTDFLIHGYIDDNEIAWPT  528



>ref|XP_010268637.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Nelumbo 
nucifera]
Length=546

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   QH G ++FL  D  +  G T LT++QASQI++NITTNE+ANA RY YL+G  G
Sbjct  449  WIHHLAVQHPGVLVFLFMDTIILIGATALTISQASQIAQNITTNELANARRYGYLQGPDG  508

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RFRNPY+HGC+KNC+DFLI+GY +D E +  +
Sbjct  509  RFRNPYNHGCRKNCTDFLIHGYIDDNEIAWPT  540



>ref|XP_008237079.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Prunus 
mume]
Length=537

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   QH   + FL  D  +    T LTV QA+QI+RNITTNE+ANA+RY YLRG  G
Sbjct  440  WIHHVVVQHPSVVAFLFLDVIILVAATTLTVAQATQIARNITTNELANAIRYGYLRGPDG  499

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DFLI G+ +D E +
Sbjct  500  RFRNPYNHGCRKNCADFLIQGHTDDDEIA  528



>ref|XP_008237078.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Prunus 
mume]
Length=540

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   QH   + FL  D  +    T LTV QA+QI+RNITTNE+ANA+RY YLRG  G
Sbjct  443  WIHHVVVQHPSVVAFLFLDVIILVAATTLTVAQATQIARNITTNELANAIRYGYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DFLI G+ +D E +
Sbjct  503  RFRNPYNHGCRKNCADFLIQGHTDDDEIA  531



>ref|XP_009394300.1| PREDICTED: probable protein S-acyltransferase 23 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++    +H GAI+FL  D  L SGV  L V QASQI+RNITTNEMANA RY+YLRG  G
Sbjct  452  WIHLVVVEHPGAILFLGMDAILLSGVLTLAVVQASQIARNITTNEMANAARYSYLRGPDG  511

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RFRNPY+HGC+KNC+DF I+GY  D E +  S
Sbjct  512  RFRNPYNHGCRKNCTDFFIHGYINDDEVAWPS  543



>ref|XP_007199780.1| hypothetical protein PRUPE_ppa003909mg [Prunus persica]
 gb|EMJ00979.1| hypothetical protein PRUPE_ppa003909mg [Prunus persica]
Length=540

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   QH   + FL  D  +    T LTV QA+QI+RNITTNE+ANA+RY YLRG  G
Sbjct  443  WIHHLVVQHPSVVAFLFLDVIILVAATTLTVAQATQIARNITTNELANAIRYGYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DFLI G+ +D E +
Sbjct  503  RFRNPYNHGCRKNCADFLIQGHTDDDEIA  531



>ref|XP_007041468.1| Palmitoyltransferase TIP1, putative isoform 1 [Theobroma cacao]
 gb|EOX97299.1| Palmitoyltransferase TIP1, putative isoform 1 [Theobroma cacao]
Length=537

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H    H G ++FL+ D  +    T LT  QASQI+RNITTNE++NA+RY YLRG  G
Sbjct  441  WIHHVIIHHPGIVVFLILDAIVLIAATTLTTVQASQIARNITTNELSNAIRYGYLRGPDG  500

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HGC+KNC+DFLI GY +D
Sbjct  501  RFRNPYNHGCRKNCTDFLIRGYTDD  525



>gb|ADN34259.1| palmitoyltransferase TIP1 [Cucumis melo subsp. melo]
Length=380

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W +H    + G I FL  D  +F   T LTV QASQ++RNITTNE++NA+RY YLRG  G
Sbjct  284  WFHHVVVHYPGIITFLFLDAIIFIAATTLTVAQASQVARNITTNELSNAIRYGYLRGPDG  343

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            +FRNPY+HGC+KNCSDFLI GY +D
Sbjct  344  KFRNPYNHGCRKNCSDFLIQGYTDD  368



>emb|CDO97340.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H   +H G + FL+ D  +      L + Q SQISRNITTNEMANA+RY YLRG  G
Sbjct  443  WIHHVIFEHPGVVAFLIMDGSILLAAATLLIVQVSQISRNITTNEMANAMRYGYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNCSDF+I GY +D E +
Sbjct  503  RFRNPYNHGCRKNCSDFVIRGYTDDNEIA  531



>ref|XP_011658843.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Cucumis 
sativus]
Length=381

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W +HA   + G I FL  D  +F   T LTV QASQI+RNITTNE++NA+RY YLRG  G
Sbjct  285  WFHHAVVHYPGIITFLFLDAIIFIAATTLTVAQASQIARNITTNELSNAIRYGYLRGPDG  344

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            +FRNPY+HGC+KNCSDFLI G+ +D
Sbjct  345  KFRNPYNHGCRKNCSDFLIQGHTDD  369



>ref|XP_009769043.1| PREDICTED: probable protein S-acyltransferase 23 [Nicotiana sylvestris]
Length=542

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +WL+H    + G I FL  D  +      L V Q SQI+RNITTNEMANA+RY YLRG  
Sbjct  444  SWLHHVVFAYPGVITFLFMDGVILIAAVTLCVVQISQIARNITTNEMANAIRYGYLRGPD  503

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNCSDFLINGY  D E +
Sbjct  504  GRFRNPYNHGCRKNCSDFLINGYTNDDEIA  533



>ref|XP_010936252.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Elaeis 
guineensis]
Length=551

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            AW++H  T+H GA+ FL+ D FL  G   LTV QASQI+RNITTNE+ANA RY+YLRG  
Sbjct  453  AWIHHMLTEHPGAVTFLVLDIFLLFGAFALTVAQASQIARNITTNELANAARYSYLRGPE  512

Query  581  GRFRNPYDHGCKKNCSDFLINGYNED  504
            GRFRNPY+HG +KNC+DFLI+GY  D
Sbjct  513  GRFRNPYNHGFRKNCTDFLIHGYIND  538



>ref|XP_008455110.1| PREDICTED: probable protein S-acyltransferase 23 [Cucumis melo]
Length=538

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W +H    + G I FL  D  +F   T LTV QASQ++RNITTNE++NA+RY YLRG  G
Sbjct  442  WFHHVVVHYPGIITFLFLDAIIFIAATTLTVAQASQVARNITTNELSNAIRYGYLRGPDG  501

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            +FRNPY+HGC+KNCSDFLI GY +D
Sbjct  502  KFRNPYNHGCRKNCSDFLIQGYTDD  526



>ref|XP_010936253.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Elaeis 
guineensis]
Length=547

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            AW++H  T+H GA+ FL+ D FL  G   LTV QASQI+RNITTNE+ANA RY+YLRG  
Sbjct  449  AWIHHMLTEHPGAVTFLVLDIFLLFGAFALTVAQASQIARNITTNELANAARYSYLRGPE  508

Query  581  GRFRNPYDHGCKKNCSDFLINGYNED  504
            GRFRNPY+HG +KNC+DFLI+GY  D
Sbjct  509  GRFRNPYNHGFRKNCTDFLIHGYIND  534



>ref|XP_004136905.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Cucumis 
sativus]
 gb|KGN43792.1| hypothetical protein Csa_7G067470 [Cucumis sativus]
Length=539

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W +HA   + G I FL  D  +F   T LTV QASQI+RNITTNE++NA+RY YLRG  G
Sbjct  443  WFHHAVVHYPGIITFLFLDAIIFIAATTLTVAQASQIARNITTNELSNAIRYGYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            +FRNPY+HGC+KNCSDFLI G+ +D
Sbjct  503  KFRNPYNHGCRKNCSDFLIQGHTDD  527



>gb|EPS74107.1| hypothetical protein M569_00641, partial [Genlisea aurea]
Length=543

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -1

Query  770  SFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLR  591
            SFG WL HAG++H GA+ F+ AD FL  GV VLT  QASQI RN+TTNEMAN +RY+YLR
Sbjct  449  SFGEWLKHAGSEHTGALAFIAADLFLLGGVGVLTCVQASQIGRNMTTNEMANLMRYSYLR  508

Query  590  GAGGRFRNPYDHGCKKNCSDFLINGYNED  504
            G  GRF NPYD G  KNC +FLI G + D
Sbjct  509  GGDGRFHNPYDKGWGKNCWEFLIKGESGD  537



>ref|XP_010691489.1| PREDICTED: probable protein S-acyltransferase 23 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=471

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            AW++H    H G I+FL+ DF +F   T L V+QASQI+RNITTNE+AN  RY YLRG  
Sbjct  373  AWMHHVIAHHPGVIVFLVMDFLIFVSATTLAVSQASQIARNITTNELANTSRYTYLRGPD  432

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            G+FRNPY+HGC+KNC DFLI GY  D E +   
Sbjct  433  GQFRNPYNHGCRKNCGDFLIQGYTNDDEIAWPP  465



>ref|XP_009609761.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Nicotiana 
tomentosiformis]
Length=542

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +WL+H    +   I FL  D  +      L V Q SQI+RNITTNEMANA+RY YLRG  
Sbjct  444  SWLHHVVFAYPSIIAFLFMDGVILIAAVTLCVVQISQIARNITTNEMANAIRYGYLRGPD  503

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNCSDFLINGY  D E +
Sbjct  504  GRFRNPYNHGCRKNCSDFLINGYTNDDEIA  533



>ref|XP_006361977.1| PREDICTED: probable protein S-acyltransferase 23-like isoform 
X1 [Solanum tuberosum]
Length=542

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +WL+H    + G I FL  D  +      L V Q SQI+RN+TTNEMANA+RY YLRG  
Sbjct  444  SWLHHVFFAYPGVIAFLFMDGAILIASVTLCVIQISQIARNLTTNEMANAVRYGYLRGPD  503

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNCSDFLINGY  D E +
Sbjct  504  GRFRNPYNHGCRKNCSDFLINGYTNDDEIA  533



>ref|XP_010092531.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB51440.1| putative S-acyltransferase [Morus notabilis]
Length=540

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++    H G + FLL D  +F  VT LT  QASQI+RNITTNE+ANA+RY YLRG  G
Sbjct  443  WIHYVIVNHPGIVAFLLGDIIVFIVVTTLTTAQASQIARNITTNELANAVRYGYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC DF+I GY +D E +
Sbjct  503  RFRNPYNHGCRKNCVDFVIRGYTDDEEIA  531



>ref|XP_006852720.1| PREDICTED: probable protein S-acyltransferase 23 [Amborella trichopoda]
 gb|ERN14187.1| hypothetical protein AMTR_s00033p00059780 [Amborella trichopoda]
Length=547

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  737  QHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYD  558
            +H GA  FL  D  +  G T +T+ QASQI+RNITTNE+ANA RY YLRG  GRFRNPY+
Sbjct  458  RHPGAAAFLAMDILVLLGATTMTIAQASQIARNITTNELANASRYAYLRGPDGRFRNPYN  517

Query  557  HGCKKNCSDFLINGYNED  504
            HGC KNC+DFLI+GYN+D
Sbjct  518  HGCWKNCTDFLIHGYNDD  535



>ref|XP_004230654.1| PREDICTED: probable protein S-acyltransferase 23 [Solanum lycopersicum]
Length=542

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +WL+H    + G I FL  D  +      L V Q SQI+RN+TTNEMANA+RY YLRG  
Sbjct  444  SWLHHVFFAYPGIIAFLFMDGVILIASVTLCVIQISQIARNLTTNEMANAVRYGYLRGPD  503

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNCSDFLINGY  D E +
Sbjct  504  GRFRNPYNHGCRKNCSDFLINGYTNDDEIA  533



>ref|XP_009366346.1| PREDICTED: probable protein S-acyltransferase 23 [Pyrus x bretschneideri]
Length=539

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+     Q+   + FL  D  +   VT LT+ QA+QI+RNITTNE+ANA+RY YLRG  
Sbjct  442  SWIRRVVVQYPSIVAFLFVDIIILIAVTTLTMAQATQIARNITTNELANAIRYGYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNED  504
            GRFRNPY+HGC+KNCSDFLI G+ +D
Sbjct  502  GRFRNPYNHGCRKNCSDFLIQGHTDD  527



>ref|XP_009379579.1| PREDICTED: probable protein S-acyltransferase 23 [Pyrus x bretschneideri]
Length=539

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+     Q+   + FL  D  +   VT LT+ QA+QI+RNITTNE+ANA+RY YLRG  
Sbjct  442  SWIRRVVVQYPSIVAFLFVDVIILIAVTTLTMAQATQIARNITTNELANAIRYGYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNED  504
            GRFRNPY+HGC+KNCSDFLI G+ +D
Sbjct  502  GRFRNPYNHGCRKNCSDFLIQGHTDD  527



>ref|XP_010691487.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=549

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            AW++H    H G I+FL+ DF +F   T L V+QASQI+RNITTNE+AN  RY YLRG  
Sbjct  451  AWMHHVIAHHPGVIVFLVMDFLIFVSATTLAVSQASQIARNITTNELANTSRYTYLRGPD  510

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIE  498
            G+FRNPY+HGC+KNC DFLI GY  D E
Sbjct  511  GQFRNPYNHGCRKNCGDFLIQGYTNDDE  538



>ref|XP_010691488.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=545

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            AW++H    H G I+FL+ DF +F   T L V+QASQI+RNITTNE+AN  RY YLRG  
Sbjct  447  AWMHHVIAHHPGVIVFLVMDFLIFVSATTLAVSQASQIARNITTNELANTSRYTYLRGPD  506

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIE  498
            G+FRNPY+HGC+KNC DFLI GY  D E
Sbjct  507  GQFRNPYNHGCRKNCGDFLIQGYTNDDE  534



>gb|KEH44378.1| DHHC-type zinc finger protein [Medicago truncatula]
Length=634

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  674  LTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIEC  495
            LTV QAS IS N+TTNEM N  RY+YL+G  GRFRNPYDHG KKNCSDFLINGYNED+E 
Sbjct  561  LTVEQASNISSNLTTNEMINHERYSYLKGPDGRFRNPYDHGIKKNCSDFLINGYNEDLEY  620

Query  494  SEES  483
             EE+
Sbjct  621  VEET  624



>ref|XP_003529272.1| PREDICTED: probable protein S-acyltransferase 23-like isoform 
X1 [Glycine max]
Length=540

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++A  +H G ++FL+ D  +F   T LT+TQAS I+RN+TTNE+AN+ RY+YLRG  G
Sbjct  443  WIHYALVKHPGLVVFLVMDAVVFFAATTLTLTQASMIARNVTTNELANSSRYDYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC KNC+DFL  GY  D E +
Sbjct  503  RFRNPYNHGCWKNCADFLFLGYTNDDEIA  531



>ref|XP_006583781.1| PREDICTED: probable protein S-acyltransferase 23-like isoform 
X2 [Glycine max]
Length=546

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++A  +H G ++FL+ D  +F   T LT+TQAS I+RN+TTNE+AN+ RY+YLRG  G
Sbjct  449  WIHYALVKHPGLVVFLVMDAVVFFAATTLTLTQASMIARNVTTNELANSSRYDYLRGPDG  508

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC KNC+DFL  GY  D E +
Sbjct  509  RFRNPYNHGCWKNCADFLFLGYTNDDEIA  537



>tpg|DAA42114.1| TPA: hypothetical protein ZEAMMB73_763279 [Zea mays]
Length=167

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W++   T+H GA++F+  D FL +G  +LT  QA QI+RNITTNE AN  RY YL
Sbjct  65   SSSESWIHFMVTKHPGAVLFMFLDVFLLTGALILTGAQAVQIARNITTNEAANRSRYTYL  124

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFLI+GY+ D E +  +
Sbjct  125  RGPDGRFRNPYSRGCQRNCTDFLISGYSNDEEVAWPT  161



>ref|XP_003531002.1| PREDICTED: probable protein S-acyltransferase 23-like [Glycine 
max]
Length=541

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   +H+G ++FL+ D  +F   T LT+TQAS I+RN+TTNE+AN+ RY+YLRG  G
Sbjct  444  WIHYVLVRHLGLVVFLVMDAVVFVATTTLTITQASMIARNVTTNELANSSRYDYLRGPDG  503

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIE  498
            RFRNPY+HGC KNC+DF   GY  D E
Sbjct  504  RFRNPYNHGCWKNCADFFFLGYTNDDE  530



>gb|KHN46224.1| Putative S-acyltransferase [Glycine soja]
Length=541

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   +H+G ++FL+ D  +F   T LT+TQAS I+RN+TTNE+AN+ RY+YLRG  G
Sbjct  444  WIHYVLVRHLGLVVFLVMDAVVFVATTTLTITQASMIARNVTTNELANSSRYDYLRGPDG  503

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIE  498
            RFRNPY+HGC KNC+DF   GY  D E
Sbjct  504  RFRNPYNHGCWKNCADFFFLGYTNDDE  530



>gb|KJB16072.1| hypothetical protein B456_002G211400 [Gossypium raimondii]
Length=544

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++     H G + FLL D  + +  T LT+ QA+QI+RNITTNE++NA+RY YL G  G
Sbjct  448  WIHLVIDHHPGIVAFLLLDALVLTSATTLTIIQATQIARNITTNEVSNAIRYRYLHGPEG  507

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HGC+KNC+DF I GY +D
Sbjct  508  RFRNPYNHGCRKNCTDFFIRGYTDD  532



>ref|XP_012074546.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Jatropha 
curcas]
Length=542

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   QH+G + FL+ D  +F   T LT  QASQI+RNITTNE+ANA+RY YLRG  G
Sbjct  445  WMHYVVVQHLGVVAFLVLDMIIFVAATTLTTAQASQIARNITTNELANAIRYGYLRGPDG  504

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DF+I GY +D E +
Sbjct  505  RFRNPYNHGCRKNCADFIIQGYTDDDEIA  533



>gb|ACS32303.1| palmitoyl transferase [Jatropha curcas]
Length=543

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   QH+G + FL+ D  +F   T LT  QASQI+RNITTNE+ANA+RY YLRG  G
Sbjct  446  WMHYVVVQHLGVVAFLVLDMIIFVAATTLTTAQASQIARNITTNELANAIRYGYLRGPDG  505

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DF+I GY +D E +
Sbjct  506  RFRNPYNHGCRKNCADFIIQGYTDDDEIA  534



>ref|XP_012074545.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Jatropha 
curcas]
 gb|KDP35920.1| hypothetical protein JCGZ_09892 [Jatropha curcas]
Length=543

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+++   QH+G + FL+ D  +F   T LT  QASQI+RNITTNE+ANA+RY YLRG  G
Sbjct  446  WMHYVVVQHLGVVAFLVLDMIIFVAATTLTTAQASQIARNITTNELANAIRYGYLRGPDG  505

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DF+I GY +D E +
Sbjct  506  RFRNPYNHGCRKNCADFIIQGYTDDDEIA  534



>ref|XP_010527025.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Tarenaya 
hassleriana]
Length=484

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W++H   +H G I+FL  D  +F   T LT+ Q  Q++RNITTNEM+N  RY+YLRG  
Sbjct  389  SWIHHIAFKHPGVIVFLFFDSVIFMAATTLTILQTYQVARNITTNEMSNKRRYSYLRGQD  448

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV  474
            GRF NPY+HGC++NCSDF ++GY  D E +    ++
Sbjct  449  GRFHNPYNHGCRRNCSDFFVHGYTMDDEVARSPTQL  484



>ref|XP_007159187.1| hypothetical protein PHAVU_002G216500g [Phaseolus vulgaris]
 gb|ESW31181.1| hypothetical protein PHAVU_002G216500g [Phaseolus vulgaris]
Length=540

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+ +   +H G ++FL+ D  +F   T LT+TQ S I+RN+TTNE+AN+ RY+YLRG  G
Sbjct  443  WIQYVVVRHPGLVVFLVMDAVVFIAATTLTITQISMIARNVTTNELANSSRYDYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC+KNC+DFL  GY  D E +
Sbjct  503  RFRNPYNHGCRKNCADFLSLGYTNDDEIA  531



>ref|XP_010527024.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Tarenaya 
hassleriana]
Length=538

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W++H   +H G I+FL  D  +F   T LT+ Q  Q++RNITTNEM+N  RY+YLRG  
Sbjct  443  SWIHHIAFKHPGVIVFLFFDSVIFMAATTLTILQTYQVARNITTNEMSNKRRYSYLRGQD  502

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEV  474
            GRF NPY+HGC++NCSDF ++GY  D E +    ++
Sbjct  503  GRFHNPYNHGCRRNCSDFFVHGYTMDDEVARSPTQL  538



>ref|NP_001068072.1| Os11g0549700 [Oryza sativa Japonica Group]
 dbj|BAF28435.1| Os11g0549700, partial [Oryza sativa Japonica Group]
Length=479

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W+N   + H GA++F+  D FL +G  +LT  QA+QI+RN+TTNE AN  RY YL
Sbjct  375  SSSESWINFMLSNHPGAVLFMFMDVFLLTGALILTGAQATQIARNLTTNEAANQSRYAYL  434

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFL+NGY+ D E +  +
Sbjct  435  RGPDGRFRNPYSRGCRRNCADFLVNGYSNDEEAAWPT  471



>ref|XP_008668352.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=545

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W++   T+H GA++F+  D FL +G  +LT  QA QI+RNITTNE AN  RY YL
Sbjct  443  SSSESWIHFMVTKHPGAVLFMFLDVFLLTGALILTGAQAVQIARNITTNEAANRSRYTYL  502

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFLI+GY+ D E +  +
Sbjct  503  RGPDGRFRNPYSRGCQRNCTDFLISGYSNDEEVAWPT  539



>ref|XP_006663520.1| PREDICTED: probable protein S-acyltransferase 23-like [Oryza 
brachyantha]
Length=481

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W+N     H GA++F+  D FL +G  +LT  QA QI+RN+TTNE AN  RY YL
Sbjct  377  SSSESWINFMLANHPGALLFMFLDVFLLTGALILTGAQAIQIARNVTTNEAANRSRYAYL  436

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY+ GC++NC+DFL+NGY+ D E +  +
Sbjct  437  RGPDGRFRNPYNQGCRRNCADFLVNGYSNDEEATWPT  473



>ref|XP_002270505.1| PREDICTED: probable protein S-acyltransferase 23 [Vitis vinifera]
 emb|CBI25067.3| unnamed protein product [Vitis vinifera]
Length=537

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+ +   QH G + FL+ D  L      LT  Q+SQI+RNITTNE+AN +RY YL    G
Sbjct  440  WIQYVVVQHSGVVAFLVMDIILLMASVTLTTAQSSQIARNITTNELANFIRYGYLHAPDG  499

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIE  498
            RFRNPY+HGC+KNC+DFLI GY +D E
Sbjct  500  RFRNPYNHGCRKNCADFLIYGYTDDEE  526



>gb|EAY81271.1| hypothetical protein OsI_36450 [Oryza sativa Indica Group]
Length=551

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W+N   + H GA++F+  D FL +G  +LT  QA+QI+RN+TTNE AN  RY YL
Sbjct  447  SSSESWINFMLSNHPGAVLFMFMDVFLLTGALILTGAQATQIARNLTTNEAANQSRYAYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFL+NGY+ D E +  +
Sbjct  507  RGPDGRFRNPYSRGCRRNCADFLVNGYSNDEEAAWPT  543



>gb|ABA94183.1| ankryin repeat S-palmitoyl transferase, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EEE52265.1| hypothetical protein OsJ_34225 [Oryza sativa Japonica Group]
Length=551

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W+N   + H GA++F+  D FL +G  +LT  QA+QI+RN+TTNE AN  RY YL
Sbjct  447  SSSESWINFMLSNHPGAVLFMFMDVFLLTGALILTGAQATQIARNLTTNEAANQSRYAYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFL+NGY+ D E +  +
Sbjct  507  RGPDGRFRNPYSRGCRRNCADFLVNGYSNDEEAAWPT  543



>ref|XP_006422675.1| hypothetical protein CICLE_v10028145mg [Citrus clementina]
 gb|ESR35915.1| hypothetical protein CICLE_v10028145mg [Citrus clementina]
Length=541

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  680  TVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDI  501
            T LT  QA QI+RNITTNE+AN++RY+YLRG  GRFRNPY+HGC+KNC+DF I+GY  D 
Sbjct  470  TTLTSIQAYQIARNITTNELANSVRYDYLRGPDGRFRNPYNHGCQKNCADFFIHGYTNDD  529

Query  500  ECS  492
            E +
Sbjct  530  ELA  532



>gb|KDO67953.1| hypothetical protein CISIN_1g009183mg [Citrus sinensis]
Length=541

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  680  TVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDI  501
            T LT  QA QI+RNITTNE+AN++RY+YLRG  GRFRNPY+HGC+KNC+DF I+GY  D 
Sbjct  470  TTLTSIQAYQIARNITTNELANSVRYDYLRGPDGRFRNPYNHGCQKNCADFFIHGYTNDD  529

Query  500  ECS  492
            E +
Sbjct  530  ELA  532



>gb|EYU18368.1| hypothetical protein MIMGU_mgv1a004168mg [Erythranthe guttata]
Length=541

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W +H   ++ G I FL+ D  +F   T L   QA QI+RN+TTNE+AN++RY YLRG  G
Sbjct  444  WTHHVIFEYPGVIAFLVLDAAIFFAATTLLAVQAYQIARNVTTNEVANSMRYGYLRGPDG  503

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RFRNPY+HGC KNCSDFLI+G+ +D E +
Sbjct  504  RFRNPYNHGCWKNCSDFLIHGHTDDDEIA  532



>ref|XP_007041469.1| Palmitoyltransferase TIP1, putative isoform 2 [Theobroma cacao]
 gb|EOX97300.1| Palmitoyltransferase TIP1, putative isoform 2 [Theobroma cacao]
Length=522

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H    H G I FL+ D  +    T LT  Q SQI+RNIT NE++NA+RY YLRG  G
Sbjct  442  WIHHVIVHHPGIIAFLILDAIVLIAATTLTTVQVSQIARNITANELSNAIRYGYLRGPDG  501

Query  578  RFRNPYDHGCKKNCSDFLING  516
            RF+NPY+HGC+KNC DFLI G
Sbjct  502  RFQNPYNHGCRKNCPDFLIRG  522



>gb|KHG18337.1| Palmitoyltransferase AKR1 [Gossypium arboreum]
Length=544

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++     H G + FLL D  +    T LT+ QA+QI+RNITTNE++NA+RY YL G  G
Sbjct  448  WIHLVIDHHPGIVAFLLLDALVLISATTLTIIQATQIARNITTNEVSNAIRYRYLHGPEG  507

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HGC+KNC+DF   GY +D
Sbjct  508  RFRNPYNHGCRKNCTDFFTRGYTDD  532



>ref|XP_002449668.1| hypothetical protein SORBIDRAFT_05g021380 [Sorghum bicolor]
 gb|EES08656.1| hypothetical protein SORBIDRAFT_05g021380 [Sorghum bicolor]
Length=503

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
             W+++   +H GA++F+  D FL +G  +LT  QA QI+RN+TTNE+AN  RY YLRG  
Sbjct  403  PWISNCVGKHPGAVLFMFLDVFLLTGALILTGAQAVQIARNLTTNEVANRSRYTYLRGPD  462

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRFRNPY  GC++NC+DFLINGY+ D E +  +
Sbjct  463  GRFRNPYSRGCQRNCTDFLINGYSNDEEIAWPT  495



>ref|XP_004504881.1| PREDICTED: probable S-acyltransferase At2g14255-like [Cicer arietinum]
Length=538

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++     H G + FL+ D  +    T LTVTQ S I+RN+TTNE+AN+ RY YLRG  G
Sbjct  441  WIHQVLVNHPGLVAFLVMDAVVVIAATTLTVTQISMIARNVTTNELANSTRYEYLRGPDG  500

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HGC KNC+DF+  G+ +D
Sbjct  501  RFRNPYNHGCWKNCADFVFLGHTDD  525



>ref|XP_007041462.1| Palmitoyltransferase TIP1, putative [Theobroma cacao]
 gb|EOX97293.1| Palmitoyltransferase TIP1, putative [Theobroma cacao]
Length=510

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++H    H G I FL+ D  +    T LT  Q SQI+RNIT NE++NA+RY YLRG  G
Sbjct  430  WIHHVIVHHPGIIAFLILDAIVLIAATTLTTVQVSQIARNITANELSNAIRYGYLRGPDG  489

Query  578  RFRNPYDHGCKKNCSDFLING  516
            RF+NPY+HGC+KNC DFLI G
Sbjct  490  RFQNPYNHGCRKNCPDFLIRG  510



>gb|KEH44377.1| translation initiation factor IF-3 [Medicago truncatula]
Length=949

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 10/91 (11%)
 Frame = -1

Query  668  VTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSE  489
            + QAS IS N+TTNEM N  RY+YL+G  GRFRNPYDHG KKNCSDFLINGYNED+E   
Sbjct  423  LMQASNISSNLTTNEMINHERYSYLKGPDGRFRNPYDHGIKKNCSDFLINGYNEDLE---  479

Query  488  ESGEVEGIGMIQMASSALQNGACHSQQTNGN  396
                   IG  ++ ++  Q   C++  ++ +
Sbjct  480  -------IGNSKLKAACFQFRRCYTHLSHAS  503



>ref|XP_011088009.1| PREDICTED: probable protein S-acyltransferase 23 [Sesamum indicum]
Length=541

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -1

Query  665  TQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
             QA+QI+RNITTNE+ANA+RY YLRG  GRFRNPY+HGC KNCSDFL++GY  D E +
Sbjct  475  VQATQIARNITTNEVANAIRYGYLRGPDGRFRNPYNHGCWKNCSDFLVHGYTNDDEIA  532



>ref|XP_011030252.1| PREDICTED: probable protein S-acyltransferase 23 [Populus euphratica]
Length=540

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ +    H G + FL+ D  +F   T LT  QASQI+RNITTNE+ANA+RY YLRG  
Sbjct  442  SWIRYVVVHHPGVVAFLVLDVIVFIAATTLTTAQASQIARNITTNELANAIRYGYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNC+DFL+ GY +D E +
Sbjct  502  GRFRNPYNHGCRKNCADFLVQGYTDDNEIA  531



>ref|XP_002300301.2| hypothetical protein POPTR_0001s29380g [Populus trichocarpa]
 gb|EEE85106.2| hypothetical protein POPTR_0001s29380g [Populus trichocarpa]
Length=540

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ +    H G + FL+ D  +F   T LT  QASQI+RNITTNE+ANA+RY YLRG  
Sbjct  442  SWIRYVVVHHPGVVAFLVLDVIVFIAATTLTTAQASQIARNITTNELANAIRYGYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            GRFRNPY+HGC+KNC+DFL+ GY +D E +
Sbjct  502  GRFRNPYNHGCRKNCADFLVQGYTDDNEIA  531



>ref|XP_009112234.1| PREDICTED: probable protein S-acyltransferase 23 [Brassica rapa]
Length=539

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H GA +FL  D  +F     LT++QA  I+RNITTNE+ N  R++YLRG  
Sbjct  445  SWIQHVLIEHPGAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNTRRFSYLRGPD  504

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NCSDFL+NGY  D E    S
Sbjct  505  GRFYNPYNHGWRRNCSDFLVNGYTRDDEVVPSS  537



>gb|EMS48259.1| hypothetical protein TRIUR3_25112 [Triticum urartu]
Length=268

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W +   T+H GA++F+  D FL +G  +L V QA  I+RN+TTNE AN  RY YL
Sbjct  167  SSSESWTHFMVTKHPGAVLFMFMDIFLLTGALILMVAQAVMIARNLTTNEAANQSRYTYL  226

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            RG  GRFRNPY+ G +KNC  FL+NGYN D E +
Sbjct  227  RGPDGRFRNPYNQGWQKNCVYFLVNGYNNDEEAA  260



>ref|XP_010547926.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010547927.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Tarenaya 
hassleriana]
Length=546

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W+ H   +H   ++FL  D  +F   T+L ++Q  Q++RNITTNEM+N+ RY YLRG  G
Sbjct  446  WIRHVAFEHPSVVLFLFFDLVIFIASTMLMISQTYQVARNITTNEMSNSKRYTYLRGPDG  505

Query  578  RFRNPYDHGCKKNCSDFLINGYNEDIE  498
            RF NPY+HG ++NCSDF INGY  D E
Sbjct  506  RFNNPYNHGWRRNCSDFFINGYTTDDE  532



>ref|XP_010237656.1| PREDICTED: probable protein S-acyltransferase 23 [Brachypodium 
distachyon]
Length=561

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W +   T+H GA++F+  D FL +G  +L   QA+QI+RN+TTNE AN  RY+YL
Sbjct  457  SSSESWTHFMVTKHPGAVLFMFMDIFLLTGALILAGAQATQIARNLTTNEAANQSRYSYL  516

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY+ GC++NC+ FL+NGY+ D E +  +
Sbjct  517  RGPDGRFRNPYNQGCRRNCAYFLVNGYSNDEEAAWPT  553



>ref|XP_010517465.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Camelina 
sativa]
Length=536

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT+TQA  I+RNITTNE+ NA R++YLRG  
Sbjct  442  SWIQHIVIEHYDAAVFLFFDLLIFIATMTLTITQAYMITRNITTNELWNAKRFSYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E +  S
Sbjct  502  GRFYNPYNHGWRRNCTDFLVHGYTRDDEVAPSS  534



>ref|XP_010517459.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Camelina 
sativa]
Length=549

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT+TQA  I+RNITTNE+ NA R++YLRG  
Sbjct  455  SWIQHIVIEHYDAAVFLFFDLLIFIATMTLTITQAYMITRNITTNELWNAKRFSYLRGPD  514

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E +  S
Sbjct  515  GRFYNPYNHGWRRNCTDFLVHGYTRDDEVAPSS  547



>ref|XP_004979451.1| PREDICTED: probable S-acyltransferase At2g14255-like isoform 
X1 [Setaria italica]
Length=551

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SS  +W +   T H GA++F+  D FL +G  +LT  QA QI+ NITTNE AN  RY YL
Sbjct  447  SSSESWTHFMVTNHPGAVLFMFLDVFLLTGALILTGAQAVQIAWNITTNEQANKSRYAYL  506

Query  593  RGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            RG  GRFRNPY  GC++NC+DFL+NGY  D E +  +
Sbjct  507  RGPDGRFRNPYSRGCQRNCTDFLVNGYTNDEEIAWPT  543



>gb|KFK39958.1| hypothetical protein AALP_AA3G311600 [Arabis alpina]
Length=533

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ +   +H GA +F+  D  +F     LT++QA QISRNITTNE+ NA R+ YL+G  
Sbjct  439  SWIQYVVIEHPGAAVFMFFDSLVFIATMTLTISQAYQISRNITTNELWNAKRFKYLQGPD  498

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL+ GY  D E    S
Sbjct  499  GRFYNPYNHGWRRNCTDFLVQGYTRDDEVVPSS  531



>ref|XP_006409659.1| hypothetical protein EUTSA_v10022988mg [Eutrema salsugineum]
 gb|ESQ51112.1| hypothetical protein EUTSA_v10022988mg [Eutrema salsugineum]
Length=536

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H GA +FL  D  +F     LT++QA  I+RNITTNE+ N+ R++YLRG  
Sbjct  442  SWIQHVVIEHPGAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNSKRFSYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E    S
Sbjct  502  GRFYNPYNHGWRRNCTDFLVHGYTRDDEFVPSS  534



>emb|CDY37217.1| BnaA09g08380D [Brassica napus]
Length=336

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -1

Query  755  LNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGGR  576
            + H   +H GA +FL  D  +F     LT++QA  I+RNITTNE+ N  R++YLRG  GR
Sbjct  244  IQHVLIEHPGAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNTRRFSYLRGPDGR  303

Query  575  FRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            F NPY+HG ++NCSDFL+NGY  D E    S
Sbjct  304  FYNPYNHGWQRNCSDFLVNGYTRDDEVVPSS  334



>emb|CDX81456.1| BnaC09g08670D [Brassica napus]
Length=527

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -1

Query  755  LNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGGR  576
            + H   +H GA +FL  D  +F     LT++QA  I+RNITTNE+ N  R++YLRGA GR
Sbjct  435  IQHVLIEHPGAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNTRRFSYLRGADGR  494

Query  575  FRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            F NPY+HG ++NCSDFL+NGY  D E    S
Sbjct  495  FYNPYNHGWRRNCSDFLVNGYTRDDEVVPSS  525



>ref|XP_002883831.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60090.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=288

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT++Q+  I+RNITTNE+ NA R++YLRG  
Sbjct  194  SWIKHIVIEHPDAAVFLFFDLLIFIATMTLTISQSYMIARNITTNELWNAKRFSYLRGPD  253

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E    S
Sbjct  254  GRFYNPYNHGWRRNCTDFLLHGYTRDDEVVPSS  286



>gb|ABO31375.1| TIP1-like protein [Gossypium hirsutum]
Length=127

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            SSF  W+N+A T HIGAI FL+ DFFLF GV  LTV QASQI+RNITTNEMAN +RY+YL
Sbjct  58   SSFFPWINNAFTHHIGAITFLIVDFFLFFGVAALTVVQASQIARNITTNEMANVMRYSYL  117

Query  593  RGAGGRFRNP  564
            R A GRFRNP
Sbjct  118  RSAIGRFRNP  127



>ref|XP_010467225.1| PREDICTED: probable protein S-acyltransferase 23 [Camelina sativa]
Length=536

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT++QA  I+RNITTNE+ NA R++YLRG  
Sbjct  442  SWIQHIVIEHSDAAVFLFFDLLIFIATMTLTISQAYMITRNITTNELWNAKRFSYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E +  S
Sbjct  502  GRFYNPYNHGWRRNCTDFLVHGYTRDDEVAPSS  534



>gb|EPS69086.1| palmitoyl transferase [Genlisea aurea]
Length=77

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  650  ISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVE  471
            I+RNITTNE+AN++RY YLRG  GRFRNPY+HG +KNC+DFLING+  D E +     + 
Sbjct  8    IARNITTNEVANSIRYGYLRGPDGRFRNPYNHGWRKNCTDFLINGHTNDDEIAWPPLPLH  67

Query  470  GIG  462
             +G
Sbjct  68   QLG  70



>ref|XP_004290297.1| PREDICTED: probable protein S-acyltransferase 23 [Fragaria vesca 
subsp. vesca]
Length=546

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  650  ISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECS  492
            I+RNITTNE+ANA+RY YLRG  GRFRNPY+HGC+KNC+DF I+GY +D E +
Sbjct  485  IARNITTNELANAIRYGYLRGPDGRFRNPYNHGCRKNCADFFIHGYTDDDEIA  537



>ref|XP_010488876.1| PREDICTED: probable protein S-acyltransferase 23 isoform X2 [Camelina 
sativa]
Length=517

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT++QA  I+RNITTNE+ NA R++YLRG  
Sbjct  423  SWIQHIVIEHSDAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNAKRFSYLRGPD  482

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E    S
Sbjct  483  GRFYNPYNHGWRRNCTDFLVHGYTRDDEVVPSS  515



>ref|NP_973453.2| Ankyrin repeat family protein with DHHC zinc finger domain [Arabidopsis 
thaliana]
 sp|Q3EC11.2|ZDHC2_ARATH RecName: Full=Probable protein S-acyltransferase 23; AltName: 
Full=Probable palmitoyltransferase At2g14255; AltName: Full=Zinc 
finger DHHC domain-containing protein At2g14255 [Arabidopsis 
thaliana]
 gb|AEC06292.1| Ankyrin repeat family protein with DHHC zinc finger domain [Arabidopsis 
thaliana]
Length=536

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT++Q+  I+RNITTNE+ NA R++YLRG  
Sbjct  442  SWIKHIVIEHPDAAVFLFFDLLIFIATMTLTISQSYMIARNITTNELWNAKRFSYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E    S
Sbjct  502  GRFYNPYNHGLRRNCTDFLVHGYTRDDEVVPSS  534



>ref|XP_010488875.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Camelina 
sativa]
Length=536

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -1

Query  761  AWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAG  582
            +W+ H   +H  A +FL  D  +F     LT++QA  I+RNITTNE+ NA R++YLRG  
Sbjct  442  SWIQHIVIEHSDAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNAKRFSYLRGPD  501

Query  581  GRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            GRF NPY+HG ++NC+DFL++GY  D E    S
Sbjct  502  GRFYNPYNHGWRRNCTDFLVHGYTRDDEVVPSS  534



>emb|CDY67866.1| BnaA09g52690D [Brassica napus]
Length=531

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -1

Query  755  LNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGGR  576
            + H   +H GA +FL  D  +F     LT++QA  I+RNITTNE+ N  R++YLRG  GR
Sbjct  439  IQHVLIEHPGAAVFLFFDLLIFIATMTLTISQAYMIARNITTNELWNTRRFSYLRGPDGR  498

Query  575  FRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            F NPY+HG ++NCSDFL+NGY  D E    S
Sbjct  499  FYNPYNHGWQRNCSDFLVNGYTRDDEVVPSS  529



>ref|XP_008391971.1| PREDICTED: probable protein S-acyltransferase 23 [Malus domestica]
Length=539

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  650  ISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNED  504
            I+RNITTNE+ANA+RY YLRG  GRFRNPY+HGC+KNCSDFLI G+ +D
Sbjct  479  IARNITTNELANAIRYGYLRGPDGRFRNPYNHGCRKNCSDFLIQGHTDD  527



>gb|KCW79059.1| hypothetical protein EUGRSUZ_C00485 [Eucalyptus grandis]
Length=534

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  773  SSFGAWLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYL  594
            +SFGAWL HA + H GA+ FL+A+FFLF GV  LT  QA QISRNITTNE  N+LRY+YL
Sbjct  431  ASFGAWLKHAWSHHTGAMSFLIAEFFLFLGVAALTALQAYQISRNITTNERENSLRYSYL  490

Query  593  RGAGGRFRNPYDHG  552
            R  GGRFRNPYD G
Sbjct  491  RDPGGRFRNPYDRG  504



>ref|XP_007041467.1| Palmitoyltransferase TIP1, putative [Theobroma cacao]
 gb|EOX97298.1| Palmitoyltransferase TIP1, putative [Theobroma cacao]
Length=297

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  680  TVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNED  504
            T LT  QA+QI+RNITTNE++NA+ Y YL G  G+F NPY+HGC+KN +DFLI GY +D
Sbjct  227  TTLTTVQAAQIARNITTNELSNAICYGYLHGPDGQFMNPYNHGCQKNSTDFLIRGYRDD  285



>ref|XP_003608335.1| Palmitoyltransferase [Medicago truncatula]
Length=298

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++    +H G + FL+ D  +    T LTVTQAS I+RN+TTNE+AN+ RY YLRG  G
Sbjct  201  WIHQVLVRHPGLVAFLVMDAVVVVATTTLTVTQASMIARNVTTNELANSTRYEYLRGPDG  260

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HG  KNC+DFL+ G+ +D
Sbjct  261  RFRNPYNHGWWKNCADFLLLGHTDD  285



>ref|XP_009368343.1| PREDICTED: probable protein S-acyltransferase 23 isoform X1 [Pyrus 
x bretschneideri]
Length=540

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 7/69 (10%)
 Frame = -1

Query  650  ISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVE  471
            I+RNITTNE+ANA RY YLRG  GRF+NPY+HGC+KNCSDFLI G+ +D        E+ 
Sbjct  479  IARNITTNELANANRYGYLRGPDGRFQNPYNHGCRKNCSDFLIQGHTDD-------DEIA  531

Query  470  GIGMIQMAS  444
               ++Q+AS
Sbjct  532  WSPLLQVAS  540



>ref|XP_009368345.1| PREDICTED: probable protein S-acyltransferase 23 isoform X3 [Pyrus 
x bretschneideri]
Length=514

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 51/69 (74%), Gaps = 7/69 (10%)
 Frame = -1

Query  650  ISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEESGEVE  471
            I+RNITTNE+ANA RY YLRG  GRF+NPY+HGC+KNCSDFLI G+ +D        E+ 
Sbjct  453  IARNITTNELANANRYGYLRGPDGRFQNPYNHGCRKNCSDFLIQGHTDD-------DEIA  505

Query  470  GIGMIQMAS  444
               ++Q+AS
Sbjct  506  WSPLLQVAS  514



>emb|CAN71650.1| hypothetical protein VITISV_003283 [Vitis vinifera]
Length=407

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  662  QASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIE  498
            +   I+RNITTNE+AN +RY YL    GRFRNPY+HGC+KNC+DFLI GY +D E
Sbjct  314  ELPPIARNITTNELANFIRYGYLHAPDGRFRNPYNHGCRKNCADFLIYGYTDDEE  368



>gb|AES90531.2| palmitoyltransferase TIP1 [Medicago truncatula]
Length=451

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++    +H G + FL+ D  +    T LTVTQAS I+RN+TTNE+AN+ RY YLRG  G
Sbjct  354  WIHQVLVRHPGLVAFLVMDAVVVVATTTLTVTQASMIARNVTTNELANSTRYEYLRGPDG  413

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HG  KNC+DFL+ G+ +D
Sbjct  414  RFRNPYNHGWWKNCADFLLLGHTDD  438



>gb|AES90530.2| palmitoyltransferase TIP1 [Medicago truncatula]
Length=540

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++    +H G + FL+ D  +    T LTVTQAS I+RN+TTNE+AN+ RY YLRG  G
Sbjct  443  WIHQVLVRHPGLVAFLVMDAVVVVATTTLTVTQASMIARNVTTNELANSTRYEYLRGPDG  502

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HG  KNC+DFL+ G+ +D
Sbjct  503  RFRNPYNHGWWKNCADFLLLGHTDD  527



>ref|XP_003608333.1| Palmitoyltransferase [Medicago truncatula]
Length=543

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  758  WLNHAGTQHIGaiiflladfflFSGVTVLTVTQASQISRNITTNEMANALRYNYLRGAGG  579
            W++    +H G + FL+ D  +    T LTVTQAS I+RN+TTNE+AN+ RY YLRG  G
Sbjct  446  WIHQVLVRHPGLVAFLVMDAVVVVATTTLTVTQASMIARNVTTNELANSTRYEYLRGPDG  505

Query  578  RFRNPYDHGCKKNCSDFLINGYNED  504
            RFRNPY+HG  KNC+DFL+ G+ +D
Sbjct  506  RFRNPYNHGWWKNCADFLLLGHTDD  530



>ref|XP_005651193.1| ankyrin [Coccomyxa subellipsoidea C-169]
 gb|EIE26649.1| ankyrin [Coccomyxa subellipsoidea C-169]
Length=557

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNED  504
            V  L+VTQA QI+RN TTNEMAN  RY YL G  G F+NP+D GC++NCS+ +       
Sbjct  469  VGALSVTQAMQIARNTTTNEMANWTRYKYLHGDDGSFKNPFDKGCRQNCSEAMCGKTAAA  528

Query  503  IECSEESGEVEGIGMIQMASSALQNGACHSQ  411
            +    +S  +E   +++M      NG    Q
Sbjct  529  VRLHPDS--IELTSLLRMEEGQHANGLSFRQ  557



>gb|KIY98503.1| S-acyltransferase TIP1 [Monoraphidium neglectum]
Length=327

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSD  531
            V VL V QASQ++RN+TTNE+AN  RY YL+ A GRF NP++H C  NC++
Sbjct  245  VAVLAVAQASQVARNVTTNELANWHRYKYLQDAAGRFHNPFNHSCCTNCAE  295



>ref|XP_001419599.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97892.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=493

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGC-KKNCSDFLINGYNE  507
            V +LTV Q SQ +RNITTNE++N  RY YL+ A GRF NP+D G   +N   F + G  E
Sbjct  432  VALLTVAQLSQAARNITTNELSNVHRYAYLKSAEGRFANPFDRGSFARNLRAFFLVGKKE  491

Query  506  DI  501
             +
Sbjct  492  PL  493



>ref|XP_002507459.1| palmitoyltransferase [Micromonas sp. RCC299]
 gb|ACO68717.1| palmitoyltransferase [Micromonas sp. RCC299]
Length=546

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDF  528
            V +LT  Q SQ+ RNITTNE++NA RY +L+   GRF NP+D GC+ N   F
Sbjct  462  VLMLTGAQLSQVFRNITTNELSNAHRYQWLKDDNGRFNNPFDRGCQSNTVRF  513



>ref|XP_007510567.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18100.1| predicted protein [Bathycoccus prasinos]
Length=588

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNED  504
            V +L  +Q +Q++RNITTNE+ N  RY YLR   G F+NP+D G  KN   F     N  
Sbjct  505  VLLLVSSQLAQVARNITTNELMNLHRYTYLRATDGTFKNPFDKGVFKNLVSFFCVDANRR  564

Query  503  IECSEESG  480
                EE  
Sbjct  565  TREFEEKA  572



>ref|XP_001698472.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP07965.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=501

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGR-FRNPYDHGCKKNCSD  531
            V  L + QASQ++RN+TTNE+AN  RY YL+   G  F NP+ HGC +NC +
Sbjct  450  VAALAIAQASQVARNVTTNELANWHRYRYLQTPDGHGFVNPFSHGCVENCRE  501



>gb|KDD72068.1| hypothetical protein H632_c3917p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=249

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSD  531
            V  L   QA QI RN+TTNE+AN  RY YL G  G F+NP+D G + NC +
Sbjct  169  VGALAGAQAHQIWRNVTTNELANWHRYRYLHGPSGDFQNPFDRGWRLNCWE  219



>ref|XP_011398384.1| Protein S-acyltransferase 24 [Auxenochlorella protothecoides]
 gb|KFM25488.1| Protein S-acyltransferase 24 [Auxenochlorella protothecoides]
Length=457

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -1

Query  662  QASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLINGYNEDIECSEES  483
            Q +QI++NITTNE+AN  RY YL  A G F NP+D G K NC++          +   E 
Sbjct  379  QTNQIAKNITTNELANWHRYKYLHAADGEFLNPFDRGWKANCAEVCCAAQRPRSQYVLEG  438

Query  482  GE  477
            GE
Sbjct  439  GE  440



>ref|XP_003081298.1| ankyrin repeat-containing protein-like (ISS), partial [Ostreococcus 
tauri]
Length=361

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHG  552
            V +LT++Q  Q+++N+TTNE++NA RY+YL+ + G F NP+D G
Sbjct  283  VIMLTISQLVQVAQNVTTNELSNAHRYSYLKSSDGAFVNPFDRG  326



>emb|CEF99127.1| Ankyrin repeat, partial [Ostreococcus tauri]
Length=470

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHG  552
            V +LT++Q  Q+++N+TTNE++NA RY+YL+ + G F NP+D G
Sbjct  392  VIMLTISQLVQVAQNVTTNELSNAHRYSYLKSSDGAFVNPFDRG  435



>ref|XP_003055353.1| palmitoyltransferase [Micromonas pusilla CCMP1545]
 gb|EEH60605.1| palmitoyltransferase [Micromonas pusilla CCMP1545]
Length=553

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -1

Query  674  LTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCK-KNCSDF  528
            L   Q  Q   NITTNE+ANA RY YLR   G+FRNP+D G K KN + F
Sbjct  467  LAAAQTHQAMENITTNELANAHRYAYLRDEHGKFRNPFDRGSKLKNLAGF  516



>emb|CCA27763.1| palmitoyltransferase putative [Albugo laibachii Nc14]
Length=652

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -1

Query  677  VLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNC  537
            +L V Q   ISRN+TTNE+ N  +Y YL+ A   F NPYD G   NC
Sbjct  592  ILLVLQLRNISRNLTTNEVFNKDKYPYLKNALDEFMNPYDRGVWNNC  638



>ref|XP_008872198.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETV98771.1| hypothetical protein, variant [Aphanomyces invadans]
Length=590

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -1

Query  677  VLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLIN  519
            VL   Q   IS N+TTNE+ N  +Y+YL+     FRNP+D G   NC  F ++
Sbjct  533  VLLGLQVRNISTNLTTNEVFNRAKYSYLKDMNDEFRNPFDRGVGANCLAFWLD  585



>ref|XP_008872199.1| hypothetical protein H310_08286 [Aphanomyces invadans]
 gb|ETV98770.1| hypothetical protein H310_08286 [Aphanomyces invadans]
Length=609

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -1

Query  677  VLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFLIN  519
            VL   Q   IS N+TTNE+ N  +Y+YL+     FRNP+D G   NC  F ++
Sbjct  552  VLLGLQVRNISTNLTTNEVFNRAKYSYLKDMNDEFRNPFDRGVGANCLAFWLD  604



>emb|CBY31307.1| unnamed protein product [Oikopleura dioica]
 emb|CBY22015.1| unnamed protein product [Oikopleura dioica]
 emb|CBY35288.1| unnamed protein product [Oikopleura dioica]
Length=516

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -1

Query  683  VTVLTVTQASQISRNITTNEMANALRYNYLRGAGGRFRNPYDHGCKKNCSDFL  525
            VT L +       +N+TTNE  N  RY YL+ + G+F NP+D G K+N  +F 
Sbjct  446  VTPLFIGTTYNAVKNLTTNEQVNFRRYEYLKNSMGQFSNPFDRGAKENLKEFF  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1538697559425