BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6920

Length=875
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239629.1|  PREDICTED: protein OPI10 homolog                   363   2e-123   Solanum lycopersicum
ref|XP_009780094.1|  PREDICTED: protein OPI10 homolog                   362   3e-123   Nicotiana sylvestris
ref|XP_006345750.1|  PREDICTED: protein OPI10 homolog                   361   6e-123   Solanum tuberosum [potatoes]
ref|XP_009595494.1|  PREDICTED: protein OPI10 homolog                   357   2e-121   Nicotiana tomentosiformis
ref|XP_008343048.1|  PREDICTED: protein Hikeshi-like                    352   5e-119   
emb|CDP01674.1|  unnamed protein product                                350   2e-118   Coffea canephora [robusta coffee]
ref|XP_008229209.1|  PREDICTED: protein OPI10 homolog                   348   7e-118   Prunus mume [ume]
ref|XP_006494083.1|  PREDICTED: protein OPI10 homolog                   342   3e-115   Citrus sinensis [apfelsine]
ref|XP_008381331.1|  PREDICTED: protein Hikeshi-like                    341   5e-115   
ref|XP_009334419.1|  PREDICTED: protein OPI10 homolog                   341   6e-115   Pyrus x bretschneideri [bai li]
ref|XP_007215039.1|  hypothetical protein PRUPE_ppa012019mg             340   1e-114   Prunus persica
ref|XP_006421091.1|  hypothetical protein CICLE_v10005984mg             340   2e-114   Citrus clementina [clementine]
ref|XP_012082758.1|  PREDICTED: protein OPI10 homolog                   340   3e-114   Jatropha curcas
ref|XP_004288368.1|  PREDICTED: protein OPI10 homolog                   339   3e-114   Fragaria vesca subsp. vesca
ref|XP_011085888.1|  PREDICTED: protein OPI10 homolog                   338   6e-114   Sesamum indicum [beniseed]
ref|XP_010242568.1|  PREDICTED: protein OPI10 homolog                   338   7e-114   Nelumbo nucifera [Indian lotus]
ref|XP_002523076.1|  conserved hypothetical protein                     338   9e-114   Ricinus communis
ref|XP_004145632.1|  PREDICTED: protein OPI10 homolog                   337   2e-113   Cucumis sativus [cucumbers]
ref|XP_008461564.1|  PREDICTED: protein Hikeshi                         337   3e-113   Cucumis melo [Oriental melon]
ref|XP_007050064.1|  Uncharacterized protein TCM_003748                 336   8e-113   
ref|XP_002265803.1|  PREDICTED: protein OPI10 homolog                   335   2e-112   Vitis vinifera
ref|XP_003544973.1|  PREDICTED: protein Hikeshi-like                    333   9e-112   Glycine max [soybeans]
ref|XP_003616198.1|  OPI10-like protein                                 332   2e-111   Medicago truncatula
ref|XP_003518366.1|  PREDICTED: protein Hikeshi-like                    332   3e-111   Glycine max [soybeans]
ref|XP_004490798.1|  PREDICTED: uncharacterized protein LOC101493272    332   4e-111   Cicer arietinum [garbanzo]
gb|EYU34526.1|  hypothetical protein MIMGU_mgv1a021479mg                332   4e-111   Erythranthe guttata [common monkey flower]
ref|XP_007141943.1|  hypothetical protein PHAVU_008G239100g             330   2e-110   Phaseolus vulgaris [French bean]
ref|XP_009371835.1|  PREDICTED: protein OPI10 homolog                   325   7e-109   Pyrus x bretschneideri [bai li]
ref|XP_010669406.1|  PREDICTED: protein OPI10 homolog                   324   3e-108   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN39486.1|  Hypothetical protein glysoja_016873                     325   3e-108   Glycine soja [wild soybean]
ref|XP_010110104.1|  hypothetical protein L484_013280                   323   6e-108   Morus notabilis
ref|XP_002305236.1|  hypothetical protein POPTR_0004s08040g             323   6e-108   Populus trichocarpa [western balsam poplar]
gb|KJB46925.1|  hypothetical protein B456_008G001800                    325   7e-108   Gossypium raimondii
ref|XP_010551467.1|  PREDICTED: protein Hikeshi isoform X1              323   1e-107   Tarenaya hassleriana [spider flower]
ref|XP_011043894.1|  PREDICTED: protein Hikeshi                         321   4e-107   Populus euphratica
ref|XP_009105185.1|  PREDICTED: protein OPI10 homolog                   320   2e-106   Brassica rapa
emb|CDY39251.1|  BnaC06g27400D                                          320   2e-106   Brassica napus [oilseed rape]
emb|CDY07480.1|  BnaA07g25590D                                          319   3e-106   Brassica napus [oilseed rape]
emb|CDY16431.1|  BnaA02g12350D                                          318   6e-106   Brassica napus [oilseed rape]
emb|CDY50322.1|  BnaCnng19050D                                          317   2e-105   Brassica napus [oilseed rape]
ref|XP_006391345.1|  hypothetical protein EUTSA_v10019182mg             317   2e-105   Eutrema salsugineum [saltwater cress]
gb|KJB46928.1|  hypothetical protein B456_008G001800                    317   4e-105   Gossypium raimondii
ref|XP_006302780.1|  hypothetical protein CARUB_v10020900mg             317   6e-105   
gb|KJB46927.1|  hypothetical protein B456_008G001800                    318   7e-105   Gossypium raimondii
gb|KFK41028.1|  hypothetical protein AALP_AA2G075800                    327   1e-104   Arabis alpina [alpine rockcress]
ref|NP_176782.1|  uncharacterized protein                               314   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58163.1|  hypothetical protein M569_16653                         313   8e-104   Genlisea aurea
ref|XP_010511533.1|  PREDICTED: protein OPI10 homolog                   312   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_002888480.1|  hypothetical protein ARALYDRAFT_475712             312   1e-103   
ref|XP_010470478.1|  PREDICTED: protein OPI10 homolog                   311   4e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010032742.1|  PREDICTED: protein OPI10 homolog                   305   9e-101   Eucalyptus grandis [rose gum]
ref|XP_006849456.1|  PREDICTED: uncharacterized protein LOC18439221     304   2e-100   Amborella trichopoda
gb|ABK25938.1|  unknown                                                 299   2e-98    Picea sitchensis
ref|XP_008798223.1|  PREDICTED: protein OPI10 homolog                   278   4e-90    
ref|XP_008368333.1|  PREDICTED: LOW QUALITY PROTEIN: protein Hike...    278   4e-90    
ref|XP_008348659.1|  PREDICTED: protein OPI10 homolog                   276   5e-90    
ref|XP_010936851.1|  PREDICTED: protein OPI10 homolog                   276   2e-89    Elaeis guineensis
ref|XP_002991883.1|  hypothetical protein SELMODRAFT_134406             263   3e-84    Selaginella moellendorffii
ref|XP_009388745.1|  PREDICTED: protein OPI10 homolog                   251   1e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001762423.1|  predicted protein                                  244   9e-77    
ref|XP_001778643.1|  predicted protein                                  235   2e-73    
ref|XP_010418997.1|  PREDICTED: protein OPI10 homolog                   229   9e-72    Camelina sativa [gold-of-pleasure]
ref|XP_001761255.1|  predicted protein                                  223   2e-68    
ref|XP_001771695.1|  predicted protein                                  221   7e-68    
ref|XP_002969459.1|  hypothetical protein SELMODRAFT_91593              215   7e-65    Selaginella moellendorffii
ref|XP_002961228.1|  hypothetical protein SELMODRAFT_74965              214   1e-64    
ref|NP_001144319.1|  hypothetical protein                               171   2e-48    Zea mays [maize]
gb|ABF94856.1|  expressed protein                                       168   5e-47    Oryza sativa Japonica Group [Japonica rice]
gb|AAO06975.1|  Hypothetical protein                                    166   1e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985069.1|  PREDICTED: protein OPI10 homolog                   162   5e-45    Setaria italica
ref|XP_002468201.1|  hypothetical protein SORBIDRAFT_01g041620          161   1e-44    Sorghum bicolor [broomcorn]
gb|AGT15901.1|  hypothetical protein SHCRBa_121_B20_R_80                159   4e-44    Saccharum hybrid cultivar R570
ref|XP_003558405.1|  PREDICTED: protein OPI10 homolog                   159   7e-44    Brachypodium distachyon [annual false brome]
ref|XP_010101779.1|  hypothetical protein L484_018735                   140   8e-37    
ref|XP_005847507.1|  hypothetical protein CHLNCDRAFT_134521             137   2e-35    Chlorella variabilis
ref|XP_010092034.1|  hypothetical protein L484_006352                   143   2e-34    
gb|AEW08558.1|  hypothetical protein CL487Contig1_01                    121   8e-31    Pinus lambertiana
ref|XP_001418434.1|  predicted protein                                  124   2e-30    Ostreococcus lucimarinus CCE9901
ref|XP_003061944.1|  predicted protein                                  120   5e-29    Micromonas pusilla CCMP1545
gb|EMT18032.1|  hypothetical protein F775_22021                         120   2e-28    
ref|XP_001698841.1|  hypothetical protein CHLREDRAFT_151930             117   6e-28    Chlamydomonas reinhardtii
ref|XP_002500250.1|  predicted protein                                  117   7e-28    Micromonas commoda
emb|CEF98318.1|  Protein of unknown function DUF775                     112   4e-26    Ostreococcus tauri
ref|NP_001049495.1|  Os03g0237500                                       101   2e-22    
gb|EMS60665.1|  hypothetical protein TRIUR3_20798                     99.4    2e-22    Triticum urartu
ref|XP_003079806.1|  ribulose-phosphate 3-epimerase (IC)                102   5e-21    
ref|XP_006651202.1|  PREDICTED: uncharacterized protein LOC102715001  98.2    1e-20    
ref|XP_002179274.1|  predicted protein                                88.6    3e-17    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002952886.1|  hypothetical protein VOLCADRAFT_105709           87.8    4e-17    Volvox carteri f. nagariensis
gb|KDD76521.1|  hypothetical protein H632_c196p2                      79.0    1e-14    Helicosporidium sp. ATCC 50920
ref|XP_007721777.1|  hypothetical protein A1O1_02677                  79.7    2e-14    Capronia coronata CBS 617.96
ref|XP_008604221.1|  hypothetical protein SDRG_00519                  77.0    1e-13    Saprolegnia diclina VS20
ref|XP_007733569.1|  hypothetical protein A1O3_05254                  76.3    2e-13    Capronia epimyces CBS 606.96
ref|XP_007513171.1|  predicted protein                                72.8    4e-12    Bathycoccus prasinos
ref|XP_011396656.1|  Protein Hikeshi                                  71.6    5e-12    Auxenochlorella protothecoides
gb|KIX04340.1|  hypothetical protein Z518_05208                       72.4    7e-12    Rhinocladiella mackenziei CBS 650.93
emb|CBJ30038.1|  conserved unknown protein                            71.6    1e-11    Ectocarpus siliculosus
ref|XP_009153374.1|  hypothetical protein HMPREF1120_01116            71.2    2e-11    Exophiala dermatitidis NIH/UT8656
ref|XP_002835626.1|  hypothetical protein                             70.9    2e-11    Tuber melanosporum Mel28
ref|XP_009536811.1|  hypothetical protein PHYSODRAFT_262726           70.9    2e-11    Phytophthora sojae
ref|XP_002379241.1|  DUF775 domain protein                            70.1    5e-11    Aspergillus flavus NRRL3357
ref|XP_007339861.1|  DUF775-domain-containing protein                 69.7    6e-11    
gb|KIW44056.1|  hypothetical protein PV06_05096                       69.3    7e-11    Exophiala oligosperma
emb|CCA72516.1|  hypothetical protein PIIN_06453                      69.3    8e-11    Serendipita indica DSM 11827
ref|XP_005834150.1|  hypothetical protein GUITHDRAFT_107080           68.9    1e-10    Guillardia theta CCMP2712
gb|KJK60227.1|  Protein of unknown function DUF775                    68.9    1e-10    Aspergillus parasiticus SU-1
gb|KIV93798.1|  hypothetical protein PV10_04987                       68.6    1e-10    Exophiala mesophila
gb|KDO27912.1|  hypothetical protein SPRG_07185                       71.2    2e-10    Saprolegnia parasitica CBS 223.65
ref|XP_003066376.1|  hypothetical protein CPC735_056010               68.9    2e-10    Coccidioides posadasii C735 delta SOWgp
ref|XP_001246897.1|  hypothetical protein CIMG_00668                  68.6    2e-10    Coccidioides immitis RS
ref|XP_002541152.1|  conserved hypothetical protein                   68.2    3e-10    Uncinocarpus reesii 1704
gb|KIW11818.1|  hypothetical protein PV08_09091                       67.4    4e-10    Exophiala spinifera
ref|XP_002288292.1|  predicted protein                                67.8    5e-10    Thalassiosira pseudonana CCMP1335
ref|XP_002786756.1|  conserved hypothetical protein                   67.0    5e-10    Perkinsus marinus ATCC 50983
ref|XP_009824847.1|  hypothetical protein H257_02755                  67.0    5e-10    Aphanomyces astaci
ref|XP_002771635.1|  conserved hypothetical protein                   67.0    6e-10    Perkinsus marinus ATCC 50983
gb|KIW60561.1|  hypothetical protein PV05_00768                       67.0    6e-10    Exophiala xenobiotica
ref|XP_002782001.1|  conserved hypothetical protein                   66.6    7e-10    Perkinsus marinus ATCC 50983
gb|EWM23609.1|  Protein of unknown function DUF775                    66.2    8e-10    Nannochloropsis gaditana
ref|XP_008043899.1|  DUF775-domain-containing protein                 66.2    1e-09    Trametes versicolor FP-101664 SS1
ref|XP_008730276.1|  hypothetical protein G647_07742                  66.2    1e-09    Cladophialophora carrionii CBS 160.54
ref|XP_002340363.1|  DUF775 domain protein                            66.6    2e-09    Talaromyces stipitatus ATCC 10500
ref|XP_001216308.1|  conserved hypothetical protein                   65.9    2e-09    Aspergillus terreus NIH2624
gb|KIK07065.1|  hypothetical protein K443DRAFT_87991                  65.5    3e-09    Laccaria amethystina LaAM-08-1
gb|KKA25273.1|  DUF775 domain protein                                 65.9    3e-09    Rasamsonia emersonii CBS 393.64
tpe|CBF89989.1|  TPA: DUF775 domain protein (AFU_orthologue; AFUA...  65.5    3e-09    Aspergillus nidulans FGSC A4
ref|XP_002140125.1|  hypothetical protein                             64.7    3e-09    Cryptosporidium muris RN66
ref|XP_007267412.1|  DUF775-domain-containing protein                 65.1    4e-09    Fomitiporia mediterranea MF3/22
gb|KJA23817.1|  hypothetical protein HYPSUDRAFT_137223                64.7    4e-09    Hypholoma sublateritium FD-334 SS-4
ref|XP_001878996.1|  predicted protein                                64.7    4e-09    Laccaria bicolor S238N-H82
gb|KIW33601.1|  hypothetical protein PV07_00437                       64.3    4e-09    Cladophialophora immunda
emb|CDO74338.1|  hypothetical protein BN946_scf184850.g10             64.7    5e-09    Trametes cinnabarina
gb|KDQ12484.1|  hypothetical protein BOTBODRAFT_34450                 64.7    5e-09    Botryobasidium botryosum FD-172 SS1
gb|KIW64416.1|  hypothetical protein PV04_09350                       63.5    8e-09    Phialophora americana
ref|XP_657803.1|  hypothetical protein AN0199.2                       65.9    8e-09    Aspergillus nidulans FGSC A4
gb|KIY03920.1|  hypothetical protein Z520_00612                       63.5    9e-09    Fonsecaea multimorphosa CBS 102226
ref|XP_002046638.1|  GJ12989                                          63.5    9e-09    Drosophila virilis
ref|XP_003044631.1|  predicted protein                                63.5    9e-09    [Nectria] haematococca mpVI 77-13-4
ref|NP_001017577.1|  protein Hikeshi                                  63.5    9e-09    Danio rerio [leopard danio]
sp|Q568T4.2|HIKES_DANRE  RecName: Full=Protein Hikeshi                63.5    1e-08    Danio rerio [leopard danio]
ref|XP_004523766.1|  PREDICTED: protein OPI10 homolog                 63.5    1e-08    Ceratitis capitata [medfly]
ref|XP_011183817.1|  PREDICTED: protein OPI10 homolog                 63.5    1e-08    Zeugodacus cucurbitae [melon fruit fly]
pdb|3WW0|A  Chain A, Crystal Structure Of F97a Mutant, A New Nucl...  63.2    1e-08    Homo sapiens [man]
gb|KEF52933.1|  hypothetical protein A1O9_10839                       62.8    2e-08    Exophiala aquamarina CBS 119918
pdb|3WW0|B  Chain B, Crystal Structure Of F97a Mutant, A New Nucl...  62.8    2e-08    Homo sapiens [man]
ref|XP_002007273.1|  GI12844                                          62.8    2e-08    Drosophila mojavensis
dbj|GAM90125.1|  hypothetical protein ANO11243_081650                 62.8    2e-08    fungal sp. No.11243
ref|XP_007805398.1|  hypothetical protein EPUS_08173                  63.2    2e-08    Endocarpon pusillum Z07020
ref|XP_005189077.1|  PREDICTED: protein OPI10 homolog                 62.8    2e-08    Musca domestica
gb|KIJ37109.1|  hypothetical protein M422DRAFT_33960                  62.8    2e-08    Sphaerobolus stellatus SS14
ref|XP_007760947.1|  hypothetical protein A1O7_08768                  62.4    2e-08    Cladophialophora yegresii CBS 114405
ref|XP_001362527.1|  PREDICTED: protein Hikeshi isoform X1            62.4    3e-08    Monodelphis domestica
ref|XP_003764643.1|  PREDICTED: protein Hikeshi                       62.4    3e-08    Sarcophilus harrisii
ref|XP_003992701.1|  PREDICTED: protein Hikeshi                       62.4    3e-08    Felis catus [cat]
ref|XP_009261864.1|  hypothetical protein FPSE_10472                  62.4    3e-08    Fusarium pseudograminearum CS3096
ref|NP_595931.1|  inositol metabolism protein Opi10 (predicted)       62.4    3e-08    Schizosaccharomyces pombe
ref|XP_003380090.1|  protein OPI10-like protein                       62.4    3e-08    Trichinella spiralis
ref|XP_001910288.1|  hypothetical protein                             62.4    3e-08    Podospora anserina S mat+
gb|EJK64196.1|  hypothetical protein THAOC_15100                      62.4    3e-08    Thalassiosira oceanica
gb|EUC66321.1|  inositol metabolism protein OPI10, putative           62.0    4e-08    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_008069261.1|  PREDICTED: protein Hikeshi isoform X2            61.6    4e-08    Carlito syrichta
ref|XP_008069256.1|  PREDICTED: protein Hikeshi isoform X1            62.0    4e-08    Carlito syrichta
dbj|BAD96918.1|  hypothetical protein HSPC138 variant                 61.6    4e-08    Homo sapiens [man]
ref|XP_002065862.1|  GK16958                                          61.6    5e-08    Drosophila willistoni
ref|XP_002904338.1|  conserved hypothetical protein                   61.6    5e-08    Phytophthora infestans T30-4
ref|XP_003660422.1|  hypothetical protein MYCTH_2052653               61.6    5e-08    Thermothelomyces thermophila ATCC 42464
ref|XP_005379802.1|  PREDICTED: protein Hikeshi isoform X1            61.2    6e-08    
ref|XP_011212939.1|  PREDICTED: protein OPI10 homolog                 61.2    6e-08    Bactrocera dorsalis [papaya fruit fly]
ref|XP_504694.1|  YALI0E32637p                                        61.6    6e-08    Yarrowia lipolytica CLIB122
emb|CCX10230.1|  Similar to Protein OPI10 homolog; acc. no. O60175    61.2    6e-08    Pyronema omphalodes CBS 100304
gb|KIK53316.1|  hypothetical protein GYMLUDRAFT_49338                 61.2    7e-08    Gymnopus luxurians FD-317 M1
ref|XP_004886952.1|  PREDICTED: protein Hikeshi                       61.2    7e-08    
ref|XP_002917352.1|  PREDICTED: protein Hikeshi                       61.2    7e-08    Ailuropoda melanoleuca
ref|XP_002594234.1|  hypothetical protein BRAFLDRAFT_113596           61.2    7e-08    Branchiostoma floridae
ref|XP_005875688.1|  PREDICTED: protein Hikeshi                       61.2    7e-08    Myotis brandtii
dbj|GAM34523.1|  DUF775 domain protein                                61.6    8e-08    Talaromyces cellulolyticus
ref|XP_010632032.1|  PREDICTED: protein Hikeshi                       61.2    8e-08    Fukomys damarensis [Damara mole rat]
ref|XP_008716342.1|  hypothetical protein HMPREF1541_03770            61.2    8e-08    Cyphellophora europaea CBS 101466
ref|XP_011321347.1|  hypothetical protein FGSG_04271                  60.8    9e-08    Fusarium graminearum PH-1
ref|XP_006189600.1|  PREDICTED: protein Hikeshi                       60.8    9e-08    Camelus ferus
ref|XP_005323347.1|  PREDICTED: protein Hikeshi                       60.8    9e-08    Ictidomys tridecemlineatus
ref|XP_004632627.1|  PREDICTED: protein Hikeshi                       60.8    9e-08    Octodon degus
ref|XP_004416965.1|  PREDICTED: protein Hikeshi                       60.8    9e-08    Odobenus rosmarus divergens
ref|XP_002171863.1|  inositol metabolism protein Opi10                60.8    9e-08    Schizosaccharomyces japonicus yFS275
gb|KIL86874.1|  hypothetical protein FAVG1_10130                      60.8    9e-08    Fusarium avenaceum
ref|XP_007634574.1|  PREDICTED: protein Hikeshi isoform X3            60.8    1e-07    
emb|CAK43588.1|  unnamed protein product                              61.2    1e-07    Aspergillus niger
gb|KGB78387.1|  hypothetical protein CNBG_3949                        60.8    1e-07    Cryptococcus gattii VGII R265
ref|XP_001388656.2|  hypothetical protein ANI_1_282014                60.8    1e-07    Aspergillus niger CBS 513.88
gb|KIV86846.1|  hypothetical protein PV11_02430                       60.5    1e-07    Exophiala sideris
ref|XP_004455307.1|  PREDICTED: protein Hikeshi isoform 2             60.5    1e-07    Dasypus novemcinctus
gb|KIM41441.1|  hypothetical protein M413DRAFT_411155                 60.8    1e-07    Hebeloma cylindrosporum h7
gb|KII91494.1|  hypothetical protein PLICRDRAFT_38256                 60.8    1e-07    Plicaturopsis crispa FD-325 SS-3
ref|XP_003418595.1|  PREDICTED: protein Hikeshi                       60.5    1e-07    Loxodonta africana [African bush elephant]
ref|XP_004658324.1|  PREDICTED: protein Hikeshi                       60.5    1e-07    Jaculus jaculus
ref|NP_080580.1|  protein Hikeshi isoform a                           60.5    1e-07    Mus musculus [mouse]
dbj|BAB28072.1|  unnamed protein product                              60.5    1e-07    Mus musculus [mouse]
ref|NP_057485.2|  protein Hikeshi                                     60.5    1e-07    Homo sapiens [man]
gb|KIW86168.1|  hypothetical protein Z517_01563                       60.5    1e-07    Fonsecaea pedrosoi CBS 271.37
gb|KIR25130.1|  hypothetical protein I309_06033                       60.5    1e-07    Cryptococcus gattii VGII LA55
pdb|3WVZ|A  Chain A, Crystal Structure Of Hikeshi, A New Nuclear ...  60.5    1e-07    Homo sapiens [man]
gb|ETO07139.1|  hypothetical protein RFI_30252                        60.5    1e-07    Reticulomyxa filosa
gb|EHH56635.1|  hypothetical protein EGM_06088                        60.5    1e-07    Macaca fascicularis [crab eating macaque]
ref|XP_009245196.1|  PREDICTED: protein Hikeshi                       60.5    1e-07    
ref|XP_007254894.1|  PREDICTED: protein Hikeshi                       60.5    1e-07    Astyanax mexicanus [blind cave fish]
ref|XP_533984.1|  PREDICTED: protein Hikeshi isoformX1                60.5    1e-07    Canis lupus familiaris [dogs]
gb|KIR32514.1|  hypothetical protein I352_04939                       60.5    1e-07    Cryptococcus gattii VGII MMRL2647
ref|XP_007944460.1|  PREDICTED: protein Hikeshi                       60.5    1e-07    Orycteropus afer afer
gb|KIW90766.1|  hypothetical protein Z519_08549                       60.1    2e-07    Cladophialophora bantiana CBS 173.52
ref|XP_010210558.1|  PREDICTED: protein Hikeshi                       60.1    2e-07    Tinamus guttatus
gb|EPS93222.1|  hypothetical protein FOMPIDRAFT_1170730               60.1    2e-07    Fomitopsis pinicola FP-58527 SS1
dbj|GAA91755.1|  DUF775 domain protein                                60.5    2e-07    Aspergillus kawachii IFO 4308
gb|KEP55510.1|  putative inositol metabolism protein OPI10            60.5    2e-07    Rhizoctonia solani 123E
ref|XP_011117646.1|  hypothetical protein AOL_s00006g35               60.8    2e-07    Arthrobotrys oligospora ATCC 24927
gb|KIY33230.1|  hypothetical protein I305_04096                       60.1    2e-07    Cryptococcus gattii E566
gb|EPQ13581.1|  Hypothetical protein D623_10014362                    60.5    2e-07    Myotis brandtii
ref|XP_008588244.1|  PREDICTED: protein Hikeshi isoform X1            60.1    2e-07    Galeopterus variegatus [Malayan flying lemur]
emb|CCT73472.1|  uncharacterized protein FFUJ_09729                   60.1    2e-07    Fusarium fujikuroi IMI 58289
ref|XP_007124970.1|  PREDICTED: protein Hikeshi isoform X1            60.1    2e-07    Physeter catodon
ref|XP_001490181.1|  PREDICTED: protein Hikeshi                       60.1    2e-07    Equus caballus [domestic horse]
ref|XP_007848394.1|  inositol metabolism protein opi10                60.1    2e-07    
gb|KIM28437.1|  hypothetical protein M408DRAFT_69974                  59.7    2e-07    Serendipita vermifera MAFF 305830
ref|XP_002708700.1|  PREDICTED: protein Hikeshi isoform X1            59.7    2e-07    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010143400.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Buceros rhinoceros silvestris
ref|XP_003192557.1|  hypothetical protein CGB_C0210C                  59.7    2e-07    Cryptococcus gattii WM276
ref|XP_005038378.1|  PREDICTED: protein Hikeshi-like isoform X2       59.7    2e-07    
ref|XP_010191985.1|  PREDICTED: protein Hikeshi                       60.1    2e-07    Mesitornis unicolor
ref|XP_004019450.1|  PREDICTED: protein Hikeshi isoform X1            59.7    2e-07    Ovis aries [domestic sheep]
ref|XP_006895323.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFQ11297.1|  Protein Hikeshi                                       59.7    2e-07    Haliaeetus albicilla
ref|XP_008547509.1|  PREDICTED: protein OPI10 homolog                 59.7    2e-07    Microplitis demolitor
ref|XP_006197517.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Vicugna pacos
ref|XP_009871085.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Apaloderma vittatum
ref|XP_009879553.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Charadrius vociferus
ref|XP_006865017.1|  PREDICTED: protein Hikeshi                       59.7    2e-07    Chrysochloris asiatica
ref|XP_010151124.1|  PREDICTED: protein Hikeshi                       59.3    2e-07    Eurypyga helias
ref|XP_007740093.1|  hypothetical protein A1O5_01284                  59.7    2e-07    Cladophialophora psammophila CBS 110553
ref|XP_005038377.1|  PREDICTED: protein Hikeshi-like isoform X1       60.1    3e-07    
gb|KIR47955.1|  hypothetical protein I312_02469                       59.7    3e-07    Cryptococcus gattii CA1280
ref|XP_009693939.1|  PREDICTED: protein Hikeshi                       59.7    3e-07    Cariama cristata
ref|XP_005029808.1|  PREDICTED: protein Hikeshi-like isoform X3       59.7    3e-07    
ref|XP_004271912.1|  PREDICTED: protein Hikeshi                       59.7    3e-07    Orcinus orca [Orca]
ref|XP_004683327.1|  PREDICTED: protein Hikeshi                       59.7    3e-07    Condylura cristata
ref|XP_007538512.1|  PREDICTED: protein Hikeshi                       59.3    3e-07    Erinaceus europaeus [common hedgehog]
ref|XP_004082189.1|  PREDICTED: protein Hikeshi                       59.3    3e-07    Oryzias latipes [Japanese rice fish]
gb|EMD37125.1|  hypothetical protein CERSUDRAFT_115045                59.7    3e-07    Gelatoporia subvermispora B
ref|XP_004619098.1|  PREDICTED: protein Hikeshi                       59.3    3e-07    Sorex araneus [Eurasian shrew]
ref|XP_009071559.1|  PREDICTED: protein Hikeshi                       59.3    3e-07    Acanthisitta chloris
ref|XP_008312903.1|  PREDICTED: protein Hikeshi isoform X1            59.7    3e-07    
ref|XP_005456017.1|  PREDICTED: protein Hikeshi-like                  59.3    3e-07    Oreochromis niloticus
ref|NP_001029398.1|  protein Hikeshi                                  59.3    3e-07    Bos taurus [bovine]
ref|XP_002848124.1|  DUF775 domain-containing protein                 60.1    3e-07    Microsporum canis CBS 113480
gb|ETO70737.1|  hypothetical protein F444_12814                       58.9    3e-07    Phytophthora parasitica P1976
ref|XP_004554703.1|  PREDICTED: protein Hikeshi-like                  59.3    3e-07    
gb|KJZ79403.1|  hypothetical protein HIM_00872                        59.3    3e-07    Hirsutella minnesotensis 3608
ref|XP_001984716.1|  GH14872                                          59.3    3e-07    Drosophila grimshawi
ref|NP_001090793.1|  protein Hikeshi                                  59.3    3e-07    Xenopus tropicalis [western clawed frog]
gb|KFQ41123.1|  Protein Hikeshi                                       58.9    3e-07    Nestor notabilis
ref|NP_001232618.1|  uncharacterized protein LOC100190155             59.3    3e-07    Taeniopygia guttata
emb|CEL63781.1|  Protein OPI10 homolog OS=Schizosaccharomyces pom...  59.3    4e-07    Rhizoctonia solani AG-1 IB
ref|XP_006259062.1|  PREDICTED: protein Hikeshi                       59.3    4e-07    Alligator mississippiensis
ref|XP_009926294.1|  PREDICTED: protein Hikeshi                       59.7    4e-07    Haliaeetus albicilla
gb|KIR39683.1|  hypothetical protein I313_04154                       59.3    4e-07    Cryptococcus gattii VGII Ram5
ref|XP_569852.1|  hypothetical protein                                59.3    4e-07    
ref|XP_002159760.2|  PREDICTED: protein Hikeshi-like                  58.9    4e-07    
ref|XP_010575048.1|  PREDICTED: protein Hikeshi                       60.1    4e-07    Haliaeetus leucocephalus
ref|XP_007168553.1|  PREDICTED: protein Hikeshi isoform X1            58.9    4e-07    Balaenoptera acutorostrata scammoni
ref|XP_007634573.1|  PREDICTED: protein Hikeshi isoform X2            59.7    4e-07    
gb|ELU16398.1|  hypothetical protein CAPTEDRAFT_163472                58.9    4e-07    Capitella teleta
gb|KFO60069.1|  Protein Hikeshi                                       58.5    5e-07    Corvus brachyrhynchos
ref|XP_009468694.1|  PREDICTED: protein Hikeshi                       59.3    5e-07    Nipponia nippon
ref|XP_002368988.1|  hypothetical protein, conserved                  58.5    5e-07    
ref|XP_001590737.1|  hypothetical protein SS1G_08477                  59.7    5e-07    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_009017388.1|  hypothetical protein HELRODRAFT_78723            58.5    5e-07    Helobdella robusta
gb|EPY54258.1|  inositol metabolism protein Opi10                     58.5    5e-07    Schizosaccharomyces cryophilus OY26
ref|XP_008633139.1|  PREDICTED: protein Hikeshi                       58.5    5e-07    
ref|XP_009484425.1|  PREDICTED: protein Hikeshi                       58.5    5e-07    Pelecanus crispus
ref|XP_010399336.1|  PREDICTED: protein Hikeshi                       58.5    6e-07    Corvus cornix cornix
ref|XP_009498480.1|  PREDICTED: protein Hikeshi                       58.5    6e-07    Phalacrocorax carbo [common cormorant]
gb|KIP03134.1|  hypothetical protein PHLGIDRAFT_95180                 58.5    6e-07    
gb|ERE77961.1|  Protein of unknown function DUF775 containing pro...  59.7    6e-07    
ref|XP_005510812.1|  PREDICTED: protein Hikeshi-like isoform X1       58.5    6e-07    
ref|XP_005516211.1|  PREDICTED: protein Hikeshi-like isoform X1       58.5    6e-07    
gb|KIR97607.1|  hypothetical protein L804_05294                       58.5    6e-07    
ref|XP_010084455.1|  PREDICTED: protein Hikeshi                       58.2    6e-07    
gb|KIM54266.1|  hypothetical protein SCLCIDRAFT_1222144               58.5    6e-07    
ref|XP_007587620.1|  putative duf775 domain protein                   58.5    6e-07    
gb|KGO35957.1|  Protein of unknown function DUF775                    58.9    7e-07    
ref|XP_008947670.1|  PREDICTED: protein Hikeshi                       58.5    7e-07    
gb|AAF29102.1|AF161487_1  HSPC138                                     58.5    7e-07    
ref|NP_001026583.1|  protein Hikeshi                                  58.2    7e-07    
gb|KIR55295.1|  hypothetical protein I315_01881                       58.5    7e-07    
ref|XP_009898461.1|  PREDICTED: protein Hikeshi                       59.3    8e-07    
ref|XP_008077940.1|  hypothetical protein GLAREA_10648                58.5    8e-07    
ref|XP_005143857.1|  PREDICTED: protein Hikeshi-like                  58.2    8e-07    
ref|XP_009285936.1|  PREDICTED: protein Hikeshi                       58.2    9e-07    
gb|ACH46398.1|  putative RIKEN cDNA 0610007P06 variant 2              58.2    9e-07    
sp|Q5ZK09.2|HIKES_CHICK  RecName: Full=Protein Hikeshi                58.2    9e-07    
ref|XP_009820718.1|  PREDICTED: protein Hikeshi                       57.8    9e-07    
ref|XP_006785922.1|  PREDICTED: protein Hikeshi-like                  58.2    9e-07    
gb|ETI42114.1|  hypothetical protein F443_12709                       57.8    9e-07    
ref|XP_010704526.1|  PREDICTED: protein Hikeshi                       58.2    9e-07    
ref|XP_005817105.1|  PREDICTED: protein Hikeshi-like                  58.2    9e-07    
ref|XP_007872154.1|  hypothetical protein PNEG_00283                  58.2    9e-07    
gb|KIR86837.1|  hypothetical protein I308_02526                       58.2    1e-06    
ref|XP_008926661.1|  PREDICTED: protein Hikeshi                       58.9    1e-06    
ref|XP_010000858.1|  PREDICTED: protein Hikeshi                       57.8    1e-06    
ref|XP_010204336.1|  PREDICTED: protein Hikeshi                       57.8    1e-06    
ref|XP_007776300.1|  hypothetical protein W97_00193                   58.2    1e-06    
ref|NP_001158574.1|  CK073 protein                                    57.8    1e-06    
ref|XP_003884638.1|  conserved hypothetical protein                   57.4    1e-06    
ref|XP_012052550.1|  hypothetical protein CNAG_01479                  57.8    1e-06    
ref|XP_009321755.1|  PREDICTED: protein Hikeshi                       57.8    1e-06    
ref|XP_005995206.1|  PREDICTED: protein Hikeshi isoform X2            57.8    1e-06    
ref|XP_005105901.1|  PREDICTED: protein Hikeshi-like                  57.8    1e-06    
ref|XP_008909071.1|  hypothetical protein PPTG_14258                  57.4    1e-06    
gb|EZF33006.1|  hypothetical protein H101_03417                       58.2    1e-06    
gb|AAH18080.1|  Chromosome 11 open reading frame 73                   57.8    1e-06    
gb|KDN69206.1|  hypothetical protein CSUB01_07133                     57.8    1e-06    
gb|EWG51523.1|  hypothetical protein FVEG_10461                       57.8    1e-06    
ref|NP_001187859.1|  uncharacterized protein c11orf73-like protein    57.8    1e-06    
ref|XP_007442103.1|  PREDICTED: protein Hikeshi                       57.4    1e-06    
gb|KJJ26658.1|  hypothetical protein U727_0043084041                  58.2    1e-06    
ref|XP_006455332.1|  hypothetical protein AGABI2DRAFT_209781          57.8    1e-06    
ref|XP_010884406.1|  PREDICTED: protein Hikeshi isoform X1            57.4    1e-06    
gb|ACI69520.1|  C11orf73 homolog                                      57.4    2e-06    
ref|XP_008494997.1|  PREDICTED: protein Hikeshi                       57.4    2e-06    
ref|XP_004589883.1|  PREDICTED: protein Hikeshi                       57.4    2e-06    
ref|XP_006118450.1|  PREDICTED: protein Hikeshi                       57.4    2e-06    
ref|XP_003010317.1|  hypothetical protein ARB_03018                   57.8    2e-06    
ref|XP_011583117.1|  PREDICTED: protein Hikeshi                       58.9    2e-06    
gb|KFO80303.1|  Protein Hikeshi                                       57.0    2e-06    
ref|XP_001352762.1|  GA12631                                          57.0    2e-06    
gb|KGO65256.1|  Protein of unknown function DUF775                    57.8    2e-06    
ref|XP_009670939.1|  PREDICTED: protein Hikeshi                       57.8    2e-06    
ref|XP_008842361.1|  PREDICTED: protein Hikeshi isoform X1            57.0    2e-06    
ref|XP_009930884.1|  PREDICTED: protein Hikeshi                       57.8    2e-06    
gb|ACO07991.1|  C11orf73 homolog                                      57.0    2e-06    
ref|XP_005287584.1|  PREDICTED: protein Hikeshi isoform X2            57.0    2e-06    
ref|NP_001087012.1|  protein Hikeshi                                  57.0    2e-06    
ref|XP_002025627.1|  GL20735                                          57.0    2e-06    
ref|XP_006926754.1|  PREDICTED: protein Hikeshi                       57.0    2e-06    
ref|XP_007566337.1|  PREDICTED: protein Hikeshi-like                  57.0    2e-06    
ref|XP_007869840.1|  DUF775-domain-containing protein                 57.0    2e-06    
ref|XP_003219392.1|  PREDICTED: protein Hikeshi                       56.6    3e-06    
ref|XP_002145022.1|  DUF775 domain protein                            57.4    3e-06    
gb|EWZ35507.1|  hypothetical protein FOZG_11418                       56.6    3e-06    
ref|XP_008275337.1|  PREDICTED: protein Hikeshi                       56.6    3e-06    
ref|XP_006639250.1|  PREDICTED: protein Hikeshi-like                  56.6    3e-06    
gb|EGU85179.1|  hypothetical protein FOXB_04294                       56.6    3e-06    
ref|XP_008842362.1|  PREDICTED: protein Hikeshi isoform X2            56.6    3e-06    
gb|EGE02299.1|  DUF775 domain-containing protein                      57.0    3e-06    
gb|ENH75263.1|  Protein OPI10                                         56.2    3e-06    
ref|XP_002672556.1|  predicted protein                                56.6    4e-06    
gb|EGD98100.1|  hypothetical protein TESG_05489                       56.6    4e-06    
gb|EXA37633.1|  hypothetical protein FOVG_11772                       56.2    4e-06    
ref|NP_001279107.1|  chromosome unknown open reading frame, human...  55.8    4e-06    
gb|EFQ33145.1|  hypothetical protein GLRG_08289                       56.2    4e-06    
ref|XP_005232283.1|  PREDICTED: protein Hikeshi-like                  57.0    4e-06    
ref|XP_007060669.1|  PREDICTED: protein Hikeshi                       56.2    4e-06    
emb|CCD79788.1|  hypothetical protein Smp_027220                      55.8    4e-06    
gb|KDR77142.1|  hypothetical protein GALMADRAFT_139159                56.2    4e-06    
emb|CDM30808.1|  Protein of unknown function DUF775                   56.6    5e-06    
gb|ETN67492.1|  protein OPI10                                         55.8    5e-06    
ref|XP_005434757.1|  PREDICTED: protein Hikeshi-like                  57.0    5e-06    
ref|XP_007900552.1|  PREDICTED: protein Hikeshi                       55.8    5e-06    
ref|XP_009049740.1|  hypothetical protein LOTGIDRAFT_141873           55.8    5e-06    
gb|AFM86128.1|  hypothetical protein                                  55.8    5e-06    
ref|XP_009657989.1|  DUF775 domain-containing protein                 55.8    5e-06    
gb|EKG13500.1|  hypothetical protein MPH_09368                        56.2    6e-06    
ref|XP_008396898.1|  PREDICTED: protein Hikeshi isoform X1            55.8    6e-06    
gb|KIN00233.1|  hypothetical protein OIDMADRAFT_145733                55.8    6e-06    
ref|XP_009966509.1|  PREDICTED: protein Hikeshi                       55.5    7e-06    
gb|KFB42117.1|  AGAP002426-PA-like protein                            55.5    7e-06    
gb|EKV10345.1|  hypothetical protein PDIP_60610                       55.8    7e-06    
ref|XP_003175707.1|  DUF775 domain-containing protein                 55.8    7e-06    
gb|KIK23960.1|  hypothetical protein PISMIDRAFT_426188                55.5    1e-05    
ref|XP_003715264.1|  hypothetical protein MGG_07078                   55.1    1e-05    
emb|CAF89643.1|  unnamed protein product                              55.1    1e-05    
ref|XP_011618306.1|  PREDICTED: protein Hikeshi                       54.7    1e-05    
ref|XP_001661201.1|  AAEL010953-PA                                    54.7    1e-05    
gb|KFY68348.1|  hypothetical protein V496_01145                       55.5    1e-05    
ref|XP_007316826.1|  hypothetical protein SERLADRAFT_463922           54.7    1e-05    
ref|XP_006962465.1|  predicted protein                                54.7    2e-05    
ref|XP_004361218.1|  OPI10 family protein                             54.3    2e-05    
emb|CCE34316.1|  uncharacterized protein CPUR_08248                   54.7    2e-05    
gb|KIJ16303.1|  hypothetical protein PAXINDRAFT_168457                54.7    2e-05    
emb|CEJ95132.1|  Putative Protein OPI10                               54.3    2e-05    
gb|AFM86734.1|  hypothetical protein                                  54.3    2e-05    
gb|ELU03246.1|  hypothetical protein CAPTEDRAFT_191635                53.9    2e-05    
ref|XP_007394585.1|  hypothetical protein PHACADRAFT_91841            54.3    2e-05    
gb|KDB12178.1|  DUF775 domain-containing protein                      53.9    2e-05    
gb|ENH89333.1|  duf775 domain protein                                 53.9    3e-05    
gb|EPS32607.1|  hypothetical protein PDE_07567                        54.3    3e-05    
ref|XP_004928722.1|  PREDICTED: protein OPI10 homolog isoform X1      53.9    3e-05    
gb|EPX74378.1|  inositol metabolism protein Opi10                     53.9    3e-05    
gb|KFH42343.1|  hypothetical protein ACRE_069360                      53.9    3e-05    
gb|EMT66106.1|  Protein OPI10                                         53.9    3e-05    
ref|XP_005579339.1|  PREDICTED: protein Hikeshi isoform X1            53.5    3e-05    
gb|AAW25708.1|  SJCHGC06240 protein                                   53.5    3e-05    
gb|KFA63882.1|  hypothetical protein S40285_10709                     54.7    3e-05    
emb|CAX71154.1|  hypothetical protein                                 53.5    3e-05    
ref|XP_003468627.1|  PREDICTED: protein Hikeshi                       53.9    3e-05    
gb|KFY75527.1|  hypothetical protein V499_04499                       54.3    3e-05    
ref|XP_007330846.1|  hypothetical protein AGABI1DRAFT_60712           53.5    4e-05    
gb|KIK96901.1|  hypothetical protein PAXRUDRAFT_825461                53.5    4e-05    
dbj|BAH72110.1|  ACYPI003146                                          53.1    5e-05    
ref|XP_001952280.1|  PREDICTED: protein OPI10 homolog                 53.1    5e-05    
ref|XP_001628400.1|  predicted protein                                52.8    6e-05    
ref|XP_008877145.1|  hypothetical protein H310_12020                  52.4    6e-05    
emb|CAX76568.1|  hypothetical protein                                 52.8    6e-05    
ref|XP_011859595.1|  PREDICTED: protein OPI10 homolog                 52.8    7e-05    
ref|XP_008956725.1|  PREDICTED: protein Hikeshi isoform X2            52.4    7e-05    
ref|XP_006033825.1|  PREDICTED: LOW QUALITY PROTEIN: protein Hikeshi  52.8    7e-05    
gb|KEQ85421.1|  hypothetical protein M438DRAFT_354493                 52.8    7e-05    
ref|XP_003020964.1|  hypothetical protein TRV_04925                   53.1    7e-05    
ref|NP_001278215.1|  protein Hikeshi isoform b                        52.0    8e-05    
ref|XP_002108733.1|  hypothetical protein TRIADDRAFT_19969            52.4    8e-05    
gb|EFB29209.1|  hypothetical protein PANDA_005566                     52.0    8e-05    
ref|XP_789731.3|  PREDICTED: protein Hikeshi                          52.4    8e-05    
gb|EHK46247.1|  hypothetical protein TRIATDRAFT_89641                 52.4    9e-05    
ref|XP_004868285.1|  PREDICTED: protein Hikeshi isoform X1            52.4    9e-05    
ref|XP_007911334.1|  putative duf775 domain-containing protein        52.4    1e-04    
ref|XP_007284974.1|  duf775 domain protein                            51.6    1e-04    
ref|XP_007832471.1|  hypothetical protein PFICI_05699                 52.4    1e-04    
gb|KIO11268.1|  hypothetical protein M404DRAFT_839269                 52.4    1e-04    
gb|KIY71332.1|  DUF775-domain-containing protein                      52.0    1e-04    
gb|EAW75134.1|  hypothetical protein HSPC138, isoform CRA_b           51.6    1e-04    
ref|XP_009269298.1|  Protein OPI10-like protein                       51.6    1e-04    
ref|XP_006677888.1|  hypothetical protein BATDEDRAFT_24016            52.8    1e-04    
emb|CAX76565.1|  hypothetical protein                                 51.6    1e-04    
gb|ETS05142.1|  duf775 domain-containing protein                      52.0    1e-04    
ref|XP_009849754.1|  hypothetical protein NEUTE1DRAFT_145523          52.0    1e-04    
gb|KFY43910.1|  hypothetical protein V495_03699                       52.0    2e-04    
dbj|GAN08823.1|  inositol metabolism protein Opi10                    51.6    2e-04    
emb|CEP13776.1|  hypothetical protein                                 53.1    2e-04    
ref|XP_007007882.1|  hypothetical protein TREMEDRAFT_35429            51.2    2e-04    
gb|KEQ59571.1|  hypothetical protein M437DRAFT_56331                  51.6    2e-04    
ref|XP_001843282.1|  conserved hypothetical protein                   51.2    2e-04    
gb|ENN74474.1|  hypothetical protein YQE_08920                        51.2    2e-04    
gb|KFA77089.1|  hypothetical protein S40288_11330                     51.2    2e-04    
gb|KEY66592.1|  hypothetical protein S7711_01886                      51.2    2e-04    
gb|ERE77963.1|  Protein of unknown function DUF775 containing pro...  51.6    2e-04    
gb|KEQ76332.1|  hypothetical protein M436DRAFT_61583                  51.2    2e-04    
ref|XP_003701132.1|  PREDICTED: protein OPI10 homolog                 51.2    2e-04    
ref|XP_962698.1|  hypothetical protein NCU08028                       51.6    2e-04    
ref|XP_003234460.1|  hypothetical protein TERG_05057                  51.6    2e-04    
gb|EZF23647.1|  hypothetical protein H100_03735                       51.6    2e-04    
ref|XP_003837214.1|  similar to DUF775 domain protein                 51.2    3e-04    
gb|KFD55302.1|  hypothetical protein M513_03943                       52.4    3e-04    
gb|EFX04288.1|  duf775 domain containing protein                      50.8    3e-04    
gb|EQK99260.1|  DUF775 domain-containing protein                      50.8    3e-04    
ref|XP_001939300.1|  hypothetical protein PTRG_08968                  50.8    4e-04    
ref|XP_008151871.1|  PREDICTED: protein Hikeshi                       50.1    4e-04    
ref|XP_003031006.1|  hypothetical protein SCHCODRAFT_56836            50.4    4e-04    
gb|KFX95594.1|  hypothetical protein V490_03768                       50.8    4e-04    
emb|CDR42433.1|  CYFA0S09e03488g1_1                                   50.4    5e-04    
ref|XP_312519.3|  AGAP002426-PA                                       50.1    5e-04    
gb|KFY04197.1|  hypothetical protein O988_00931                       50.8    5e-04    
gb|EHJ72445.1|  hypothetical protein KGM_09337                        50.1    5e-04    
gb|KJX92586.1|  DUF775-domain-containing protein                      50.1    5e-04    
ref|XP_009164154.1|  hypothetical protein T265_12855                  50.1    5e-04    
gb|EPB87332.1|  hypothetical protein HMPREF1544_05857                 50.1    6e-04    
ref|NP_001013919.1|  protein Hikeshi                                  49.3    6e-04    
gb|KEY78117.1|  hypothetical protein BA78_7075                        50.4    6e-04    
ref|XP_007666293.1|  PREDICTED: protein Hikeshi                       49.3    6e-04    
ref|XP_004339490.1|  hypothetical protein ACA1_062190                 49.3    7e-04    
ref|XP_753538.1|  DUF775 domain protein                               50.1    8e-04    
ref|XP_004709007.1|  PREDICTED: protein Hikeshi                       49.3    8e-04    
emb|CEI99162.1|  hypothetical protein RMCBS344292_13254               49.7    9e-04    
gb|KHJ45151.1|  C-5 cytosine-specific DNA methylase                   50.8    0.001    
gb|KFY30822.1|  hypothetical protein V493_01632                       49.7    0.001    
ref|XP_003305031.1|  hypothetical protein PTT_17765                   49.7    0.001    



>ref|XP_004239629.1| PREDICTED: protein OPI10 homolog [Solanum lycopersicum]
 ref|XP_010321300.1| PREDICTED: protein OPI10 homolog [Solanum lycopersicum]
Length=187

 Score =   363 bits (931),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QID THW+LDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDPTHWVLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG+LQLTADATP+SAKIG+SVE+LATL
Sbjct  61   AVYIQSPGSPFLFCGAVTLTRPSAVLSLPWPEPGGQLQLTADATPISAKIGISVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDVAAG+KIERLA+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVAAGQKIERLALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_009780094.1| PREDICTED: protein OPI10 homolog [Nicotiana sylvestris]
 ref|XP_009780095.1| PREDICTED: protein OPI10 homolog [Nicotiana sylvestris]
Length=187

 Score =   362 bits (929),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDTTHW+LDMNTFVGEAYDSIREVCIFL+NNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDTTHWVLDMNTFVGEAYDSIREVCIFLINNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG+LQLTADATP+SAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSPFLFCGAVTLTRPSAVLSLPWPEPGGQLQLTADATPVSAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A KKIERLA+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKKIERLALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_006345750.1| PREDICTED: protein OPI10 homolog [Solanum tuberosum]
Length=187

 Score =   361 bits (927),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QID THW+LDMNTFVGEAYDSIREVCIFLLNN TLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDPTHWVLDMNTFVGEAYDSIREVCIFLLNNLTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG+LQLTADATP+SAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSPFLFCGAVTLTRPSAVLSLPWPEPGGQLQLTADATPISAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDVAAG+KIERLA+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVAAGQKIERLALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_009595494.1| PREDICTED: protein OPI10 homolog [Nicotiana tomentosiformis]
Length=187

 Score =   357 bits (917),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QI TTHW+LDMNTFVGEAYDSIREVCIFL+NNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIGTTHWVLDMNTFVGEAYDSIREVCIFLINNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG+LQLTADATP+SAKIGVSVE+LA L
Sbjct  61   AVYIQSPGSPFLFCGAVTLTRPSAVLSLPWPEPGGQLQLTADATPVSAKIGVSVEDLAAL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A KKIERLA+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKKIERLALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_008343048.1| PREDICTED: protein Hikeshi-like [Malus domestica]
 ref|XP_008343049.1| PREDICTED: protein Hikeshi-like [Malus domestica]
Length=187

 Score =   352 bits (902),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDMNTFVGEAYD + E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMNTFVGEAYDQVXELCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSAVLSLPWPEPGG+LQLTADATPLSAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSAFFFCGAVTVARPSAVLSLPWPEPGGQLQLTADATPLSAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>emb|CDP01674.1| unnamed protein product [Coffea canephora]
Length=188

 Score =   350 bits (898),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 182/188 (97%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+FTQIDT HW+LDMNTFVGEAYDSIRE+CIFLLNNFTLPP+KAL
Sbjct  1    MFGVVFPNRSFPMDISTFTQIDTFHWILDMNTFVGEAYDSIREICIFLLNNFTLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFL+CGAVT++RPSAVLSLPWPEPGG+LQLTA D+ PLSAKIGVSVE+L++
Sbjct  61   AVYIQSPGSPFLYCGAVTITRPSAVLSLPWPEPGGQLQLTAPDSAPLSAKIGVSVEDLSS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA KKIERLAMKVGENLF+FMQSFCGVDGSKL+VPMDILDRWFK FQERA RDP
Sbjct  121  LPSLDVAAEKKIERLAMKVGENLFHFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGFAL
Sbjct  181  EYLKGFAL  188



>ref|XP_008229209.1| PREDICTED: protein OPI10 homolog [Prunus mume]
 ref|XP_008229210.1| PREDICTED: protein OPI10 homolog [Prunus mume]
Length=187

 Score =   348 bits (894),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDMNTFVGEAY+ +RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMNTFVGEAYNQVREMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSAVL+LPWPEPGGELQLTAD+ PLSAKIGVSVE+LA+L
Sbjct  61   AVYIQSPGSSFFFCGAVTVARPSAVLALPWPEPGGELQLTADSVPLSAKIGVSVEDLASL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_006494083.1| PREDICTED: protein OPI10 homolog [Citrus sinensis]
 gb|KDO44480.1| hypothetical protein CISIN_1g041772mg [Citrus sinensis]
Length=188

 Score =   342 bits (877),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 179/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMN+FVGEAYD +R++CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFSQIDTFHWILDMNSFVGEAYDQVRDMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFL+CGAVT++RPSAVLSLPWPEPGG +QLTA D+TPLSAKIGVSVE+L +
Sbjct  61   AVYIQSPGSPFLYCGAVTVARPSAVLSLPWPEPGGGMQLTAPDSTPLSAKIGVSVEDLTS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQE+A RDP
Sbjct  121  LPSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGFAL
Sbjct  181  EYLKGFAL  188



>ref|XP_008381331.1| PREDICTED: protein Hikeshi-like [Malus domestica]
Length=187

 Score =   341 bits (875),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDMNTFVGE YD +RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMNTFVGEEYDQVRELCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGA+T++RPSAVL+LPWP  GG+L LTADA PLSAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSAFFFCGAITVARPSAVLALPWPXQGGQLXLTADAAPLSAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_009334419.1| PREDICTED: protein OPI10 homolog [Pyrus x bretschneideri]
Length=187

 Score =   341 bits (875),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDMNTFVGEAYD + E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMNTFVGEAYDQVHELCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSAVLSLPWPEPGG+LQLTADATPLSAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSAFFFCGAVTVARPSAVLSLPWPEPGGQLQLTADATPLSAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLA++ G +LFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKRIERLAVEGGGDLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_007215039.1| hypothetical protein PRUPE_ppa012019mg [Prunus persica]
 gb|EMJ16238.1| hypothetical protein PRUPE_ppa012019mg [Prunus persica]
Length=187

 Score =   340 bits (873),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDM TFVGEAY  +RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMKTFVGEAYAQVREMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSAVLSLPWP PGGELQLTADA PLSAKIGVSVE+LA+L
Sbjct  61   AVYIQSPGSSFFFCGAVTVARPSAVLSLPWPAPGGELQLTADAVPLSAKIGVSVEDLASL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IER+AMKVGENLFNFMQSFCGVDGSKL+VP DILDRWF  FQERA RDPE
Sbjct  121  PSLDVTAEKRIERMAMKVGENLFNFMQSFCGVDGSKLVVPTDILDRWFNKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  181  YLKGFAL  187



>ref|XP_006421091.1| hypothetical protein CICLE_v10005984mg [Citrus clementina]
 gb|ESR34331.1| hypothetical protein CICLE_v10005984mg [Citrus clementina]
Length=188

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMN+FVGEAYD +R++CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFSQIDTFHWILDMNSFVGEAYDQVRDMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFL+CGAVT++RPSAVLSLPWPEPGG +QLTA D+TPLSAKIGVSVE+L +
Sbjct  61   AVYIQSPGSPFLYCGAVTVARPSAVLSLPWPEPGGGMQLTAPDSTPLSAKIGVSVEDLTS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKLIVP DILDRWFK FQE+A RDP
Sbjct  121  LPSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLIVPTDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGFAL
Sbjct  181  EYLKGFAL  188



>ref|XP_012082758.1| PREDICTED: protein OPI10 homolog [Jatropha curcas]
 ref|XP_012082759.1| PREDICTED: protein OPI10 homolog [Jatropha curcas]
 ref|XP_012082760.1| PREDICTED: protein OPI10 homolog [Jatropha curcas]
 gb|KDP28155.1| hypothetical protein JCGZ_13926 [Jatropha curcas]
Length=188

 Score =   340 bits (871),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD +RE+CIFLLNNFTLPP+KAL
Sbjct  1    MFGVVFPNRSFPMDISAFSQIDTFHWVLDMNTFVGEAYDQVREMCIFLLNNFTLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGSPF FCGAVT++RPSAVLSL WP+PGG+LQLTA D+ PLSAKIGVSVE+LA+
Sbjct  61   AVYIQSPGSPFQFCGAVTIARPSAVLSLNWPDPGGQLQLTATDSAPLSAKIGVSVEDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA K+IERLAMKVGENLFN+MQSFCGVDGSKLIVPMDILDRWFK FQERA RDP
Sbjct  121  LPSLDVAAEKRIERLAMKVGENLFNYMQSFCGVDGSKLIVPMDILDRWFKKFQERAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGF L
Sbjct  181  EYLKGFDL  188



>ref|XP_004288368.1| PREDICTED: protein OPI10 homolog [Fragaria vesca subsp. vesca]
 ref|XP_011467230.1| PREDICTED: protein OPI10 homolog [Fragaria vesca subsp. vesca]
Length=187

 Score =   339 bits (870),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDI+SF+QIDT HW+LDMNTFVGEAYD +RE+CIFLLN F LPPDKAL
Sbjct  1    MFGVVFPNRSFPMDITSFSQIDTFHWVLDMNTFVGEAYDQVREMCIFLLNGFQLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSAVL+LPWPEPG +LQLTADA  LSAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSAFFFCGAVTVARPSAVLALPWPEPGDQLQLTADAAQLSAKIGVSVEDLATL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  PSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLKGF L
Sbjct  181  YLKGFVL  187



>ref|XP_011085888.1| PREDICTED: protein OPI10 homolog [Sesamum indicum]
Length=190

 Score =   338 bits (868),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQID+THWLLDMN FVGE+YDSIRE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPLDISTFTQIDSTHWLLDMNHFVGESYDSIREICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG-GEL-QLTA-DATPLSAKIGVSVEEL  440
            A+YIQSPGSPFLFCGAVT+SRPSAVLSLPWPEPG G + QLTA DA PLSAKIGVSVE+L
Sbjct  61   ALYIQSPGSPFLFCGAVTISRPSAVLSLPWPEPGSGSVPQLTAPDAPPLSAKIGVSVEDL  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LPSLDVAA +KIERLA+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  AALPSLDVAAERKIERLALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DPEYLKGFAL
Sbjct  181  DPEYLKGFAL  190



>ref|XP_010242568.1| PREDICTED: protein OPI10 homolog [Nelumbo nucifera]
Length=188

 Score =   338 bits (868),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+FPNRSFPMDIS+FTQIDTTHW+LDMNTFVGEAYD IR++CIFLLN FTLPPDKAL
Sbjct  1    MFGVLFPNRSFPMDISTFTQIDTTHWVLDMNTFVGEAYDQIRDMCIFLLNGFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFLFCGAV++SRPSAVLSLPWPEPGG+LQLT+ D+ PLSAKIGVSVE+LA+
Sbjct  61   AVYIQSPGSPFLFCGAVSVSRPSAVLSLPWPEPGGQLQLTSPDSAPLSAKIGVSVEDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDV A K++E LA+KVGENLFNFMQSFCGVDGS+L+VPMDILDRWFK FQERA RDP
Sbjct  121  LPSLDVTAQKRVEHLALKVGENLFNFMQSFCGVDGSRLVVPMDILDRWFKKFQERAKRDP  180

Query  253  EYLKGFAL  230
            +YLKGF L
Sbjct  181  DYLKGFVL  188



>ref|XP_002523076.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39261.1| conserved hypothetical protein [Ricinus communis]
Length=188

 Score =   338 bits (867),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+FPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD IRE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVLFPNRSFPMDISTFSQIDTFHWILDMNTFVGEAYDQIREICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVY+QSPGSPF FCGAVTL+RPSAVLSL WP+PGG+LQL+A D++PLSAKIGVSVE+LA+
Sbjct  61   AVYVQSPGSPFQFCGAVTLARPSAVLSLNWPDPGGQLQLSAPDSSPLSAKIGVSVEDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA K+IERLAMKVGENLFN+MQSFCGVDGS+LIVPMDILDRWFK FQE+A RDP
Sbjct  121  LPSLDVAAEKRIERLAMKVGENLFNYMQSFCGVDGSRLIVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGF L
Sbjct  181  EYLKGFDL  188



>ref|XP_004145632.1| PREDICTED: protein OPI10 homolog [Cucumis sativus]
 gb|KGN57715.1| hypothetical protein Csa_3G258170 [Cucumis sativus]
Length=188

 Score =   337 bits (865),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD IRE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISAFSQIDTFHWVLDMNTFVGEAYDQIREICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLT-ADATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG++QL   D+ PLSAKIGVSV++LA+
Sbjct  61   AVYIQSPGSPFLFCGAVTLARPSAVLSLPWPEPGGQMQLMPPDSAPLSAKIGVSVQDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            L SLDV A K+IERLA+KVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQE+A RDP
Sbjct  121  LQSLDVTAEKRIERLALKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGF L
Sbjct  181  EYLKGFVL  188



>ref|XP_008461564.1| PREDICTED: protein Hikeshi [Cucumis melo]
Length=188

 Score =   337 bits (864),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 176/188 (94%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD IRE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISAFSQIDTFHWVLDMNTFVGEAYDQIREMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLT-ADATPLSAKIGVSVEELAT  434
            AVYIQSPGSPFLFCGAVTL+RPSAVLSLPWPEPGG++QL   D+ PLSAKIGVSV++LA+
Sbjct  61   AVYIQSPGSPFLFCGAVTLARPSAVLSLPWPEPGGQMQLMPPDSAPLSAKIGVSVQDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            L SLDV A K+IERLA+KVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQE+A RDP
Sbjct  121  LQSLDVTAEKRIERLALKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGF L
Sbjct  181  EYLKGFVL  188



>ref|XP_007050064.1| Uncharacterized protein TCM_003748 [Theobroma cacao]
 gb|EOX94221.1| Uncharacterized protein TCM_003748 [Theobroma cacao]
Length=188

 Score =   336 bits (861),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSFTQIDT HW+LDMNTFVGEAYD  RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFTQIDTFHWILDMNTFVGEAYDQTREICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVY+QSPGSPF+FCGAVTL RPSAVLSL WPE GG++QLTA D+  LSAKIGVSVE+LA 
Sbjct  61   AVYVQSPGSPFVFCGAVTLQRPSAVLSLLWPELGGQMQLTAPDSATLSAKIGVSVEDLAA  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA KKIERLA+KVGENLFNFMQSFCGVDGS+L+VPMDILDRWFK FQE+A RDP
Sbjct  121  LPSLDVAAEKKIERLALKVGENLFNFMQSFCGVDGSRLVVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            +YLKGFAL
Sbjct  181  DYLKGFAL  188



>ref|XP_002265803.1| PREDICTED: protein OPI10 homolog [Vitis vinifera]
 emb|CAN77663.1| hypothetical protein VITISV_027383 [Vitis vinifera]
 emb|CAQ58596.1| Unknown gene [Vitis vinifera]
 emb|CBI28635.3| unnamed protein product [Vitis vinifera]
Length=190

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD +RE+CIFLLN+F+LP DKAL
Sbjct  1    MFGVVFPNRSFPMDISTFSQIDTFHWVLDMNTFVGEAYDQVRELCIFLLNSFSLPADKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADA-TPLSAKIGVSVEEL  440
            AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP  GGE++LTA    PLSAKIGVSVE+L
Sbjct  61   AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGSGGEMRLTASGDAPLSAKIGVSVEDL  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LPSLDVAA K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK F+ERA R
Sbjct  121  AALPSLDVAAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFRERAKR  180

Query  259  DPEYLKGFAL  230
            DPEYLKGFAL
Sbjct  181  DPEYLKGFAL  190



>ref|XP_003544973.1| PREDICTED: protein Hikeshi-like [Glycine max]
Length=189

 Score =   333 bits (854),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMNTFVGEAYD +RE+CIFLLN FTLPP+KAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDTFHWVLDMNTFVGEAYDQVRELCIFLLNGFTLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADATPLSAKIGVSVEELA  437
            AVYIQSPGSPF+FCGAVT++RPSAVL+L WPEP  GG LQLTADA PLSAKIGVSVE+LA
Sbjct  61   AVYIQSPGSPFVFCGAVTVARPSAVLTLAWPEPGAGGPLQLTADAQPLSAKIGVSVEDLA  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            +LPSLD+AA K+IE LAMKVGENLFNFMQSFCGVDGSKL+VPMDIL+RWFK FQERA RD
Sbjct  121  SLPSLDMAAEKRIEGLAMKVGENLFNFMQSFCGVDGSKLVVPMDILERWFKKFQERARRD  180

Query  256  PEYLKGFAL  230
            PEYLKGFAL
Sbjct  181  PEYLKGFAL  189



>ref|XP_003616198.1| OPI10-like protein [Medicago truncatula]
 gb|AES99156.1| OPI10-like protein [Medicago truncatula]
Length=190

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HW+LDMNTFVGEAYD + E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFSQIDTFHWILDMNTFVGEAYDQVTEICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGG---ELQLTADATPLSAKIGVSVEEL  440
            AVY+QSPGSPF+FCGAVT++RPSAVLSL WPEPG    + QLTADA P+SAKIGVSVE+L
Sbjct  61   AVYVQSPGSPFVFCGAVTIARPSAVLSLLWPEPGSGAIQPQLTADAVPISAKIGVSVEDL  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A+L S+DVA  K+IERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQERA R
Sbjct  121  ASLNSIDVAGEKRIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DPEYLKGFAL
Sbjct  181  DPEYLKGFAL  190



>ref|XP_003518366.1| PREDICTED: protein Hikeshi-like [Glycine max]
Length=189

 Score =   332 bits (851),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 175/188 (93%), Gaps = 2/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMNTFVGEA+D +RE+CIFLLN +TLPP+KAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDTFHWVLDMNTFVGEAFDQVRELCIFLLNGYTLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADATPLSAKIGVSVEELA  437
            AVYIQSPGSPF+FCGAVT++RPSAVL+L WPEP  GG +QLTADA PLSAKIGVSVE+LA
Sbjct  61   AVYIQSPGSPFVFCGAVTVARPSAVLTLAWPEPGAGGPMQLTADAQPLSAKIGVSVEDLA  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            +LPSLDVAA K+IE LAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQERA RD
Sbjct  121  SLPSLDVAAEKRIEGLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERARRD  180

Query  256  PEYLKGFA  233
            PEYLKGFA
Sbjct  181  PEYLKGFA  188



>ref|XP_004490798.1| PREDICTED: uncharacterized protein LOC101493272 [Cicer arietinum]
Length=190

 Score =   332 bits (850),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMNTFVGEAYD + E+CIFL+NNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDTFHWILDMNTFVGEAYDQVSEICIFLINNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGG---ELQLTADATPLSAKIGVSVEEL  440
            AVY+QSPGSPF++CGAVT++RPSAVLSL WPEPG    + QLTADA PLSAKIGVSVE+L
Sbjct  61   AVYVQSPGSPFVYCGAVTIARPSAVLSLLWPEPGAGDVQPQLTADAQPLSAKIGVSVEDL  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
             +LPS+DVA  K+IERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQERA R
Sbjct  121  VSLPSIDVAGEKRIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP+YLKGFAL
Sbjct  181  DPQYLKGFAL  190



>gb|EYU34526.1| hypothetical protein MIMGU_mgv1a021479mg [Erythranthe guttata]
Length=190

 Score =   332 bits (850),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 175/190 (92%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQID THWLLDMN FVGE+YDS+ E+CIFLLN ++LPPDKAL
Sbjct  1    MFGVVFPNRSFPLDISTFTQIDGTHWLLDMNHFVGESYDSVTEICIFLLNTYSLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGEL--QLTA-DATPLSAKIGVSVEEL  440
            A+YIQSPGS FLFCGAVTLSRPSAVLSLPWPEPGG    QLTA DA PLSAKIGVSVE+L
Sbjct  61   ALYIQSPGSSFLFCGAVTLSRPSAVLSLPWPEPGGGTVPQLTAPDAPPLSAKIGVSVEDL  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LPSLDVAA ++IERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQERA R
Sbjct  121  AALPSLDVAAERRIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DPEYLKGFAL
Sbjct  181  DPEYLKGFAL  190



>ref|XP_007141943.1| hypothetical protein PHAVU_008G239100g [Phaseolus vulgaris]
 gb|ESW13937.1| hypothetical protein PHAVU_008G239100g [Phaseolus vulgaris]
Length=189

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 174/189 (92%), Gaps = 2/189 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMNTFVGEAYD +R++CIFLLN FTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFAQIDTFHWVLDMNTFVGEAYDQVRDLCIFLLNGFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTADATPLSAKIGVSVEELA  437
            AVYIQSPGSPF+FCGAVT++RPSAVL+L WPEPG  G LQLTAD+  LSAKIGVSVE+LA
Sbjct  61   AVYIQSPGSPFVFCGAVTVARPSAVLTLSWPEPGAPGPLQLTADSQTLSAKIGVSVEDLA  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            +LPSLDV A  +IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDIL+RWFK FQERA RD
Sbjct  121  SLPSLDVGAETRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILNRWFKKFQERAKRD  180

Query  256  PEYLKGFAL  230
            PEYLKGFAL
Sbjct  181  PEYLKGFAL  189



>ref|XP_009371835.1| PREDICTED: protein OPI10 homolog [Pyrus x bretschneideri]
Length=179

 Score =   325 bits (834),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 169/187 (90%), Gaps = 8/187 (4%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDISSF+QIDT HW+LDMNTFVGEAYD +RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISSFSQIDTFHWILDMNTFVGEAYDQVRELCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGS F FCGAVT++RPSA L+LPW        LTADA PLSAKIGVSVE+LATL
Sbjct  61   AVYIQSPGSAFFFCGAVTVARPSAGLALPW--------LTADAAPLSAKIGVSVEDLATL  112

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            PSLDV A K+IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  113  PSLDVTAEKRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKRDPE  172

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  173  YLKGFAL  179



>ref|XP_010669406.1| PREDICTED: protein OPI10 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010669407.1| PREDICTED: protein OPI10 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010669408.1| PREDICTED: protein OPI10 homolog [Beta vulgaris subsp. vulgaris]
Length=189

 Score =   324 bits (831),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+F QIDT HW+LDMN FVGEAYD I+E+CIFLLNNFTLP DKAL
Sbjct  1    MFGVVFPNRSFPLDISTFAQIDTMHWVLDMNHFVGEAYDQIKEMCIFLLNNFTLPADKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTADATPLSAKIGVSVEELA  437
            AVY+QSPGSPF++CGAVT+SRPSAVLSL WPEPG  G  Q+TAD+ PLSAKIGVSV++L+
Sbjct  61   AVYVQSPGSPFVYCGAVTVSRPSAVLSLLWPEPGTQGHFQITADSAPLSAKIGVSVQDLS  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            +L SLD+AA KKIE  A+KVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK FQERA RD
Sbjct  121  SLQSLDIAADKKIEHTALKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKKFQERAKRD  180

Query  256  PEYLKGFAL  230
            P+YLKGF L
Sbjct  181  PDYLKGFTL  189



>gb|KHN39486.1| Hypothetical protein glysoja_016873 [Glycine soja]
Length=217

 Score =   325 bits (833),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 181/216 (84%), Gaps = 10/216 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPM+IS+F QIDT HW+LDMNTFVGEA+D +RE+CIFLLN +TLPP+KAL
Sbjct  1    MFGVVFPNRSFPMEISTFAQIDTFHWVLDMNTFVGEAFDQVRELCIFLLNGYTLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQSPGSPF+FCGAVT +RPSAVL+L W  PGG +Q  ADA PLSAKIGVSVE+LA+L
Sbjct  61   AVYIQSPGSPFVFCGAVTGARPSAVLTLAWAGPGGPMQRPADAQPLSAKIGVSVEDLASL  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
             SLD+AA K+IE LAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA RDPE
Sbjct  121  SSLDMAAEKRIEGLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERARRDPE  180

Query  250  YLKGFAL*FHSIFNFQFCVRISYVQIQIPSFPMKSM  143
            YLKGFA          F  R+S  ++Q+  F  +SM
Sbjct  181  YLKGFA----------FVPRMSTGELQVVHFENRSM  206



>ref|XP_010110104.1| hypothetical protein L484_013280 [Morus notabilis]
 gb|EXC25191.1| hypothetical protein L484_013280 [Morus notabilis]
Length=193

 Score =   323 bits (829),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 174/193 (90%), Gaps = 6/193 (3%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F+QIDT HWLLDMNTFVG+AYD +RE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISAFSQIDTFHWLLDMNTFVGDAYDQVREICIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP-----GGELQL-TADATPLSAKIGVSV  449
            AVY QSPGSPF+FCGAVTL+RPSAVLSLPWP+P     G +LQ+  ADA P SAKIGVSV
Sbjct  61   AVYAQSPGSPFVFCGAVTLARPSAVLSLPWPDPPSAASGEQLQIAAADAVPPSAKIGVSV  120

Query  448  EELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQER  269
            E+LA LPSLDVAA K+IE LAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+
Sbjct  121  EDLALLPSLDVAAEKRIELLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEK  180

Query  268  AIRDPEYLKGFAL  230
            A RDPE+LK FAL
Sbjct  181  AKRDPEFLKRFAL  193



>ref|XP_002305236.1| hypothetical protein POPTR_0004s08040g [Populus trichocarpa]
 gb|ABK94342.1| unknown [Populus trichocarpa]
 gb|EEE85747.1| hypothetical protein POPTR_0004s08040g [Populus trichocarpa]
Length=188

 Score =   323 bits (829),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+RSFPMDIS+F+QIDT HW+LDMNTFVGEAYD +RE+CIFLLN+FTLPPDKAL
Sbjct  1    MFGVVFPDRSFPMDISAFSQIDTFHWILDMNTFVGEAYDQVREICIFLLNSFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGS F FCGAVT++RPSAVL+L WPEPGG+LQLT  D  PLSAKIGVSVE+LA+
Sbjct  61   AVYIQSPGSEFQFCGAVTITRPSAVLTLNWPEPGGQLQLTGPDTAPLSAKIGVSVEDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA K +ER+AMKVGENLFN+MQSFCGVDGSKLIVPMDILDRWFK F+ERA RDP
Sbjct  121  LPSLDVAAEKGVERVAMKVGENLFNYMQSFCGVDGSKLIVPMDILDRWFKKFRERAKRDP  180

Query  253  EYLKGFAL  230
            ++LK F L
Sbjct  181  DFLKSFRL  188



>gb|KJB46925.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
 gb|KJB46926.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
 gb|KJB46930.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
Length=229

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 6/196 (3%)
 Frame = -2

Query  814  GRRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF  635
            GRR     MFGVVFPNRSFPMDISSFTQIDT HW+LDMNTFVGE+Y  I ++CIFLLNNF
Sbjct  39   GRR-----MFGVVFPNRSFPMDISSFTQIDTFHWVLDMNTFVGESYHQIGDMCIFLLNNF  93

Query  634  TLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIG  458
            TLPPDKALAVY+QSPGSPF+FCGAVTL RPSAVLSL WPEPGG++QLTA D+   SAKIG
Sbjct  94   TLPPDKALAVYVQSPGSPFVFCGAVTLQRPSAVLSLIWPEPGGQMQLTAPDSAAPSAKIG  153

Query  457  VSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            VSVE+L  LPSLDVAA KKIER+A+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK F
Sbjct  154  VSVEDLVALPSLDVAAEKKIERMALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKF  213

Query  277  QERAIRDPEYLKGFAL  230
            QE+A RD ++LKGFAL
Sbjct  214  QEKAKRDSDFLKGFAL  229



>ref|XP_010551467.1| PREDICTED: protein Hikeshi isoform X1 [Tarenaya hassleriana]
 ref|XP_010551475.1| PREDICTED: protein Hikeshi isoform X2 [Tarenaya hassleriana]
Length=191

 Score =   323 bits (827),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 4/191 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMN FVGEAYD IRE+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISNFVQIDTFHWVLDMNHFVGEAYDQIREMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGG---ELQL-TADATPLSAKIGVSVEE  443
            A+Y+QSPGS F+FCGAVTL+RPSAVLSL WPEPGG   +LQL  ADA PLSAKIG+SVE+
Sbjct  61   AIYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGGAAEQLQLMAADAAPLSAKIGISVED  120

Query  442  LATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAI  263
             A LPSLDVAA ++IERLAM+VGENLFNFMQSFCG+DGS+L+VPMDILDRWFK FQE+A 
Sbjct  121  AAALPSLDVAAERRIERLAMRVGENLFNFMQSFCGIDGSRLVVPMDILDRWFKKFQEKAK  180

Query  262  RDPEYLKGFAL  230
            RDP++LK FAL
Sbjct  181  RDPDFLKSFAL  191



>ref|XP_011043894.1| PREDICTED: protein Hikeshi [Populus euphratica]
 ref|XP_011043895.1| PREDICTED: protein Hikeshi [Populus euphratica]
 ref|XP_011043896.1| PREDICTED: protein Hikeshi [Populus euphratica]
Length=188

 Score =   321 bits (823),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+RSFPMDIS+F+QIDT HW+LDMNTFVGEAYD +RE+CIFLLN+FTLPPDKAL
Sbjct  1    MFGVVFPDRSFPMDISAFSQIDTFHWILDMNTFVGEAYDQVREICIFLLNSFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELAT  434
            AVYIQSPGS F FCGAVT++RPS VL+L WPEPGG+LQLT  D  PLSAKIGVSVE+LA 
Sbjct  61   AVYIQSPGSEFQFCGAVTITRPSVVLTLNWPEPGGQLQLTGPDTAPLSAKIGVSVEDLAA  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LPSLDVAA K +ER+AMKVGENLFN+MQSFCGVDGSKLIVPMDILDRWFK F+ERA RDP
Sbjct  121  LPSLDVAAEKGVERVAMKVGENLFNYMQSFCGVDGSKLIVPMDILDRWFKKFRERAKRDP  180

Query  253  EYLKGFAL  230
            ++LK F L
Sbjct  181  DFLKSFRL  188



>ref|XP_009105185.1| PREDICTED: protein OPI10 homolog [Brassica rapa]
Length=190

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMN FVGEAYD I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFVQIDTFHWVLDMNHFVGEAYDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F FCGAVT+SRPSAVLSL WPEPG   ++QLTA D+ PLSAKIG+SVE+ 
Sbjct  61   AVYVQSPGSAFAFCGAVTVSRPSAVLSLQWPEPGSAAQMQLTAGDSGPLSAKIGISVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A+LPSLDVAA +KIERLAM+VGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  ASLPSLDVAAERKIERLAMRVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>emb|CDY39251.1| BnaC06g27400D [Brassica napus]
Length=190

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMN FVGEAYD I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFVQIDTFHWVLDMNHFVGEAYDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F FCGAVT+SRPSAVLSL WPEPG   ++QLTA D+TPLSAKIG+SVE+ 
Sbjct  61   AVYVQSPGSAFAFCGAVTVSRPSAVLSLQWPEPGSAAQMQLTAGDSTPLSAKIGISVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A+L SLDVAA +KIERLAM+VGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  ASLQSLDVAAERKIERLAMRVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>emb|CDY07480.1| BnaA07g25590D [Brassica napus]
Length=190

 Score =   319 bits (818),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT+HW+LDMN FVGEAYD I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPMDISTFVQIDTSHWVLDMNHFVGEAYDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F FCGAVT+SRPSAVLSL WPEPG   ++QLTA D+ PLSAKIG+SVE+ 
Sbjct  61   AVYVQSPGSAFAFCGAVTVSRPSAVLSLQWPEPGSAAQMQLTAGDSGPLSAKIGISVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A+L SLDVAA +KIERLAM+VGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  ASLQSLDVAAERKIERLAMRVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>emb|CDY16431.1| BnaA02g12350D [Brassica napus]
Length=190

 Score =   318 bits (816),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEA+D I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAFDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F FCGAVTLSRPSAVLSL WPE G   ++QLTA D+ PLSAKIG+SVE+ 
Sbjct  61   AVYVQSPGSAFAFCGAVTLSRPSAVLSLQWPEAGSAAQMQLTAGDSAPLSAKIGISVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LPSLDVAA +KIERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  AALPSLDVAAERKIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>emb|CDY50322.1| BnaCnng19050D [Brassica napus]
Length=190

 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEA+D I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAFDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F FCGAVTL+RPSAVLSL WPE G   ++QLTA D+ PLSAKIG+SVE+ 
Sbjct  61   AVYVQSPGSAFAFCGAVTLARPSAVLSLQWPEAGSAAQMQLTAGDSAPLSAKIGISVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LPSLDVAA +KIERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQERA R
Sbjct  121  AALPSLDVAAERKIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQERAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>ref|XP_006391345.1| hypothetical protein EUTSA_v10019182mg [Eutrema salsugineum]
 gb|ESQ28631.1| hypothetical protein EUTSA_v10019182mg [Eutrema salsugineum]
Length=190

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+F QIDT HW+LDMN FVGEAYD I E+CIFLLNNFTLPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFVQIDTFHWVLDMNHFVGEAYDQIGEMCIFLLNNFTLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGE--LQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG E  +QLTA +++PLSAKIGVSVE+ 
Sbjct  61   AVYVQSPGSGFVFCGAVTLNRPSAVLSLQWPEPGSEAQMQLTAGNSSPLSAKIGVSVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A L S+DVAAG++IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  121  AALQSMDVAAGRRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKSFAL  190



>gb|KJB46928.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
 gb|KJB46929.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
Length=227

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 171/192 (89%), Gaps = 6/192 (3%)
 Frame = -2

Query  814  GRRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF  635
            GRR     MFGVVFPNRSFPMDISSFTQIDT HW+LDMNTFVGE+Y  I ++CIFLLNNF
Sbjct  39   GRR-----MFGVVFPNRSFPMDISSFTQIDTFHWVLDMNTFVGESYHQIGDMCIFLLNNF  93

Query  634  TLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIG  458
            TLPPDKALAVY+QSPGSPF+FCGAVTL RPSAVLSL WPEPGG++QLTA D+   SAKIG
Sbjct  94   TLPPDKALAVYVQSPGSPFVFCGAVTLQRPSAVLSLIWPEPGGQMQLTAPDSAAPSAKIG  153

Query  457  VSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            VSVE+L  LPSLDVAA KKIER+A+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK F
Sbjct  154  VSVEDLVALPSLDVAAEKKIERMALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKF  213

Query  277  QERAIRDPEYLK  242
            QE+A RD ++LK
Sbjct  214  QEKAKRDSDFLK  225



>ref|XP_006302780.1| hypothetical protein CARUB_v10020900mg [Capsella rubella]
 gb|EOA35678.1| hypothetical protein CARUB_v10020900mg [Capsella rubella]
Length=227

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 173/197 (88%), Gaps = 3/197 (2%)
 Frame = -2

Query  811  RRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFT  632
            ++ +  +MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEAYD I E+CIFLLNNF 
Sbjct  31   QKTQNSKMFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAYDQISEMCIFLLNNFN  90

Query  631  LPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKI  461
            LPPDKALAVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D++ LSAKI
Sbjct  91   LPPDKALAVYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAQMQLTAGDSSSLSAKI  150

Query  460  GVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKI  281
            GVSVE+ A L S+DV A +KIE+LAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK 
Sbjct  151  GVSVEDAAALSSMDVVAERKIEKLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKK  210

Query  280  FQERAIRDPEYLKGFAL  230
            FQE+A RDP +LK FAL
Sbjct  211  FQEKAKRDPGFLKSFAL  227



>gb|KJB46927.1| hypothetical protein B456_008G001800 [Gossypium raimondii]
Length=241

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 171/193 (89%), Gaps = 6/193 (3%)
 Frame = -2

Query  814  GRRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF  635
            GRR     MFGVVFPNRSFPMDISSFTQIDT HW+LDMNTFVGE+Y  I ++CIFLLNNF
Sbjct  39   GRR-----MFGVVFPNRSFPMDISSFTQIDTFHWVLDMNTFVGESYHQIGDMCIFLLNNF  93

Query  634  TLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIG  458
            TLPPDKALAVY+QSPGSPF+FCGAVTL RPSAVLSL WPEPGG++QLTA D+   SAKIG
Sbjct  94   TLPPDKALAVYVQSPGSPFVFCGAVTLQRPSAVLSLIWPEPGGQMQLTAPDSAAPSAKIG  153

Query  457  VSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            VSVE+L  LPSLDVAA KKIER+A+KVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK F
Sbjct  154  VSVEDLVALPSLDVAAEKKIERMALKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKF  213

Query  277  QERAIRDPEYLKG  239
            QE+A RD ++LK 
Sbjct  214  QEKAKRDSDFLKA  226



>gb|KFK41028.1| hypothetical protein AALP_AA2G075800 [Arabis alpina]
Length=521

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMDIS+F QIDT HW+LDMN FVGEAYD I ++CIFLLNNFTLPPDKAL
Sbjct  332  MFGVVFPNRSFPMDISTFVQIDTFHWVLDMNHFVGEAYDQIGDMCIFLLNNFTLPPDKAL  391

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D+TPLSAKIG+SVE+ 
Sbjct  392  AVYVQSPGSAFVFCGAVTLNRPSAVLSLQWPEPGTAAKMQLTAGDSTPLSAKIGISVEDA  451

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A L S+DVAAG++IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  452  AALQSMDVAAGRRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  511

Query  259  DPEYLKGFAL  230
            DP++LK FAL
Sbjct  512  DPDFLKTFAL  521



>ref|NP_176782.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51306.1|AC026480_13 hypothetical protein [Arabidopsis thaliana]
 gb|AAQ22662.1| At1g66080 [Arabidopsis thaliana]
 dbj|BAF01340.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34460.1| uncharacterized protein AT1G66080 [Arabidopsis thaliana]
Length=190

 Score =   314 bits (804),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEAYD I E+CIFLLNNF LPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAYDQISEMCIFLLNNFNLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D++ LSAKIGVSVE++
Sbjct  61   AVYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAKMQLTAGDSSSLSAKIGVSVEDV  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A L SLDV A ++IE+LAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  121  AALRSLDVVAERRIEKLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  180

Query  259  DPEYLKGFAL  230
            DP++LK FAL
Sbjct  181  DPDFLKSFAL  190



>gb|EPS58163.1| hypothetical protein M569_16653 [Genlisea aurea]
Length=188

 Score =   313 bits (801),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+D S+F QID THWLLDMN FVGE+YDSIRE+CIFLLN F+LPPDKAL
Sbjct  1    MFGVVFPNRSFPLDASTFAQIDPTHWLLDMNHFVGESYDSIREICIFLLNGFSLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGG-ELQLTADATPLSAKIGVSVEELAT  434
            A+YIQSPGS FL+CGAVTLSRPSAVLSLPWP+P G  L  +A+A P SAKIGVSVE+LA 
Sbjct  61   ALYIQSPGSTFLYCGAVTLSRPSAVLSLPWPDPVGLPLLTSAEAPPPSAKIGVSVEDLAG  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            + SLDVA  ++IERLA+KVGENLFNFMQSFCGVDGSKL+VPMDI+DRWFK FQERA RDP
Sbjct  121  VTSLDVAGERRIERLALKVGENLFNFMQSFCGVDGSKLVVPMDIMDRWFKKFQERAKRDP  180

Query  253  EYLKGFAL  230
            EYLKGFAL
Sbjct  181  EYLKGFAL  188



>ref|XP_010511533.1| PREDICTED: protein OPI10 homolog [Camelina sativa]
Length=190

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEAYD I E+CIFLLNNF LPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAYDQISEMCIFLLNNFNLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D++ LSAKIGVSVE+ 
Sbjct  61   AVYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAQMQLTAGDSSSLSAKIGVSVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A L S+DV A ++IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  121  AALSSMDVVAERRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKTFAL  190



>ref|XP_002888480.1| hypothetical protein ARALYDRAFT_475712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64739.1| hypothetical protein ARALYDRAFT_475712 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEAYD I E+CIFLLNNF LPPDKAL
Sbjct  1    MFGVVFPNRSFPLDISTFTQIDTFHWVLDMNHFVGEAYDQISEMCIFLLNNFNLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D++ LSAKIGVSVE++
Sbjct  61   AVYLQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAQMQLTAGDSSSLSAKIGVSVEDI  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
              L SLDV A ++IE+LAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  121  TALRSLDVVAERRIEKLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  180

Query  259  DPEYLKGFAL  230
            DP++LK FAL
Sbjct  181  DPDFLKSFAL  190



>ref|XP_010470478.1| PREDICTED: protein OPI10 homolog [Camelina sativa]
Length=190

 Score =   311 bits (797),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFP+DIS+FTQIDT HW+LDMN FVGEAYD I ++CIFLLNNF LPPDKAL
Sbjct  1    MFGVVFPNRSFPIDISTFTQIDTFHWVLDMNHFVGEAYDQISDMCIFLLNNFNLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DATPLSAKIGVSVEEL  440
            AVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D++ LSAKIGVSVE+ 
Sbjct  61   AVYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAQMQLTAGDSSSLSAKIGVSVEDA  120

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A L S+DV A ++IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDILDRWFK FQE+A R
Sbjct  121  AALSSMDVVAERRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDILDRWFKKFQEKAKR  180

Query  259  DPEYLKGFAL  230
            DP +LK FAL
Sbjct  181  DPGFLKTFAL  190



>ref|XP_010032742.1| PREDICTED: protein OPI10 homolog [Eucalyptus grandis]
Length=198

 Score =   305 bits (782),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 169/198 (85%), Gaps = 11/198 (6%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+RSFP+DIS+F QIDT HW+LDMNTFVGEAYD +RE+CIFLLN F+LPPDKAL
Sbjct  1    MFGVVFPDRSFPIDISAFAQIDTFHWVLDMNTFVGEAYDQVREICIFLLNGFSLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP----------GGELQLTA-DATPLSAK  464
            AVY+QSPGSPF++CGAVT+SRPSAVL L WPEP          G +LQLT+  A PL+AK
Sbjct  61   AVYVQSPGSPFVYCGAVTVSRPSAVLPLAWPEPGGDAAAAAAGGQQLQLTSPGAAPLTAK  120

Query  463  IGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFK  284
            IGVSVEE   LPSLD A G+++ER+AM+VGENLFNFMQSFCGVDGS+L+VP DILDRWFK
Sbjct  121  IGVSVEEAGALPSLDAAEGRRVERMAMRVGENLFNFMQSFCGVDGSRLVVPTDILDRWFK  180

Query  283  IFQERAIRDPEYLKGFAL  230
             FQERA RDP+YLK FAL
Sbjct  181  KFQERAKRDPDYLKSFAL  198



>ref|XP_006849456.1| PREDICTED: uncharacterized protein LOC18439221 [Amborella trichopoda]
 gb|ERN11037.1| hypothetical protein AMTR_s00024p00077680 [Amborella trichopoda]
Length=188

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+FPNRS+PMDISSF QIDT HW+LDMNTFVGEAYD IRE+CIFLLN  +LPPDKAL
Sbjct  1    MFGVLFPNRSYPMDISSFAQIDTFHWILDMNTFVGEAYDQIREMCIFLLNGLSLPPDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQL-TADATPLSAKIGVSVEELAT  434
            AVYIQSPGS F +CGA+    PSAVL+L WPEPGG++QL +AD+ PLSAKIGVSVE+LA+
Sbjct  61   AVYIQSPGSAFEYCGAIYTGCPSAVLALQWPEPGGQMQLSSADSPPLSAKIGVSVEDLAS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LP+L+V   ++IE+LAMKVGENLFNFMQSFC VDG++L+VPMDILDRWFK FQE+A RDP
Sbjct  121  LPALNVGHQRRIEQLAMKVGENLFNFMQSFCSVDGNRLVVPMDILDRWFKKFQEKAKRDP  180

Query  253  EYLKGFAL  230
            EYLK F L
Sbjct  181  EYLKSFML  188



>gb|ABK25938.1| unknown [Picea sitchensis]
Length=187

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMD+S FTQID+ HW+LDMNTFVGEAYD I+E+CIFLLN F+LPPDK L
Sbjct  1    MFGVVFPNRSFPMDLSCFTQIDSFHWILDMNTFVGEAYDQIKEMCIFLLNEFSLPPDKVL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVY+QSPGS F +CGAV  + PSAVL+L WPEPGG++QLT+D+ PL+AKIGVS+E+L  +
Sbjct  61   AVYVQSPGSEFKYCGAVYRACPSAVLTLCWPEPGGQMQLTSDSVPLTAKIGVSIEDLNAI  120

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
            P+L+V   ++IE+LAMKVGENLFNFMQSFC +D +KL+VP DILDRWFK FQERA RDPE
Sbjct  121  PALNVGHQQRIEQLAMKVGENLFNFMQSFCTMDSNKLVVPTDILDRWFKKFQERAKRDPE  180

Query  250  YLKGFAL  230
            YLK F +
Sbjct  181  YLKSFVI  187



>ref|XP_008798223.1| PREDICTED: protein OPI10 homolog [Phoenix dactylifera]
 ref|XP_008798230.1| PREDICTED: protein OPI10 homolog [Phoenix dactylifera]
 ref|XP_008798236.1| PREDICTED: protein OPI10 homolog [Phoenix dactylifera]
Length=192

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 158/196 (81%), Gaps = 13/196 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+RS+PMD SSF QID  HWLLDM TFVGEAY  ++E+CIFLLN   LPP+KAL
Sbjct  1    MFGVVFPDRSYPMDPSSFAQIDPLHWLLDMKTFVGEAYHEVKELCIFLLNAGVLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPL--------SAKIGV  455
            AVY Q+PG PF+FCGAV  +RPSAVLSLPWP+P G+    A A PL        SAKIGV
Sbjct  61   AVYCQAPGRPFVFCGAVHAARPSAVLSLPWPDPAGD----AAAGPLQVVVPEAASAKIGV  116

Query  454  SVEELATLPS-LDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            SVE+LA LP  LD  A +++ERLA++VGENLFNFMQSFCGVDGS+L+VPMDILDRWFK F
Sbjct  117  SVEDLAALPPVLDAGAERRVERLALRVGENLFNFMQSFCGVDGSRLVVPMDILDRWFKKF  176

Query  277  QERAIRDPEYLKGFAL  230
            QE+A +DP YLKGFAL
Sbjct  177  QEKAKKDPSYLKGFAL  192



>ref|XP_008368333.1| PREDICTED: LOW QUALITY PROTEIN: protein Hikeshi-like [Malus domestica]
Length=177

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 149/187 (80%), Gaps = 10/187 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVF NRSFPMDI SF+ IDT HW+LDMNTFV E YD +RE+CIFL NNFTLP DKAL
Sbjct  1    MFGVVFWNRSFPMDIPSFSXIDTFHWILDMNTFVWEVYDQVRELCIFLXNNFTLPSDKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVYIQS GS   FCG +T++RPS VL+L            A A PLSAKIGVSVE+LATL
Sbjct  61   AVYIQSLGSGLFFCGTITVARPSTVLAL----------XVAQAAPLSAKIGVSVEDLATL  110

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
             SLDV A K IERL MKVGENLFNFMQSFCGVDGSKL+VPMDIL RWF  FQERA RDPE
Sbjct  111  SSLDVTAEKXIERLMMKVGENLFNFMQSFCGVDGSKLVVPMDILHRWFDKFQERAKRDPE  170

Query  250  YLKGFAL  230
            YLKGFAL
Sbjct  171  YLKGFAL  177



>ref|XP_008348659.1| PREDICTED: protein OPI10 homolog [Malus domestica]
Length=158

 Score =   276 bits (707),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  703  MNTFVGEAYDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLP  524
            M    GE YD +RE+CIFLLNNFTLPPDKALAVYIQSPGS F FCGA+T++RPSAVL+LP
Sbjct  1    MPQLGGEEYDQVRELCIFLLNNFTLPPDKALAVYIQSPGSAFFFCGAITVARPSAVLALP  60

Query  523  WPEPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSF  344
            WP  GG+LQLTADA PLSAKIGVSVE+LATLPSLDV A K+IERLAMKVGENLFNFMQSF
Sbjct  61   WPPQGGQLQLTADAAPLSAKIGVSVEDLATLPSLDVTAEKRIERLAMKVGENLFNFMQSF  120

Query  343  CGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLKGFAL  230
            CGVDGSKL+VPMDILDRWFK FQERA RDPEYLKGFAL
Sbjct  121  CGVDGSKLVVPMDILDRWFKKFQERAKRDPEYLKGFAL  158



>ref|XP_010936851.1| PREDICTED: protein OPI10 homolog [Elaeis guineensis]
 ref|XP_010936852.1| PREDICTED: protein OPI10 homolog [Elaeis guineensis]
 ref|XP_010936853.1| PREDICTED: protein OPI10 homolog [Elaeis guineensis]
Length=192

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 158/194 (81%), Gaps = 9/194 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+RS+PMD SSF QID  HWLLDM TFVGEAY  ++E+CIFLLN   LPP+KAL
Sbjct  1    MFGVVFPDRSYPMDPSSFAQIDPLHWLLDMKTFVGEAYHEVKELCIFLLNAGVLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP-----GGELQLTA-DATPLSAKIGVSV  449
            AVY Q+PG PF+FCGAV  +RPSAVLSLPWP+P      G LQ+   DA   SAKIGVSV
Sbjct  61   AVYCQAPGRPFVFCGAVHAARPSAVLSLPWPDPADDATAGPLQVAVPDAA--SAKIGVSV  118

Query  448  EELATLP-SLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQE  272
            E+LA LP  LD  A +++ERLA++VGENLFNFMQSFCGVDGS+L+VPMDILDRWFK FQE
Sbjct  119  EDLAALPLVLDAGAERRVERLALRVGENLFNFMQSFCGVDGSRLVVPMDILDRWFKKFQE  178

Query  271  RAIRDPEYLKGFAL  230
            +A +DP YLKGFAL
Sbjct  179  KAKKDPSYLKGFAL  192



>ref|XP_002991883.1| hypothetical protein SELMODRAFT_134406 [Selaginella moellendorffii]
 gb|EFJ06994.1| hypothetical protein SELMODRAFT_134406 [Selaginella moellendorffii]
Length=190

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFPNRSFPMD +SF QID  HW+LDM+ F+GE Y+ ++E+CIFLLN  +LPP+KAL
Sbjct  1    MFGVVFPNRSFPMDAASFQQIDIAHWVLDMSVFLGEGYEEVKEMCIFLLNELSLPPEKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADAT-PLSAKIGVSVEELAT  434
            AVY+QSPGS F +CGAV  + PSAV++L WP+PGG++Q+ A  T PL+AKIG++VE+L +
Sbjct  61   AVYVQSPGSQFQYCGAVHKACPSAVVTLLWPKPGGQMQIMASETQPLTAKIGLAVEDLVS  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LP+L+V   KK+E LA+KVGENLFNFMQSFC  +  +++VP+DIL++WFK FQ++A +DP
Sbjct  121  LPALNVGNYKKVEDLALKVGENLFNFMQSFCSQENGRMVVPLDILEKWFKKFQDKAKKDP  180

Query  253  EYLKGF  236
            EYLK F
Sbjct  181  EYLKRF  186



>ref|XP_009388745.1| PREDICTED: protein OPI10 homolog [Musa acuminata subsp. malaccensis]
Length=193

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 151/197 (77%), Gaps = 14/197 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLL--NNFTLPPDK  617
            MFGVVFP RS+PMD S+FTQID  HW+LDM +FVG+AY  ++EVC+FLL     + PP K
Sbjct  1    MFGVVFPERSYPMDASAFTQIDPLHWVLDMASFVGDAYRDVKEVCVFLLPAAAASFPPGK  60

Query  616  ALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG-------GELQLTADATPLSAKIG  458
            ALAVY+Q PG PFLFCGAV  +RPSA+L+LPWP+         G LQ+ A     SAKIG
Sbjct  61   ALAVYVQPPGHPFLFCGAVHPARPSALLALPWPDLAEDAVAAFGVLQVAA----ASAKIG  116

Query  457  VSVEELATLPSL-DVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKI  281
            VSVE+ A+LP + D    ++ ERLA++VGENLFNFMQSFCGVDGS+L+VPMDILDRWFK 
Sbjct  117  VSVEDFASLPPVADAGTERRAERLALRVGENLFNFMQSFCGVDGSRLVVPMDILDRWFKK  176

Query  280  FQERAIRDPEYLKGFAL  230
            FQERA +DP YLK F+L
Sbjct  177  FQERAKKDPSYLKNFSL  193



>ref|XP_001762423.1| predicted protein [Physcomitrella patens]
 gb|EDQ72890.1| predicted protein [Physcomitrella patens]
Length=189

 Score =   244 bits (622),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+FPNRSFP+ I++F Q+D   W+LDMN FVGEAYD ++E+CIFLLN   LP  KAL
Sbjct  1    MFGVLFPNRSFPLGITTFNQVDDHRWILDMNYFVGEAYDQVKEMCIFLLNELALPAGKAL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP-GGELQLTADATPL-SAKIGVSVEELA  437
            AVY+Q+PGS F + GAV  + PSAV  L WP    G++ LT    P  SA+IG+SVE+LA
Sbjct  61   AVYVQTPGSQFEYRGAVHSACPSAVFPLLWPSATSGQMLLTGPGAPCASAQIGISVEDLA  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            TLPSL+V   K++E LA+KVGENLFNFMQSFC ++G KL++PMDIL++WFK FQE+A RD
Sbjct  121  TLPSLNVGQQKRVEELALKVGENLFNFMQSFCSIEGDKLLIPMDILNQWFKKFQEKARRD  180

Query  256  PEYLKGFAL  230
            P+YL  F L
Sbjct  181  PDYLNRFTL  189



>ref|XP_001778643.1| predicted protein [Physcomitrella patens]
 gb|EDQ56538.1| predicted protein [Physcomitrella patens]
Length=189

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+FPNRSFP+ IS+F Q+D   WLLDMN FVGEAYD ++E+C+FLLN   LP  K+L
Sbjct  1    MFGVLFPNRSFPLGISTFNQVDEHRWLLDMNYFVGEAYDQVKEMCVFLLNEMVLPAGKSL  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP-EPGGELQLTADATP-LSAKIGVSVEELA  437
            AVY+Q+PGS F + GAV  + PSAV  L WP    G + LT    P  SA+IG+SVE+LA
Sbjct  61   AVYVQAPGSQFEYRGAVHSACPSAVFPLLWPGATSGPMLLTGPGAPGASAQIGISVEDLA  120

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
            TLPSL+V   K++E +A+KVGENLFNFMQSF    G KLIVPMDIL++WFK FQE+A RD
Sbjct  121  TLPSLNVGHQKRVEEIALKVGENLFNFMQSFGTTQGGKLIVPMDILNQWFKKFQEKARRD  180

Query  256  PEYLKGFAL  230
            P+YL  F +
Sbjct  181  PDYLNRFTM  189



>ref|XP_010418997.1| PREDICTED: protein OPI10 homolog, partial [Camelina sativa]
Length=144

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = -2

Query  652  FLLNNFTLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPG--GELQLTA-DA  482
            FLLNNF LPPDKALAVY+QSPGS F+FCGAVTL+RPSAVLSL WPEPG   ++QLTA D+
Sbjct  1    FLLNNFNLPPDKALAVYVQSPGSAFVFCGAVTLARPSAVLSLQWPEPGSAAQMQLTAGDS  60

Query  481  TPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDI  302
            + LSAKIGVSVE+ A L S+DV A ++IERLAMKVGENLFNFMQSFCGVDGSKL+VPMDI
Sbjct  61   SSLSAKIGVSVEDAAALSSMDVVAERRIERLAMKVGENLFNFMQSFCGVDGSKLVVPMDI  120

Query  301  LDRWFKIFQERAIRDPEYLKGFAL  230
            LDRWFK FQE+A RDP +LK FAL
Sbjct  121  LDRWFKKFQEKAKRDPGFLKTFAL  144



>ref|XP_001761255.1| predicted protein [Physcomitrella patens]
 gb|EDQ73977.1| predicted protein [Physcomitrella patens]
Length=218

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  814  GRRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF  635
            G+ I    +FGV+FPNRS+P+D S+FTQ+DT  WLL+M+ FVGEAYD + E+CI+L +  
Sbjct  22   GQAIIPTNIFGVLFPNRSYPLDASNFTQVDTQKWLLNMDIFVGEAYDQVTEMCIYLFHEA  81

Query  634  TLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADAT-PLSAKIG  458
            ++P DKA+AVY+QSPGS F F G VT + PS VLSL WP    ++ L    + P++AKIG
Sbjct  82   SIPADKAVAVYVQSPGSNFQFRGGVTRACPSTVLSLLWPTTSSQMNLIGSTSRPVTAKIG  141

Query  457  VSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            V++E+ ATLP+L+V   +++E++A+ VG NLFNFMQSFC V  + L+VP  I ++W+K F
Sbjct  142  VAIEDAATLPALNVGRHRQLEQVALNVGRNLFNFMQSFCHVQDNHLVVPRGIFEQWYKKF  201

Query  277  QERAIRDPEYLK  242
            +ER+ RDPEY+ 
Sbjct  202  EERSQRDPEYVN  213



>ref|XP_001771695.1| predicted protein [Physcomitrella patens]
 gb|EDQ63478.1| predicted protein, partial [Physcomitrella patens]
Length=189

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            +FGV+FPNRS+P+D S+FTQ+DT  WLL+M+ FVGE YD + E+CI+L +  ++PPDKA+
Sbjct  1    IFGVLFPNRSYPLDASNFTQVDTHKWLLNMDIFVGEPYDKVTEICIYLFHEESIPPDKAV  60

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADAT-PLSAKIGVSVEELAT  434
            AVY+QSPGS F F G VT + PS+VLSL WP    ++ L    + P++AKIGVS+E+ AT
Sbjct  61   AVYVQSPGSSFQFRGGVTRACPSSVLSLLWPTTSSQMNLIGSTSRPVTAKIGVSIEDAAT  120

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LP+L+V   +++E++A+ VG NLFNFMQSFC V  + L VP  I ++W+K F ER+ RDP
Sbjct  121  LPALNVGRHRQLEQVALNVGRNLFNFMQSFCHVQDNHLGVPRGIFEQWYKKFVERSQRDP  180

Query  253  EYLK  242
            EY+ 
Sbjct  181  EYVN  184



>ref|XP_002969459.1| hypothetical protein SELMODRAFT_91593 [Selaginella moellendorffii]
 gb|EFJ29547.1| hypothetical protein SELMODRAFT_91593 [Selaginella moellendorffii]
Length=238

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 142/190 (75%), Gaps = 2/190 (1%)
 Frame = -2

Query  793  EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKA  614
             +FGVVFP  S+P+D  SF Q+D+  W LDM  FVG +Y+ + E+CIFL N F LPP+KA
Sbjct  49   RIFGVVFPRHSYPIDAFSFKQLDSCRWCLDMAIFVGTSYEQVTEMCIFLFNQFVLPPEKA  108

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELA  437
            LAVY+QSPGS F +CG ++   PSA+++L WP+ GG+ QLTA DA PL+A IGVS+E+L+
Sbjct  109  LAVYVQSPGSAFQYCGGISNVCPSAMITLLWPKHGGKKQLTALDAPPLNASIGVSLEDLS  168

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFC-GVDGSKLIVPMDILDRWFKIFQERAIR  260
            TLP+L++     +E++A+K+GEN F+FMQS        ++IVP+++LD+WF  F+++A +
Sbjct  169  TLPALNIRQYYHVEKVALKIGENFFHFMQSCSKAAQDGRIIVPLNLLDQWFVRFKDKASK  228

Query  259  DPEYLKGFAL  230
            DP+YLK F +
Sbjct  229  DPDYLKQFQV  238



>ref|XP_002961228.1| hypothetical protein SELMODRAFT_74965 [Selaginella moellendorffii]
 gb|EFJ38767.1| hypothetical protein SELMODRAFT_74965 [Selaginella moellendorffii]
Length=238

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = -2

Query  793  EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKA  614
             +FGVVFP  S+P+D  SF Q+D+  W LDM  FVG  Y+ + E+CIFL N F LPP+KA
Sbjct  49   RIFGVVFPRHSYPIDAFSFKQLDSCRWCLDMAIFVGTTYEQVTEMCIFLFNQFVLPPEKA  108

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-DATPLSAKIGVSVEELA  437
            LAVY+QSPGS F +CG ++   PSA+++L WP+ GG+ QLTA DA PL+A IGVS+E+L+
Sbjct  109  LAVYVQSPGSAFQYCGGISNVCPSAMITLLWPKHGGKKQLTAPDAPPLNASIGVSLEDLS  168

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFC-GVDGSKLIVPMDILDRWFKIFQERAIR  260
            TLP+L++     +E++A+K+GEN F+FMQS        ++IVP+++LD+WF  F+++A +
Sbjct  169  TLPALNIRQYYHVEKVALKIGENFFHFMQSCSKAAQDGRIIVPLNLLDQWFVRFKDKASK  228

Query  259  DPEYLKGFAL  230
            DP+YLK F +
Sbjct  229  DPDYLKQFQV  238



>ref|NP_001144319.1| hypothetical protein [Zea mays]
 ref|XP_008671113.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008671120.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG39503.1| hypothetical protein [Zea mays]
 tpg|DAA44294.1| TPA: hypothetical protein ZEAMMB73_799757 [Zea mays]
Length=180

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 122/188 (65%), Gaps = 13/188 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF--TLPPDK  617
            MFG+VFP+ +FP+D ++F Q+    W+LD++T    A  + R   +FLL      LPP K
Sbjct  1    MFGIVFPDHTFPLDATAFAQVAPNSWVLDLSTLALAA--APRSAVVFLLPAAVTALPPGK  58

Query  616  ALAVYIQSP-GSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEEL  440
            A++VY Q+    PF F GA+  +RPSA  S P PE G E +         AK+GV+VE+ 
Sbjct  59   AVSVYFQAATNRPFAFLGALGPTRPSA--SFPLPEAGDEPEPAVG----PAKLGVAVEDA  112

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LP       ++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +
Sbjct  113  AALPP--PPDEQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKK  170

Query  259  DPEYLKGF  236
            DP YLK F
Sbjct  171  DPAYLKSF  178



>gb|ABF94856.1| expressed protein [Oryza sativa Japonica Group]
Length=215

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 124/194 (64%), Gaps = 11/194 (6%)
 Frame = -2

Query  811  RRIEE*EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFT  632
            R++    MFGVVFP+ SFP+D+++F Q+    W LD++T    A      V +       
Sbjct  29   RQLAAAAMFGVVFPDHSFPLDVTAFAQVAPNSWALDLSTLSLAAAPRSAVVFLLPAAAAA  88

Query  631  LPPDKALAVYIQSPGS-PFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLS-AKIG  458
            LPP KA+AVY Q   + PF F GA+   RPSA  SLP PE G E +      PL  AK+G
Sbjct  89   LPPGKAVAVYFQPAANRPFAFLGALGPGRPSA--SLPLPEAGDEPE-----PPLGPAKLG  141

Query  457  VSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            V+VE+ A LP      G++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ F
Sbjct  142  VAVEDAAALPP--PPDGQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKF  199

Query  277  QERAIRDPEYLKGF  236
            QERA +DP YLK F
Sbjct  200  QERAKKDPSYLKTF  213



>gb|AAO06975.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=180

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 121/187 (65%), Gaps = 11/187 (6%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+ SFP+D+++F Q+    W LD++T    A      V +       LPP KA+
Sbjct  1    MFGVVFPDHSFPLDVTAFAQVAPNSWALDLSTLSLAAAPRSAVVFLLPAAAAALPPGKAV  60

Query  610  AVYIQ-SPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLS-AKIGVSVEELA  437
            AVY Q +   PF F GA+   RPSA  SLP PE G E +      PL  AK+GV+VE+ A
Sbjct  61   AVYFQPAANRPFAFLGALGPGRPSA--SLPLPEAGDEPE-----PPLGPAKLGVAVEDAA  113

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRD  257
             LP      G++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +D
Sbjct  114  ALPP--PPDGQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKKD  171

Query  256  PEYLKGF  236
            P YLK F
Sbjct  172  PSYLKTF  178



>ref|XP_004985069.1| PREDICTED: protein OPI10 homolog [Setaria italica]
Length=180

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 119/186 (64%), Gaps = 9/186 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+ +FP+D ++F Q+    WLLD++T    A      V +       LPP KA+
Sbjct  1    MFGVVFPDHTFPLDATAFGQVAPNSWLLDLSTLALAAAPRSAVVFLLPAAAAALPPGKAV  60

Query  610  AVYIQSPGS-PFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
            AVY Q+  + PF F GA+  +RPSA  S P PE G E +         AK+GV+VE+ A 
Sbjct  61   AVYFQAAANRPFAFLGALGPTRPSA--SFPLPEAGDEPEPAVG----PAKLGVAVEDAAA  114

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LP       ++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +DP
Sbjct  115  LPP--PPDEQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKKDP  172

Query  253  EYLKGF  236
             YLK F
Sbjct  173  TYLKSF  178



>ref|XP_002468201.1| hypothetical protein SORBIDRAFT_01g041620 [Sorghum bicolor]
 gb|EER95199.1| hypothetical protein SORBIDRAFT_01g041620 [Sorghum bicolor]
Length=180

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 121/188 (64%), Gaps = 13/188 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF--TLPPDK  617
            MFG+VFP+ +FP+D ++F Q+    WLLD+++       + R   +FLL      LPP K
Sbjct  1    MFGIVFPDHTFPLDATAFAQVAPNSWLLDLSSLA--LATAPRSAVVFLLPAAVAALPPGK  58

Query  616  ALAVYIQSP-GSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEEL  440
            A+AVY Q+    PF F GA+  +RPSA  S P PE G E +         AK+GV+VE+ 
Sbjct  59   AVAVYFQAATNRPFAFLGALGPTRPSA--SFPLPEAGDEPEPAVG----PAKLGVAVEDA  112

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LP       ++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +
Sbjct  113  AALPP--PPDEQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKK  170

Query  259  DPEYLKGF  236
            DP YLK F
Sbjct  171  DPAYLKSF  178



>gb|AGT15901.1| hypothetical protein SHCRBa_121_B20_R_80 [Saccharum hybrid cultivar 
R570]
Length=180

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 121/188 (64%), Gaps = 13/188 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNF--TLPPDK  617
            MFG+VFP+ +FP+D ++F Q+    WLLD+++       + R   +FLL      LPP K
Sbjct  1    MFGIVFPDHTFPLDATAFAQVAPNCWLLDLSSLA--LATAPRSAVVFLLPAAVAALPPGK  58

Query  616  ALAVYIQSP-GSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEEL  440
            A+AVY Q+    PF F GA+  +RPSA  S P PE G E +         AK+GV+VE+ 
Sbjct  59   AVAVYFQAATNRPFAFLGALGPTRPSA--SFPLPEAGDEPEPAVG----PAKLGVAVEDA  112

Query  439  ATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIR  260
            A LP       ++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +
Sbjct  113  AALPP--PPDEQRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKK  170

Query  259  DPEYLKGF  236
            DP YLK F
Sbjct  171  DPAYLKSF  178



>ref|XP_003558405.1| PREDICTED: protein OPI10 homolog [Brachypodium distachyon]
Length=180

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 118/186 (63%), Gaps = 9/186 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG+VFP+ +FP+D ++F Q+    WLLD +T    A      V +       LPP KA+
Sbjct  1    MFGIVFPDHTFPLDATAFGQVAPNSWLLDFSTLSLPATPRSAVVFLLPPAAAALPPGKAV  60

Query  610  AVYIQSPGS-PFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
            AVY Q+ G+ PF F GA+  +RPSA  + P PE G E +         AK+GV+VE+ A 
Sbjct  61   AVYFQAAGNRPFAFLGALGPARPSA--TFPLPEAGDEPEPPVG----PAKLGVAVEDAAA  114

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            LP       ++ ER+A++VGENLFNFMQSFC  DG KL+VP DILDRWF+ FQERA +DP
Sbjct  115  LPP--APDEQRAERVALRVGENLFNFMQSFCAADGGKLVVPTDILDRWFRKFQERAKKDP  172

Query  253  EYLKGF  236
             YLK F
Sbjct  173  SYLKSF  178



>ref|XP_010101779.1| hypothetical protein L484_018735 [Morus notabilis]
 gb|EXB89634.1| hypothetical protein L484_018735 [Morus notabilis]
Length=185

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = -2

Query  616  ALAVYIQSPGSPFLFCGAVT------LSRPSAVLSLPWPEPGGELQLTADATPLSAKIGV  455
            AL VY QSP SPF+ C A+       L+R S    L        L   A+  PLS KIGV
Sbjct  33   ALIVYTQSPSSPFVLCVAIPPPSLPPLARSSHRHLL-----RAALDHCANFAPLSVKIGV  87

Query  454  SVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQ  275
             VE+L +LP LDVAA K+IERL MKVGENLF FMQSFC  DGSKL VP+DILDRWFK FQ
Sbjct  88   LVEDLTSLPLLDVAAEKRIERLVMKVGENLFTFMQSFCNADGSKLEVPVDILDRWFKKFQ  147

Query  274  ERAIRDPEYLK  242
            E+A R+P++LK
Sbjct  148  EKAKREPDFLK  158



>ref|XP_005847507.1| hypothetical protein CHLNCDRAFT_134521 [Chlorella variabilis]
 gb|EFN55405.1| hypothetical protein CHLNCDRAFT_134521 [Chlorella variabilis]
Length=196

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 105/186 (56%), Gaps = 7/186 (4%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            F + F  +S P+  +SF Q D THW+LD    V   Y  ++EV +FL     LPPD  LA
Sbjct  6    FAIFFSTKSCPIPSTSFVQADATHWVLDATNTVTHDYHDLKEVALFLTQAGVLPPDLGLA  65

Query  607  VYIQSPGSPFLFCGA--VTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
            +Y+   G+ + + G   V+   PS VL L WP+P G L   A   P  A+IGVS+E LA 
Sbjct  66   LYVSIGGADWSYRGERFVSNGHPSDVLPLSWPDPAGGL--AAPPGPGFAQIGVSLEPLAA  123

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVD---GSKLIVPMDILDRWFKIFQERAI  263
            L   + +     E  A +VG +LFNFMQSF GV    G KL+VP +ILD W++    R  
Sbjct  124  LAEKEGSKLGAREEFAKRVGLDLFNFMQSFGGVQSVGGDKLLVPANILDHWYQRLSNRLR  183

Query  262  RDPEYL  245
            RDP++L
Sbjct  184  RDPDWL  189



>ref|XP_010092034.1| hypothetical protein L484_006352 [Morus notabilis]
 gb|EXB49814.1| hypothetical protein L484_006352 [Morus notabilis]
Length=895

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 94/144 (65%), Gaps = 11/144 (8%)
 Frame = -2

Query  655  IFLLNNFTLPPDKALAVYIQSPGSPFLFCGAVTL-------SRPSAVLSLPWPEPGGELQ  497
            +  L NFTLPPDKAL  Y  SPGS F+ CGA +L       ++ +    L    P     
Sbjct  754  LICLKNFTLPPDKALTAYALSPGSSFVLCGAPSLSSSLPPLAQSTRRRRLLRAAPDHRCG  813

Query  496  LTADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLI  317
              A     S KI VS E+LA+L  LDVAA K+IERLAMKVGENLFNFMQ FCGVDGSKL 
Sbjct  814  FRA----ASVKIEVSAEDLASLSLLDVAAEKRIERLAMKVGENLFNFMQLFCGVDGSKLE  869

Query  316  VPMDILDRWFKIFQERAIRDPEYL  245
            VP+DILDRWFK F+E+A R  E+L
Sbjct  870  VPVDILDRWFKKFREKARRPREFL  893



>gb|AEW08558.1| hypothetical protein CL487Contig1_01, partial [Pinus lambertiana]
 gb|AEW08559.1| hypothetical protein CL487Contig1_01, partial [Pinus radiata]
 gb|AFG59773.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59774.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59775.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59776.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59777.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59778.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59779.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59780.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59781.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59782.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59783.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59784.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59785.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59786.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59787.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59788.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59789.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
 gb|AFG59790.1| hypothetical protein CL487Contig1_01, partial [Pinus taeda]
Length=80

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  496  LTADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLI  317
            LT+D+ PL+AKIGVS+E+L  +P L+V   ++IE+LAMKVGENLFNFMQSFC +D +KL+
Sbjct  1    LTSDSVPLTAKIGVSIEDLNAIPVLNVGHQQRIEQLAMKVGENLFNFMQSFCTMDSNKLV  60

Query  316  VPMDILDRWFKIFQERAIRD  257
            VP DILDRWFK FQERA RD
Sbjct  61   VPTDILDRWFKKFQERAKRD  80



>ref|XP_001418434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96727.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=188

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 106/185 (57%), Gaps = 9/185 (5%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDT-THWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKA  614
            +FG VF  +S  +   SF  ++    W LD+ T  G A+D  REVC F+ +   L  + A
Sbjct  2    LFGAVFAKKSCVVASESFVCVENGASWTLDL-TNAGFAHDECREVCFFMPSQRLLDDNSA  60

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
            L +YI++  +P+ +CG V  ++PS V +L WP      + T  A P +A +GVSVE LA+
Sbjct  61   LCMYIKAGDAPWEYCGCVANAKPSDVFTLRWPVD----EATGRAHP-TAAVGVSVEPLAS  115

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSF-C-GVDGSKLIVPMDILDRWFKIFQERAIR  260
                + A  +  E  A +V E+LF FMQSF C G    +++VP++IL RWF  FQ R  R
Sbjct  116  ALEKEAALVQHKETFAKRVAEDLFRFMQSFQCEGSSNDRMVVPVNILTRWFDKFQNRFRR  175

Query  259  DPEYL  245
            DP +L
Sbjct  176  DPNFL  180



>ref|XP_003061944.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53656.1| predicted protein [Micromonas pusilla CCMP1545]
Length=200

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 101/187 (54%), Gaps = 11/187 (6%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFV--GEAYDSIREVCIFLLNNFTLPPDK  617
            +FGV F  +SF +   +F + D THW LD+  +V  G  Y  +R+VC+F+ +   L    
Sbjct  13   LFGVAFVRKSFVIPSDAFARADATHWTLDLRRYVPPGVPYGDVRDVCLFIPDGNVLDAHS  72

Query  616  ALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELA  437
            ALA+Y+Q+  S + + G V+   PS V  L WP      QL   + P  A+IGVS+E LA
Sbjct  73   ALALYVQAGTSAWEYRGCVSNVSPSEVFPLQWP------QLADGSLPECAQIGVSIEPLA  126

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSF---CGVDGSKLIVPMDILDRWFKIFQERA  266
             +   +       E  A +V  +LF +M+SF     V    ++VPM++LDRWF  FQ + 
Sbjct  127  EVAGKEQIVLGSKEEFARRVAMDLFRYMESFQAATQVSQEHMVVPMNVLDRWFNKFQTKF  186

Query  265  IRDPEYL  245
              DP +L
Sbjct  187  RLDPNFL  193



>gb|EMT18032.1| hypothetical protein F775_22021 [Aegilops tauschii]
Length=237

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 95/185 (51%), Gaps = 46/185 (25%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGVVFP+ +FP+D ++F Q+    WLLD++T    +      V +       LPP KA+
Sbjct  97   MFGVVFPDHTFPLDATAFAQVAPASWLLDLSTLSLPSAPRSAVVFLLPPAAAALPPGKAV  156

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            AVY Q          AV   R +A L    P P  E                        
Sbjct  157  AVYYQ----------AVAGERDAAAL----PSPPDE------------------------  178

Query  430  PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPE  251
                    ++ ER+A++VGENLFNFMQSFC  DG KL+VP DILDRWF+ FQERA +DP 
Sbjct  179  --------QRAERVALRVGENLFNFMQSFCAADGGKLVVPTDILDRWFRKFQERAKKDPT  230

Query  250  YLKGF  236
            YLK F
Sbjct  231  YLKSF  235



>ref|XP_001698841.1| hypothetical protein CHLREDRAFT_151930 [Chlamydomonas reinhardtii]
 gb|EDO99123.1| predicted protein [Chlamydomonas reinhardtii]
Length=193

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 106/182 (58%), Gaps = 3/182 (2%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG+ F   + P+   + TQ+D THW+LD +      Y ++REV +FLL    L P+ AL 
Sbjct  5    FGLFFVGHTVPITHDNLTQVDPTHWVLDASVIPN--YAAMREVALFLLPGSVLDPNAALG  62

Query  607  VYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATLP  428
            +Y+++  + + + G V  ++PSAVL L WP       ++A     S +IGVS+E  A + 
Sbjct  63   LYVRAGNAEWAYRGCVHNAQPSAVLPLQWPLAEDGSVVSAAVGGQSVQIGVSLEAAADIV  122

Query  427  SLDVAAGKKIERLAMKVGENLFNFMQSFCGVD-GSKLIVPMDILDRWFKIFQERAIRDPE  251
            + + ++       A +VG +LF +++SF   + GS ++VP + L+RW+  FQE+  RDP+
Sbjct  123  ARESSSVGAKAEFAKRVGLDLFRYLESFQTQNMGSHIVVPANALERWYTRFQEKFRRDPD  182

Query  250  YL  245
            +L
Sbjct  183  FL  184



>ref|XP_002500250.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61508.1| predicted protein [Micromonas sp. RCC299]
Length=190

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 102/183 (56%), Gaps = 11/183 (6%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            +FG VF  +SF +   SF + D THW LD+   +  AY  +R+VC+F+ N   L  + AL
Sbjct  11   LFGAVFVRKSFVISSDSFARADATHWTLDLAPLLQGAYHEVRDVCLFIPNANLLDNNSAL  70

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP-EPGGELQLTADATPLSAKIGVSVEELAT  434
            A+Y+Q+  SP+ + G V+  +PS V  L WP  P G L       P +A+IGVSVE L+ 
Sbjct  71   ALYVQAGNSPWEYRGCVSNVQPSEVFPLNWPLNPDGTL-------PATAQIGVSVEPLSE  123

Query  433  LPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
            +   +       E  A +V  +LF +M+SF G D  +L V  +++D WF  F  +  RDP
Sbjct  124  VAGREQLVLGSKEDFAKRVAMDLFRYMESFLGDD--RLGVG-NVIDNWFNKFLNKFRRDP  180

Query  253  EYL  245
             +L
Sbjct  181  NFL  183



>emb|CEF98318.1| Protein of unknown function DUF775 [Ostreococcus tauri]
Length=188

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 100/186 (54%), Gaps = 13/186 (7%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEA-YDSIREVCIFLLNNFTLPPDKAL  611
            FGVV   +S  +   SF ++D   W LD++     A +   R+ C FL +   L  + AL
Sbjct  3    FGVVLAKKSAVVLSESFRRVDERSWALDLSGGATAATHVECRDACFFLTSTGLLDDNSAL  62

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADATPLSAKIGVSVEELA  437
              YIQ+  S + +CG V  ++PS V +L WP+   GG+          +A IGVSVE LA
Sbjct  63   CFYIQAGDSAWEYCGCVANAKPSDVFALRWPKSADGGDFP--------NAAIGVSVEPLA  114

Query  436  TLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGS--KLIVPMDILDRWFKIFQERAI  263
                 + A  +  E  A +V E+LFNFMQSF G + +   ++VP++IL RWF  F  +  
Sbjct  115  LALEKEAAMVQHKETFAKRVAEDLFNFMQSFQGPESTADHMVVPVNILTRWFDKFTAKFR  174

Query  262  RDPEYL  245
            RDP +L
Sbjct  175  RDPGFL  180



>ref|NP_001049495.1| Os03g0237500 [Oryza sativa Japonica Group]
 dbj|BAF11409.1| Os03g0237500 [Oryza sativa Japonica Group]
Length=150

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 71/115 (62%), Gaps = 12/115 (10%)
 Frame = -2

Query  544  SAVLSLPWPEPGGELQLTADA--TPLSAKIGVSVEELATLPSLDV----------AAGKK  401
            +A+  + +P+    L +TA A   P S  + +S   LA  P   V            G++
Sbjct  34   AAMFGVVFPDHSFPLDVTAFAQVAPNSWALDLSTLSLAAAPRSAVVFLLPALPPPPDGQR  93

Query  400  IERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLKGF  236
             ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +DP YLK F
Sbjct  94   AERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKKDPSYLKTF  148



>gb|EMS60665.1| hypothetical protein TRIUR3_20798 [Triticum urartu]
Length=91

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 5/87 (6%)
 Frame = -2

Query  496  LTADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLI  317
            L AD T L+    +++++ A LPS      ++ ER+A++VGENLFNFMQSFC  DG KL+
Sbjct  8    LFADRTLLTT---IAIKDAAALPS--PPDEQRAERVALRVGENLFNFMQSFCAADGGKLV  62

Query  316  VPMDILDRWFKIFQERAIRDPEYLKGF  236
            VP DILDRWF+ FQERA +DP YLK F
Sbjct  63   VPTDILDRWFRKFQERAKKDPTYLKSF  89



>ref|XP_003079806.1| ribulose-phosphate 3-epimerase (IC) [Ostreococcus tauri]
Length=460

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 100/204 (49%), Gaps = 31/204 (15%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEA-YDSIREVCIFLLNN---------  638
            FGVV   +S  +   SF ++D   W LD++     A +   R+ C FL +          
Sbjct  3    FGVVLAKKSAVVLSESFRRVDERSWALDLSGGATAATHVECRDACFFLTSTGPKKRRARE  62

Query  637  ---------FTLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEP--GGELQLT  491
                       L  + AL  YIQ+  S + +CG V  ++PS V +L WP+   GG+    
Sbjct  63   TDARFRRSIAVLDDNSALCFYIQAGDSAWEYCGCVANAKPSDVFALRWPKSADGGDFP--  120

Query  490  ADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGS--KLI  317
                  +A IGVSVE LA     + A  +  E  A +V E+LFNFMQSF G + +   ++
Sbjct  121  ------NAAIGVSVEPLALALEKEAAMVQHKETFAKRVAEDLFNFMQSFQGPESTADHMV  174

Query  316  VPMDILDRWFKIFQERAIRDPEYL  245
            VP++IL RWF  F  +  RDP +L
Sbjct  175  VPVNILTRWFDKFTAKFRRDPGFL  198



>ref|XP_006651202.1| PREDICTED: uncharacterized protein LOC102715001 [Oryza brachyantha]
Length=223

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  406  KKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLKGF  236
            ++ ER+A++VGENLFNFMQSFCG DG KL+VP DILDRWF+ FQERA +DP YLK F
Sbjct  165  QRAERVALRVGENLFNFMQSFCGADGGKLVVPTDILDRWFRKFQERAKKDPAYLKTF  221



>ref|XP_002179274.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49097.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=237

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 83/160 (52%), Gaps = 19/160 (12%)
 Frame = -2

Query  673  SIREVCIFLLNNFTLPPDKALAVYIQ------------SPGSPFLFCGAVTLSRPSAVLS  530
            S+ E+  F L N   PP+  +  Y Q             P + F   G++   RPS+V  
Sbjct  75   SVHELVFFTLPNIPFPPNYGVLCYWQITAAVSQTPDLPPPSTGFELLGSIRPDRPSSVFH  134

Query  529  LPWPEPGGELQLTADATPLSAKIGVSVEELATLPSL---DVAAGKKIERLAMKVGENLFN  359
              W E    L++  + TP++  IGVS+E L  L ++    V+A K    +A K+  +LFN
Sbjct  135  TGWSEHEQLLEVAQNNTPVTLTIGVSLEPLENLQNIAGSSVSASKLF--VAQKIASDLFN  192

Query  358  FMQSF-CGVDGS-KLIVPMDILDRWFKIFQERAIRDPEYL  245
            FMQSF  G  G+ +++VP +I +RWFK F+ R  RDP + 
Sbjct  193  FMQSFDTGTGGAGQMVVPNNIFERWFKRFEARFQRDPNFF  232



>ref|XP_002952886.1| hypothetical protein VOLCADRAFT_105709 [Volvox carteri f. nagariensis]
 gb|EFJ46136.1| hypothetical protein VOLCADRAFT_105709 [Volvox carteri f. nagariensis]
Length=224

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 92/180 (51%), Gaps = 15/180 (8%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG+ F   + P+  S   Q+D THW+LD +  +   Y  ++EV +FLL    L P+ AL
Sbjct  1    MFGLFFVGVTGPITSSQLVQVDQTHWVLDCSNIIAN-YTDLKEVALFLLPGSVLDPNLAL  59

Query  610  AVYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSA-----KIGVSV  449
             +Y+++     + + G V  + PS V+ L WP       L  D +PL +     +IG+S+
Sbjct  60   GLYVKAGAVGQWAYRGCVHNTHPSEVMPLQWP-------LNDDGSPLPSSLGPVQIGISI  112

Query  448  EELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVD-GSKLIVPMDILDRWFKIFQE  272
            E    +   + +A    E  A +VG +LF F++SF     G  ++VP + LD    + ++
Sbjct  113  EPGEQIIQNEGSAHGAKEEFAKRVGLDLFRFLESFQTQQMGDHIVVPANALDSLSTLLEQ  172



>gb|KDD76521.1| hypothetical protein H632_c196p2 [Helicosporidium sp. ATCC 50920]
Length=145

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 81/184 (44%), Gaps = 54/184 (29%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FGVVF  R+ P+  S F Q D THW+LD  +   + Y  +++VC+FL +   +P + ALA
Sbjct  6    FGVVFVGRTPPLPNSVFLQKDGTHWVLDATSLHPQGYTELKDVCLFLTHPEAVPENVALA  65

Query  607  VYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATLP  428
            +Y                                                VSV E A   
Sbjct  66   LY------------------------------------------------VSVAEAAAKE  77

Query  427  SLDVAAGKKIERLAMKVGENLFNFMQSFCGVDG---SKLIVPMDILDRWFKIFQERAIRD  257
                 A K+    A +VG +LFNFMQSF GV     ++L+VP ++LD W++  + +   D
Sbjct  78   GCKRGAQKE---FAKRVGLDLFNFMQSFGGVQNVGSNQLLVPANVLDAWYQRLERKLQLD  134

Query  256  PEYL  245
            P+ L
Sbjct  135  PDCL  138



>ref|XP_007721777.1| hypothetical protein A1O1_02677 [Capronia coronata CBS 617.96]
 gb|EXJ94283.1| hypothetical protein A1O1_02677 [Capronia coronata CBS 617.96]
Length=185

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 89/190 (47%), Gaps = 16/190 (8%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I+    +  T + +        A      V +F+  N  LPPD A 
Sbjct  1    MFGVFIPSRPV---ITDMANVSPTQFAVSF-----PAAPPFHNVGVFMHPNNLLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG   F F GA+   +PSA+  +  PE   GGE+ L     P+   I V + +L
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNIPESMTGGEVNLGISVEPVQ-NIQVQMAQL  111

Query  439  ATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIFQE  272
               PS   A  K+      LA ++ +N FNF+ SF G   + + +VP+     W+  F+ 
Sbjct  112  QQTPSDVNAVAKRPPDARVLAQRIIKNAFNFLSSFAGNTANGIEVVPLKSFQDWWTKFEN  171

Query  271  RAIRDPEYLK  242
            +   DP +L+
Sbjct  172  KVRTDPGFLE  181



>ref|XP_008604221.1| hypothetical protein SDRG_00519 [Saprolegnia diclina VS20]
 gb|EQC42798.1| hypothetical protein SDRG_00519 [Saprolegnia diclina VS20]
Length=179

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 93/186 (50%), Gaps = 20/186 (11%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG+V   R     ++ F +I  T +++D+        + + ++  FLL +  +PP  A  
Sbjct  4    FGMVIAGRPV---VTDFAEISPTQFVVDV-----PYPEQVTDITFFLLPHSPVPPGYAAV  55

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWP-EPGGELQLTADATPLSAKIGVSVEELAT  434
            +Y   P    +   G+V   +PSA+    WP  P    Q      P+  ++GVS+E +  
Sbjct  56   LYFAVPHLQNWQLLGSVFAEKPSAIFRTSWPTHPDVANQ------PI-IQVGVSIEPVDN  108

Query  433  LPSLDVAAGKKIER--LAMKVGENLFNFMQSF-CGVDGSKLIVPMDILDRWFKIFQERAI  263
            + +L + A    ER   A K+  +LFNFM SF    D S +++P ++LDRW + F+ +  
Sbjct  109  VKNLGIEASGLTERKAFAHKIAVDLFNFMSSFSTSTDRSLMVIPTNLLDRWIERFEAKYR  168

Query  262  RDPEYL  245
            RDP ++
Sbjct  169  RDPNFM  174



>ref|XP_007733569.1| hypothetical protein A1O3_05254 [Capronia epimyces CBS 606.96]
 gb|EXJ84584.1| hypothetical protein A1O3_05254 [Capronia epimyces CBS 606.96]
Length=187

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 90/192 (47%), Gaps = 18/192 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I+  T +    + +        A  +   V +F+  N  LPP  A 
Sbjct  1    MFGVFIPSRPV---IAEMTSVSANQFAVSF-----PAAPTFHNVGVFMHPNNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAV--LSLPWPEPGGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG   F F GA+   +PSA+  +S+P  + GGE+ L     P+   I   + +L
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVSIPDSQTGGEVNLGISVEPVQ-NIQAQLVQL  111

Query  439  ATLPSLDVAAGKK-----IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIF  278
               PS   A  K+        LA ++ +N FNF+ SF G   + + ++P+     W+  F
Sbjct  112  QQTPSDSNAVVKRAPAPDTRVLAQRIIKNAFNFLSSFAGNTANGIEVIPLKSFQDWWTKF  171

Query  277  QERAIRDPEYLK  242
            + +   DP +L+
Sbjct  172  ESKVQNDPGFLE  183



>ref|XP_007513171.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16729.1| predicted protein [Bathycoccus prasinos]
Length=178

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 74/155 (48%), Gaps = 17/155 (11%)
 Frame = -2

Query  673  SIREVCIFLLNNFTLPPDKALAVYIQ-SPGSP----------FLFCGAVTLSRPSAVLSL  527
            S+  +C    +   L    ALA+Y++ S G            + + G VTLS PS   +L
Sbjct  22   SLTHICAQNTHYTVLDHSTALALYVKGSRGRTAENELNNNNLWEYRGCVTLSEPSNTFNL  81

Query  526  PWPEPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQS  347
             WP   G  Q   DA+     IGVS+E L      D       E  A +V  +L+NF++S
Sbjct  82   TWPIDPGTSQFYEDAS-----IGVSLEPLEECLQKDAKISGSKELFAQRVALDLWNFLKS  136

Query  346  FC-GVDGSKLIVPMDILDRWFKIFQERAIRDPEYL  245
            F  G +   L+VP ++ D W++ F  +  RDP++L
Sbjct  137  FTSGNETEHLVVPRNVFDSWYQKFTTKFRRDPDFL  171



>ref|XP_011396656.1| Protein Hikeshi [Auxenochlorella protothecoides]
 gb|KFM23778.1| Protein Hikeshi [Auxenochlorella protothecoides]
Length=138

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 7/118 (6%)
 Frame = -2

Query  589  GSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATLPSLDVAA  410
            G  + + G VT S PS V  L WPE    L       P  A+IGV  E L    + + + 
Sbjct  18   GQDWSYRGCVTNSHPSDVFPLSWPE----LPPCTVVGPGYAQIGVLAEPLDQARAKEGSK  73

Query  409  GKKIERLAMKVGENLFNFMQSFCGVDG---SKLIVPMDILDRWFKIFQERAIRDPEYL  245
                E  A  VG +LFNFMQSF GV     + L+VPM++LD W++  + R  +DP++L
Sbjct  74   LGAKEEFAKMVGLDLFNFMQSFGGVQNVGSNNLLVPMNVLDAWYQRLERRLRKDPDFL  131



>gb|KIX04340.1| hypothetical protein Z518_05208 [Rhinocladiella mackenziei CBS 
650.93]
Length=187

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 89/191 (47%), Gaps = 18/191 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     + T  + +        A   +  V IF+  N  LPPD A 
Sbjct  1    MFGVFIPARPV---IPEMGTVSTNQFAVSF-----PATPQLHNVGIFMHPNKLLPPDTAA  52

Query  610  AVYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPE--PGGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG + F F GA+   +PSA+  +  P+    G++ L     P S  I   + +L
Sbjct  53   GVYMQLPGEAGFKFLGAIGNEKPSALFRVNLPDNLTAGDVNLGISVEPAS-NIQAQMAQL  111

Query  439  ATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCG--VDGSKLIVPMDILDRWFKIFQ  275
               PS   A  K+      LA ++ ++ FNF+ SF G  V+G + +VP+     W+  F+
Sbjct  112  QQTPSTSNAVAKRPPDTRVLAQRIIKDAFNFLASFAGNTVNGIE-VVPLKSFQDWWTKFE  170

Query  274  ERAIRDPEYLK  242
             +   DP +L+
Sbjct  171  RKIQIDPGFLE  181



>emb|CBJ30038.1| conserved unknown protein [Ectocarpus siliculosus]
Length=190

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 90/192 (47%), Gaps = 25/192 (13%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG++ P R     I  F  ID++  + ++ T        + E+  FLL    +PP +   
Sbjct  9    FGIIVPGRPV---IPEFRAIDSSKCVTEIVT-----PREVDELVFFLLPTSPVPPGQTAV  60

Query  607  VYIQSPGSP------FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVE  446
            +Y   P +       +   GA+  S+PS V    WP    ++Q          ++GVS+E
Sbjct  61   LYFSVPTATTGAFEHWEVLGALAASKPSGVFRTGWPT-NEQMQSCG-----VVQLGVSIE  114

Query  445  ELATLPSLDVAAGKKIER--LAMKVGENLFNFMQSFCGVDGSK---LIVPMDILDRWFKI  281
               T  +L + AG   +R   A+K+ ++LF FM SF     +    ++VP ++LDRW   
Sbjct  115  SADTATNLGLCAGGVQDRKNFALKIAKDLFQFMSSFSQSTQAGPELMVVPTNVLDRWILR  174

Query  280  FQERAIRDPEYL  245
            F+ +  RDP ++
Sbjct  175  FESKYNRDPNFM  186



>ref|XP_009153374.1| hypothetical protein HMPREF1120_01116 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52913.1| hypothetical protein HMPREF1120_01116 [Exophiala dermatitidis 
NIH/UT8656]
Length=188

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 85/192 (44%), Gaps = 17/192 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I+    +    + +        A      V +F+  N  LPPD A 
Sbjct  1    MFGVFIPSRPV---ITEMANVSPNQFAVSF-----PASPPFHNVGVFMHPNNLLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEP--GGELQLTADATPLS--AKIGVSVE  446
             VY+Q PG   F F GA+   +PSA+  +  PE   GGE+ L     P          ++
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNIPEAMTGGEINLGISVEPAQNIQAQMAQLQ  112

Query  445  ELATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIF  278
            +    PS   A  K+      LA ++ +N FNF+ SF G   + + +VP+     W+  F
Sbjct  113  QTQQTPSESNAVAKRPPDTRVLAQRIIKNAFNFLSSFAGNTANGIEVVPLKSFQDWWTKF  172

Query  277  QERAIRDPEYLK  242
            + +   DP +L+
Sbjct  173  EHKVQNDPGFLE  184



>ref|XP_002835626.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ79783.1| unnamed protein product [Tuber melanosporum]
Length=183

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 92/199 (46%), Gaps = 37/199 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MF ++ P R     I+S   I+ T       TFV      +  + +FLL +  +PP  A 
Sbjct  1    MFAIICPGRPV---ITSLHSINPT-------TFVQTLTLPVNHIVVFLLPDTHIPPTHAA  50

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            +V+IQ P  PF   GA++ ++PSA+            ++ A A      +GVS+EE   +
Sbjct  51   SVHIQFPNQPFRILGAISAAKPSAI-----------FRVDAKALEGEVVVGVSIEEAGNV  99

Query  430  -------PSLDVAAGKKIER--LAMKVGENLFNFMQSFC-GVDGSK------LIVPMDIL  299
                     +    GK++E   LA ++  + FNF+ SF    DGS+       +VP+   
Sbjct  100  AWKVGEGAGVPGGKGKQVETVVLARRIITDAFNFLSSFASAADGSRGERGWEELVPLKAF  159

Query  298  DRWFKIFQERAIRDPEYLK  242
              W+  F+++   DP +L+
Sbjct  160  RDWWVKFEKKIELDPGFLE  178



>ref|XP_009536811.1| hypothetical protein PHYSODRAFT_262726 [Phytophthora sojae]
 gb|EGZ07245.1| hypothetical protein PHYSODRAFT_262726 [Phytophthora sojae]
Length=184

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 88/185 (48%), Gaps = 18/185 (10%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG+V   R     I+ F +I   H+++D+          + ++  FLL    +PP     
Sbjct  10   FGLVIAGRPV---ITDFREIGPAHYVVDI-----VEPTQVTDLTFFLLPGSPVPPGFGAV  61

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            +Y   P    +   G V   +PSA+    WP             P+  ++GVS+E L  +
Sbjct  62   LYFAVPALQNWQLLGTVFTEKPSAIFRTSWPT-----HPDVVGQPV-LQLGVSIESLDNV  115

Query  430  PSLDVAAGKKIER--LAMKVGENLFNFMQSF-CGVDGSKLIVPMDILDRWFKIFQERAIR  260
             +L + A    ER   A+K+ ++LFN++ SF    + S + +P ++LD+W + F+ +  R
Sbjct  116  KNLGIEASGLEERKAFALKIAQDLFNYLSSFSTSTNQSYMTIPTNLLDKWMERFEAKYRR  175

Query  259  DPEYL  245
            DP ++
Sbjct  176  DPNFM  180



>ref|XP_002379241.1| DUF775 domain protein [Aspergillus flavus NRRL3357]
 ref|XP_003189922.1| hypothetical protein AOR_1_1316014 [Aspergillus oryzae RIB40]
 gb|EED50465.1| DUF775 domain protein [Aspergillus flavus NRRL3357]
 gb|KJJ35954.1| Protein of unknown function DUF775 [Aspergillus flavus AF70]
Length=196

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 94/205 (46%), Gaps = 39/205 (19%)
 Frame = -2

Query  790  MFGVVFPNRS-----FPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLP  626
            MF V+ P R       P+D     Q     + + +          + ++ +FLL    LP
Sbjct  1    MFSVIIPGRPCLTDIVPVDPQPNGQATKFAFTIPLTP-------DLSDLVVFLLPGTVLP  53

Query  625  PDKALAVYIQSPGSP--FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVS  452
            PD A A+YIQ P  P  F F GA+   +PSA+L      P  +LQ       ++A +G+S
Sbjct  54   PDTAAAIYIQFPSDPNGFRFIGALANEKPSAILPT---SPPPDLQPG-----MTATLGIS  105

Query  451  VEELATL-PSLDV------AAGKKIER--------LAMKVGENLFNFMQSFCGVDGSKLI  317
            +E +AT+ P L+       A+G+ + +        LA ++  N FNF+ SF   D     
Sbjct  106  LEPIATVAPQLEALEAEKGASGQLVRQTRQITTKVLAQRIIGNAFNFLASFASSDQDA--  163

Query  316  VPMDILDRWFKIFQERAIRDPEYLK  242
            VP+     W+  F+ +   DP +L+
Sbjct  164  VPLKAFRDWWSKFERKVDMDPSFLE  188



>ref|XP_007339861.1| DUF775-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD52018.1| DUF775-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=200

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 87/194 (45%), Gaps = 28/194 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG V P R    DI    QID TH +  +         SI  +C+FLL     PP+   
Sbjct  1    MFGCVIPGRLVQTDIQ---QIDETHAVFHLRDAA-----SINHICVFLLGTVPFPPEYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL---------PWPEPGGELQLTADATPLSAKIG  458
             +YI  PG  F   G ++  +PSA+  L                 +  +++    S  +G
Sbjct  53   TLYIYLPGKGFQLLGMLSNDKPSAIFRLRGTFTASSSAANALSNAMISSSEGQDTSCMLG  112

Query  457  VSVEE----LATLPSLDVAA---GKKIERLAMKVGENLFNFMQSFCGVDGSKL----IVP  311
            +S+E     LA +P    AA    +   +LA KV ++LFNF+ SF     + L     +P
Sbjct  113  ISIEPLSAILAQVPPTSSAAPAPQQDPAQLAEKVVKHLFNFLSSFAPNPSAPLAPDTAIP  172

Query  310  MDILDRWFKIFQER  269
            + ++ +W++ F ++
Sbjct  173  IGLVSKWYESFLQK  186



>gb|KIW44056.1| hypothetical protein PV06_05096 [Exophiala oligosperma]
Length=184

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 87/190 (46%), Gaps = 17/190 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I+    I  T + +        A      V +F+  N  LPP  A 
Sbjct  1    MFGVFIPSRPV---IAEMGTISQTQFAVSF-----PASPQFHNVGVFMHPNQVLPPGSAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPE--PGGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG   F F GA+   +PSA+  +  P+    GE+ L     P+   I   + +L
Sbjct  53   GVYMQLPGEQGFKFLGAIANEKPSALFKVNIPDSLAAGEINLGISVEPVQ-NIQAQMAQL  111

Query  439  ATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIFQE  272
                S  +A  K+    + LA ++ +N FNF+ SF G   + + +VP+     W+  F+ 
Sbjct  112  QE-SSGSMALAKRPLDTKVLAQRIIKNAFNFLASFAGNTANGIEVVPLKSFQDWWTKFER  170

Query  271  RAIRDPEYLK  242
            +   DP +L+
Sbjct  171  KVQNDPGFLE  180



>emb|CCA72516.1| hypothetical protein PIIN_06453 [Piriformospora indica DSM 11827]
Length=198

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 87/190 (46%), Gaps = 27/190 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++    Q+D TH      TF  EA ++I  +C+F+L     PP  A 
Sbjct  1    MFGCCVAGRLLQTNLQ---QVDETHC-----TFALEAAETINHICVFMLGTVPFPPGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGE-------LQLTADATPLSAKIGVS  452
             V+   PG  F   G ++  +PSA+  +       +       LQ + D    +A++G++
Sbjct  53   TVHFYWPGKGFQLLGMLSNEKPSAIFRVRGTFGSTQSASHQVILQSSQDQASTTAQLGIA  112

Query  451  VE-------ELATLPSLDVAAGKK----IERLAMKVGENLFNFMQSFCGVD-GSKLIVPM  308
            +E       +++TL S   +   +       LA  +G++L N++ SF     G ++ VP+
Sbjct  113  IETIDAVQSQISTLQSAQTSGASRPLTDPVALAEGIGKHLMNYLSSFGQSGPGGQVYVPI  172

Query  307  DILDRWFKIF  278
              + +W++ F
Sbjct  173  AAVGKWYESF  182



>ref|XP_005834150.1| hypothetical protein GUITHDRAFT_107080 [Guillardia theta CCMP2712]
 gb|EKX47170.1| hypothetical protein GUITHDRAFT_107080 [Guillardia theta CCMP2712]
Length=189

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 82/180 (46%), Gaps = 18/180 (10%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG + P R  P    SF QI+   W +D++         IR+V +FL    T+     L+
Sbjct  18   FGYLVPGRP-PQYSDSFQQIEPAKWSIDIDN-----SQQIRDVVVFLTQPLTVA-GMGLS  70

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
             YI  P    + F GA+T   PS V  + WP   G         P +A++GVS+E L  +
Sbjct  71   CYITGPPFEKWHFIGALTNECPSGVFRVRWPPDEG--------APTAARLGVSIESLDLI  122

Query  430  PSLDVA-AGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDP  254
                 +  G ++      V ++L+N++ SF  +      + +   D W K F+E+  RDP
Sbjct  123  AQQQASLPGTELVDFGKSVAKDLWNYLTSFEIMHQQGQFL-LQYFDAWMKRFEEKCKRDP  181



>gb|KJK60227.1| Protein of unknown function DUF775 [Aspergillus parasiticus SU-1]
Length=196

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 93/208 (45%), Gaps = 45/208 (22%)
 Frame = -2

Query  790  MFGVVFPNRS-----FPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLP  626
            MF V+ P R       P+D     Q     + + +          + ++ +FLL    LP
Sbjct  1    MFSVIIPGRPCLTDIVPVDPQPNGQATKFAFTIPLTP-------DLSDLVVFLLPGTVLP  53

Query  625  PDKALAVYIQSPGSP--FLFCGAVTLSRPSAVLSLPWP---EPGGELQLTADATPLSAKI  461
            PD A A+YIQ P  P  F F GA+   +PSA+L    P   +PG           ++A +
Sbjct  54   PDTAAAIYIQFPSDPNGFRFIGALANEKPSAILPTSPPPNLQPG-----------MTATL  102

Query  460  GVSVEELATL-PSLDV------AAGKKIER--------LAMKVGENLFNFMQSFCGVDGS  326
            G+S+E +AT+ P L+       A G+ + +        LA ++  N FNF+ SF   D  
Sbjct  103  GISLEPIATVAPQLEALEAEKGAPGQLVRQTRQITTKVLAQRIIGNAFNFLASFASSDQD  162

Query  325  KLIVPMDILDRWFKIFQERAIRDPEYLK  242
               VP+     W+  F+ +   DP +L+
Sbjct  163  A--VPLKAFRDWWSKFERKVDMDPSFLE  188



>gb|KIV93798.1| hypothetical protein PV10_04987 [Exophiala mesophila]
Length=187

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 85/200 (43%), Gaps = 34/200 (17%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG   P R     I   T +    + + + T           V +FL  N  LPPD A 
Sbjct  1    MFGAFVPTRPL---IPELTTVSPNQFAISIPT-----QPPFHNVGVFLHPNQQLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PG   F F GA+   +PSA+          ++ ++ +  P    +G+SVE +  
Sbjct  53   GVYMQLPGEQGFKFLGAIANEKPSALF---------KVNISDNQAPGEINLGISVEPVQN  103

Query  433  LPSL------------DVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDI  302
            + +L              A  K+      LA ++ +N +NF  SF G   + + ++P+  
Sbjct  104  IQALLAELKQSSQGSSSTAVTKRPPDTRVLAQRIIQNAYNFTSSFAGNLANGVEVIPLKS  163

Query  301  LDRWFKIFQERAIRDPEYLK  242
               W+  F+ R   DP +L+
Sbjct  164  FQEWWAKFERRVQNDPSFLE  183



>gb|KDO27912.1| hypothetical protein SPRG_07185 [Saprolegnia parasitica CBS 223.65]
Length=720

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 92/186 (49%), Gaps = 20/186 (11%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG+V   R     ++ F +I  T +++D+        + + ++  FLL +  +P   A  
Sbjct  545  FGMVIAGRPV---VTDFAEISPTQFVVDV-----PYPEQVTDITFFLLPHSPVPLGYAAV  596

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWP-EPGGELQLTADATPLSAKIGVSVEELAT  434
            +Y   P    +   G+V   +PSA+    WP  P    Q      P+  ++GVS+E +  
Sbjct  597  LYFAVPHLQNWQLLGSVFAEKPSAIFRTSWPTHPDVANQ------PV-IQVGVSIEPVDN  649

Query  433  LPSLDVAAGKKIER--LAMKVGENLFNFMQSF-CGVDGSKLIVPMDILDRWFKIFQERAI  263
            + +L + A    ER   A K+  +LFNFM SF    D S +++P ++LDRW + F+ +  
Sbjct  650  VKNLGIEASGLTERKAFAHKIAVDLFNFMSSFSTSTDRSLMVIPTNLLDRWIERFEAKYR  709

Query  262  RDPEYL  245
            RDP ++
Sbjct  710  RDPNFM  715



>ref|XP_003066376.1| hypothetical protein CPC735_056010 [Coccidioides posadasii C735 
delta SOWgp]
 gb|EER24231.1| hypothetical protein CPC735_056010 [Coccidioides posadasii C735 
delta SOWgp]
 gb|EFW14204.1| DUF775 domain-containing protein [Coccidioides posadasii str. 
Silveira]
Length=224

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 99/224 (44%), Gaps = 46/224 (21%)
 Frame = -2

Query  790  MFGVVFPNR---SFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPD  620
            MF VV P+R   + P  I +      T+++     F   A+     + +FLL   TLP D
Sbjct  1    MFSVVLPSRPCLTNPTPIQADPSSPATNFV-----FTFPAWPKFSHIVVFLLPGITLPAD  55

Query  619  KALAVYIQ--SPGSP------FLFCGAVTLSRPSAVLSLPWP-----EPGGELQLTADAT  479
             A AVYIQ  +  +P      F F GA+   +PSA+  +  P     E   E ++    +
Sbjct  56   AAAAVYIQFSTEANPNPNPQDFRFLGAIANEKPSAIFKVNDPVRQRTEAEEEDEMLDAGS  115

Query  478  PLSAKI------GVSVE-------ELATLPSLD-----VAAGKKIER-------LAMKVG  374
            P S  I      G+S+E       +LATL +       V  G   +R       LA ++ 
Sbjct  116  PPSPNINMTVTLGISIEPAQTVASKLATLKAQSASTELVRRGDMFQRPNIPTKLLAQRII  175

Query  373  ENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
             N FNF+ SF   DG + +VP+     W+  F+ R   DP +L+
Sbjct  176  GNAFNFLSSFATSDGREEMVPLKSFRDWWSKFERRIESDPGFLE  219



>ref|XP_001246897.1| hypothetical protein CIMG_00668 [Coccidioides immitis RS]
 gb|EAS35314.3| hypothetical protein CIMG_00668 [Coccidioides immitis RS]
Length=224

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 99/224 (44%), Gaps = 46/224 (21%)
 Frame = -2

Query  790  MFGVVFPNR---SFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPD  620
            MF VV P+R   + P  I +      T+++     F   A+     + +FLL   TLP D
Sbjct  1    MFSVVLPSRPCLTNPTPIQADPSSPATNFV-----FTFPAWPKFSHIVVFLLPGITLPAD  55

Query  619  KALAVYIQ-SPGS-------PFLFCGAVTLSRPSAVLSLPWP-----EPGGELQLTADAT  479
             A AVYIQ S G+        F F GA+   +PSA+  +  P     E   E ++    +
Sbjct  56   AAAAVYIQFSTGANPNPNPQDFRFLGAIANEKPSAIFKVNDPVRQRTEAEEEDEMLDAGS  115

Query  478  PLSAKI------GVSVE-------ELATLPSLD-----VAAGKKIER-------LAMKVG  374
            P S  I      G+S+E       +LATL +       V  G   +R       LA ++ 
Sbjct  116  PPSPNINMTVTLGISIEPAQAVASKLATLKAQSASTELVRRGDMFQRPNISTKLLAQRII  175

Query  373  ENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
             N FNF+ SF   DG + +VP+     W+  F+ R   DP +L+
Sbjct  176  GNAFNFLSSFATSDGREEMVPLKSFRDWWSKFERRIESDPGFLE  219



>ref|XP_002541152.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP75819.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 97/221 (44%), Gaps = 40/221 (18%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MF VV P R   +  S+  Q D      +   F   A+     + +FLL   TLPP  A 
Sbjct  1    MFSVVLPGRPC-LTNSTPIQGDPNSPATNF-VFTFPAWPKFSHIVVFLLPGVTLPPGAAA  58

Query  610  AVYIQ-SPGSP-------FLFCGAVTLSRPSAVLSLPWP-----EPGGELQLTADATP--  476
            AVYIQ S G+        F F GA+   +PSA+  +  P     E   E ++  +  P  
Sbjct  59   AVYIQFSTGATPTPNPQDFRFLGAIADEKPSAIFRVNDPVRRRTEAEEEDEMLDEGAPPS  118

Query  475  ----LSAKIGVSVE-------ELATLPS----------LDVAAGKKIER--LAMKVGENL  365
                ++  +G+S+E       +LATL S          +DV     I    LA ++  N 
Sbjct  119  PNVNMTVTLGISIEPAQSVAAKLATLKSQSQSMELAKTVDVQQRPNISTRLLAQRIIGNA  178

Query  364  FNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            FNF+ SF   DG + +VP+     W+  F+ R   DP +L+
Sbjct  179  FNFLSSFATSDGREEVVPLKSFRDWWTKFERRIDTDPGFLE  219



>gb|KIW11818.1| hypothetical protein PV08_09091 [Exophiala spinifera]
Length=184

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 85/190 (45%), Gaps = 17/190 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     +   + I  T + +        A      V +F+  N  LPP  A 
Sbjct  1    MFGVFIPARPV---VGEMSTISPTQFAISF-----PASPPFHNVGVFMHPNQVLPPGSAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPE--PGGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG   F F GA+   +PSA+  +  P+    GE+ L     P+   I   + +L
Sbjct  53   GVYMQLPGEQGFKFLGAIANEKPSALFKVTIPDSLAAGEINLGISVEPVQ-NIQAQMAQL  111

Query  439  ATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIFQE  272
                S   A  K+    + LA ++ +N FNF+ SF G   + + +VP+     W+  F+ 
Sbjct  112  QE-SSGSTALAKRPPDTKVLAQRIIKNAFNFLASFAGNTANGIEVVPLKSFQDWWAKFER  170

Query  271  RAIRDPEYLK  242
            +   DP +L+
Sbjct  171  KIQNDPGFLE  180



>ref|XP_002288292.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93728.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=215

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 97/208 (47%), Gaps = 27/208 (13%)
 Frame = -2

Query  793  EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKA  614
            ++FGV+ P      D S+ +    T + L ++   G    S+ ++  FLL   +LP D  
Sbjct  9    QVFGVLIPGGIVRTDFSA-SDPRGTKFSLQLSGISGSDISSVSDLVFFLLPGVSLPQDCG  67

Query  613  LAVY----------------IQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADA  482
              +Y                 QS  + F   GA+   +PS      W     E   +A  
Sbjct  68   AMLYWQIVTTPVVTNATPFSAQSTTTEFELVGAIANHKPSGSFRTGWAT--NESLSSAIN  125

Query  481  TP----LSAKIGVSVEELATLPSLDVAAGKKIERLAMKVGENLFNFMQSF-CGVDGS-KL  320
            +P    ++  +GVS+E L+ + ++  A G K   +A K+  +LFN+MQSF  G  G+  +
Sbjct  126  SPCGSIVTINLGVSLEPLSNIQNIG-AMGDKTNHVAKKIALDLFNYMQSFDTGSGGAGNM  184

Query  319  IVPMDILDRWFKIFQERAIRDPE-YLKG  239
            +VP ++ DRW   F+ +A  DP  ++KG
Sbjct  185  VVPKNVFDRWMARFEAKARVDPNFFMKG  212



>ref|XP_002786756.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 ref|XP_002787856.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER18552.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER19652.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=188

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 87/190 (46%), Gaps = 25/190 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDK-A  614
            +FG+  P R     I+ F Q   T W +D+         SI    +FLL    +P D   
Sbjct  12   LFGLAIPGRPL---ITEFVQDTETSWHVDVPN-----PGSISSFSVFLLR--PIPSDAVG  61

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSA-KIGVSVEELA  437
            L VY  +      F GA++ ++P+ + S  WP       L  D   + A +IG++ E   
Sbjct  62   LGVYYTATTDGAAFVGALSNAKPTDIFSPGWP-------LNPDIASMPAVRIGLAFEPSE  114

Query  436  TLPSLDVAAGKKIE---RLAMKVGENLFNFMQSF---CGVDGSKLIVPMDILDRWFKIFQ  275
            TL      AG+  +     A KV  NLF +++SF    G D   +  P D+LDRW + F 
Sbjct  115  TLLPKMSTAGESTDFKREFARKVALNLFRYIESFNTSGGGDARFMRCPQDLLDRWLQRFD  174

Query  274  ERAIRDPEYL  245
            ++  +DP ++
Sbjct  175  DKYNKDPMFV  184



>ref|XP_009824847.1| hypothetical protein H257_02755 [Aphanomyces astaci]
 gb|ETV86375.1| hypothetical protein H257_02755 [Aphanomyces astaci]
Length=179

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 90/185 (49%), Gaps = 18/185 (10%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG V   R     I+ + +I  T +++D+        + + ++  F+L    +PP  A  
Sbjct  5    FGTVIAGRPV---ITDYIEISPTQFVIDI-----PYPEQVTDITFFMLPQSPVPPGFAAV  56

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            +Y   P    +   G V   +PSA+    WP             P+  ++GVS+E + ++
Sbjct  57   LYFAVPHLQNWQLLGGVFAEKPSAIFRTAWPT-----HPDVVGQPV-IQLGVSIESVESV  110

Query  430  PSLDVAAGKKIER--LAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIFQERAIR  260
             +L + A    ER   A+K+ ++LFNFM SF     S + +VP ++LDRW + F+ +  R
Sbjct  111  RNLGIEASGLEERKSFALKIAQDLFNFMTSFSTSTNSSMMVVPTNLLDRWMERFESKYRR  170

Query  259  DPEYL  245
            DP ++
Sbjct  171  DPNFM  175



>ref|XP_002771635.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER03451.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=188

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (47%), Gaps = 25/190 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDK-A  614
            +FG+  P R     I+ F Q   T W +D++        SI    +FLL    +P D   
Sbjct  12   LFGLAIPGRPL---ITDFVQDTETSWHVDVSN-----PGSISSFSVFLLR--PVPSDTVG  61

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSA-KIGVSVEELA  437
            L VY  +      F GA++ ++P+ + S  WP       L  D   + A +IG++ E   
Sbjct  62   LGVYYTATTDGAAFVGALSNAKPTDIFSPGWP-------LNPDIASMPAVRIGLAFEPSE  114

Query  436  TL-PSLD-VAAGKKIER-LAMKVGENLFNFMQSF---CGVDGSKLIVPMDILDRWFKIFQ  275
            TL P +  V      +R  A KV  NLF +++SF    G D   +  P D+LDRW + F 
Sbjct  115  TLLPKMSTVGESADFKREFARKVALNLFRYIESFNTSGGGDARFMRCPQDLLDRWLQRFD  174

Query  274  ERAIRDPEYL  245
            ++  +DP ++
Sbjct  175  DKYTKDPMFV  184



>gb|KIW60561.1| hypothetical protein PV05_00768 [Exophiala xenobiotica]
Length=192

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 87/197 (44%), Gaps = 23/197 (12%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I   + I  T + +        A      V +F+  N  LPP  A 
Sbjct  1    MFGVFIPSRPV---IPEMSTISPTQFAISF-----PASPQFHNVGVFMHPNQELPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPE----PGGELQLTADATPLSAKIGVSVE  446
             VY+Q PG   F F GA+   +PSA+  +  PE    PG ++ L     P+   I   + 
Sbjct  53   GVYMQLPGEQGFKFFGAIGNEKPSALFRVNIPEAMLAPGQQVNLGLSVEPVQ-NIQAQMA  111

Query  445  ELATLPSLDVAAGKKI--------ERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDR  293
            +L    S   ++G  +          LA ++ +N FNF+ SF G   + + +VP+     
Sbjct  112  QLQQDSSSSSSSGAMVVAKRPPDTRVLAQRIIKNAFNFLASFAGNTANGIEVVPLKSFQD  171

Query  292  WFKIFQERAIRDPEYLK  242
            W+  F+ +   DP +L+
Sbjct  172  WWSKFERKVQNDPGFLE  188



>ref|XP_002782001.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER13796.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=188

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 88/190 (46%), Gaps = 25/190 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDK-A  614
            +FG+  P R     I+ F Q   T W +D+         SI    +FLL    +P D   
Sbjct  12   LFGLAIPGRPL---ITDFVQDTETSWHVDVPN-----PGSISSFSVFLLR--PVPSDTVG  61

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSA-KIGVSVEELA  437
            L VY  +      F GA++ ++P+ + S  WP       L  D   + A +IG++ E   
Sbjct  62   LGVYYTATTDGAAFVGALSNAKPTDIFSPGWP-------LNPDIASMPAVRIGLAFEPSE  114

Query  436  TL-PSLD-VAAGKKIER-LAMKVGENLFNFMQSFCGVDGSK---LIVPMDILDRWFKIFQ  275
            TL P +  V      +R  A KV  NLF +++SF   DG     +  P D+LDRW + F 
Sbjct  115  TLLPKMSTVGESADFKREFARKVALNLFRYIESFNTSDGGDARFMRCPQDLLDRWLQRFD  174

Query  274  ERAIRDPEYL  245
            ++  +DP ++
Sbjct  175  DKYTKDPMFV  184



>gb|EWM23609.1| Protein of unknown function DUF775 [Nannochloropsis gaditana]
Length=182

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 92/188 (49%), Gaps = 21/188 (11%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FGVV P R   +D   +  I+ T ++ ++ +        + ++  FLL N  LPP    A
Sbjct  4    FGVVCPGRPVMVD---WRPINETKFVCEIASPA-----QVTDLTFFLLPNIVLPPGTGTA  55

Query  607  VYIQ-SPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            +Y    P + +   GA+TL +PS V    W    G  Q+ A       ++GVS+E L T+
Sbjct  56   LYYSLPPFAEWTVLGALTLDKPSGVFRTGWSTIEGIAQMPA------IQLGVSLESLDTI  109

Query  430  PSLDVAAGKKIER--LAMKVGENLFNFMQSFC--GVDGSK--LIVPMDILDRWFKIFQER  269
             +LD+      ER   A K+ ++L++F+ SF      G +  +++P + +D W + F  +
Sbjct  110  TNLDLQKSGVDERRLFAHKIAQDLWSFVCSFAQQTQQGGREAVLLPANAMDMWLERFDRK  169

Query  268  AIRDPEYL  245
               DP ++
Sbjct  170  YRLDPSFM  177



>ref|XP_008043899.1| DUF775-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW53670.1| DUF775-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=203

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 91/198 (46%), Gaps = 32/198 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    ++    Q+D TH + ++      +  SI  VC+FLL     P     
Sbjct  1    MFGCLVAGRLLQTNLQ---QVDETHAIFEL-----PSAGSINHVCVFLLGTAPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-------DATP--LSAKIG  458
             V+   PG  F   G ++  +PSA+  L            A       D +P  ++A +G
Sbjct  53   TVHFFWPGKGFQLLGMLSNDKPSAIFRLRGTFSAQTTDAHAVFSGAASDVSPADVTAILG  112

Query  457  VSVE-------ELATLPSLDVAAGKK----IERLAMKVGENLFNFMQSFCGVDGSKL---  320
            +S+E       E+++LPS  V A         RLA ++ ++LFN++ SF G + S +   
Sbjct  113  LSIEPLPQIMQEVSSLPSAMVKANNNPTADATRLAERIVKHLFNYVSSFVGGNPSAMSPD  172

Query  319  -IVPMDILDRWFKIFQER  269
             +VPM ++ +W++ F  +
Sbjct  173  FLVPMGVIAKWYENFMGK  190



>ref|XP_008730276.1| hypothetical protein G647_07742 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21395.1| hypothetical protein G647_07742 [Cladophialophora carrionii CBS 
160.54]
Length=201

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 86/211 (41%), Gaps = 42/211 (20%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     +    + +        A      V +FL  N  LPPD A 
Sbjct  1    MFGVFVPTRPV---IPEMATVGPNQFAVSF-----PATPPFHNVGVFLHPNSPLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PG+P F F GA+   +PSA+  +  P        TA A      +GVSVE +  
Sbjct  53   GVYMQLPGAPGFRFLGALANEKPSALFRVNLP------TTTAAAAVGDVNLGVSVEPVQN  106

Query  433  LPSL----------------------DVAAGKK----IERLAMKVGENLFNFMQSFCGVD  332
            + +                       D A  K+       LA ++ +N FNF+ SF G  
Sbjct  107  IQAQMAQLQQQQQQPLSPLSPTSNNNDAALPKRPPPDTRVLAQRIIKNAFNFLASFAGNT  166

Query  331  GSKL-IVPMDILDRWFKIFQERAIRDPEYLK  242
             + + +VP+     W+  F+ +   DP +L+
Sbjct  167  ANGIEVVPLKSFQDWWAKFERKVQNDPGFLE  197



>ref|XP_002340363.1| DUF775 domain protein [Talaromyces stipitatus ATCC 10500]
 gb|EED22976.1| DUF775 domain protein [Talaromyces stipitatus ATCC 10500]
Length=264

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 97/223 (43%), Gaps = 42/223 (19%)
 Frame = -2

Query  793  EMFGVVFPNRSFPMDISSFTQIDTTHWLLDMN-TFVGEAYDSIREVCIFLLNNFTLPPDK  617
            EMF VV P R    DI   T +D    +      F+  A      + IF L    LPPD 
Sbjct  39   EMFSVVIPGRPCLTDI---TAVDAQPGVQPTKFAFIFPAAPKFNHIVIFFLPGTVLPPDT  95

Query  616  ALAVYIQSP-------GSPFLFCGAVTLSRPSAVLSL----PWPEPGGELQLTADATPL-  473
            A A+Y+Q+P       GS F F GA+   +PSA+  +       + G + ++  D   + 
Sbjct  96   AAAIYLQTPTSKQTPNGSEFRFLGAIGNEKPSAIFKVGSGTQQTQTGIDDEMVDDGNDII  155

Query  472  --SAKIGVSVE-------ELATL--------PSLDVA----AGKKIER--LAMKVGENLF  362
                 +G+S+E       ++A L        PS D+       K+I    LA +V  N F
Sbjct  156  NGQVTLGISIEPAQNVAAQMAALNASRGTQQPSTDLVRLPPQQKQITTKILAQRVIGNAF  215

Query  361  NFMQSFCGVDGSKL---IVPMDILDRWFKIFQERAIRDPEYLK  242
            NF+ SF   D ++    +VP+     W+  F+ R   DP +L+
Sbjct  216  NFLASFAESDPNRKGEDVVPLKSFRDWWTKFERRIDMDPSFLE  258



>ref|XP_001216308.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU31949.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=218

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 93/213 (44%), Gaps = 33/213 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSF-TQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKA  614
            MF V+ P R    DI +   Q +        N  +     S  E+ +F L    LP D A
Sbjct  1    MFSVIIPGRPCLTDIVALDAQPNGQATKFAFNFPI---TPSFTEIVVFFLPGTVLPQDTA  57

Query  613  LAVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP----EPGGELQLTADATPLSAKIGVSVE  446
             A+YIQ PG+ F F GA+   +PSAVL +  P    E   E  +  +    +A +G+S+E
Sbjct  58   AAIYIQFPGAEFRFIGALANEQPSAVLKVRPPPRRTEAEEEDVMLDEGAAGNATLGISIE  117

Query  445  -------ELATL---------PSLDVAAGKKIER------LAMKVGENLFNFMQSFCGVD  332
                   +LA L         PS D+    + ++      LA ++  N FNF+ SF   D
Sbjct  118  PVQNVAPQLAALEAEKGAGAGPSTDLVRQTRQQKEITTKVLAQRIIGNAFNFLASFAESD  177

Query  331  ---GSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
                 + +V +     W+  F+ +   DP +L+
Sbjct  178  PNNKGQEVVSLKAFRDWWSKFERKVDMDPTFLE  210



>gb|KIK07065.1| hypothetical protein K443DRAFT_87991 [Laccaria amethystina LaAM-08-1]
Length=202

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 84/197 (43%), Gaps = 31/197 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    D+    QID TH    +     ++  SI  +C+FLL     P     
Sbjct  1    MFGCCVAGRLLQTDLQ---QIDDTHAYFQL-----QSASSINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPE-PGGELQLTA---------DATPLSAKI  461
             V+   PG  F   G ++  +PSA+  L       G   + A             ++A +
Sbjct  53   TVHFFWPGKGFQLLGMLSNEKPSAIFRLKGTGFTSGTSTINAFSAFSQQGVQQNDVTATL  112

Query  460  GVSVE-------ELATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFCGVDGSK--L  320
            G+S+E       ++ TLPS     G  + R    LA ++ ++LFN++  F G  G    +
Sbjct  113  GLSIEPLSEIQLQMQTLPSALTKPGADMMRDPTVLAERIVKHLFNYVSGFTGGSGMSPDV  172

Query  319  IVPMDILDRWFKIFQER  269
             VPM ++ +W++ F  +
Sbjct  173  AVPMSVIAKWYESFMGK  189



>gb|KKA25273.1| DUF775 domain protein [Rasamsonia emersonii CBS 393.64]
Length=231

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 94/227 (41%), Gaps = 47/227 (21%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMN-TFVGEAYDSIREVCIFLLNNFTLPPDKA  614
            MF V+ P R    DI++   ID           F   AY     + +F L    LPPD A
Sbjct  1    MFSVIVPGRPCLTDIAA---IDAQPNAQPTKFAFTFPAYPKFNHIVVFFLPGTVLPPDTA  57

Query  613  LAVYIQSP-------GSPFLFCGAVTLSRPSAVLSL------PWPEPGGELQL-------  494
             A+YIQSP       G  F F GA++  +PSA+  +         E   E Q+       
Sbjct  58   AAIYIQSPESKPTPNGPEFRFLGAISNEKPSAIFKIGSSSQPRRSEAEEEDQMLDEDATG  117

Query  493  TADATPLSAKIGVSVE-------ELATL------PSLDVAAG--------KKI--ERLAM  383
              D T     +G+S+E       +LATL      P L  +          K+I  + LA 
Sbjct  118  ARDVTNGQVTLGISIEPAQSVAAQLATLNASRNPPELSSSTALVRQTPQQKQITTKVLAQ  177

Query  382  KVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            ++  N FNF+ SF      + +VP+     W+  F+ R   DP +L+
Sbjct  178  RIIGNAFNFLASFADNKQGEEMVPLKSFRDWWTKFERRIDVDPSFLE  224



>tpe|CBF89989.1| TPA: DUF775 domain protein (AFU_orthologue; AFUA_5G11100) [Aspergillus 
nidulans FGSC A4]
Length=217

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 79/173 (46%), Gaps = 30/173 (17%)
 Frame = -2

Query  673  SIREVCIFLLNNFTLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVL----SLPWPEPGG  506
            S  E+ +F L    LP D A A+YIQ PGS F F GA+   +PS+V+    S+     GG
Sbjct  38   SFSELVVFFLPGTVLPQDTAAAIYIQYPGSEFRFIGALANEKPSSVIKVSPSVRTGAQGG  97

Query  505  ELQLTADATPLSAKIGVSVE-------ELATLPSLDVAAGK---------------KIER  392
            +  + A    +   +G+S+E       +LA L + +   G                  + 
Sbjct  98   DQMVDAGNGGM-VTLGISIEPVQVVAPQLAQLEAANGGNGGASTDLIKQTPQQKGITTKV  156

Query  391  LAMKVGENLFNFMQSFCGVDGS---KLIVPMDILDRWFKIFQERAIRDPEYLK  242
            LA ++  N FNF+ SF   D S   + +VP+     W+  F+ R   DP +L+
Sbjct  157  LAQRIVGNAFNFLASFASSDPSNRGQEVVPLKAFHDWWTKFERRINVDPTFLE  209



>ref|XP_002140125.1| hypothetical protein [Cryptosporidium muris RN66]
 gb|EEA05776.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
Length=177

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 93/192 (48%), Gaps = 34/192 (18%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG++ P R+    +S+  Q     W+ ++         +I  + IFL  N  LP D+  A
Sbjct  3    FGILVPGRA----VSAPVQESECRWIAEL-----PQPSTIHNLTIFL--NQPLPTDQCGA  51

Query  607  --VYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVE----  446
               Y  +P + + F G +T  RPS + +  WP     + L       + +IG+++E    
Sbjct  52   GIYYSFAPFTSWEFLGVITNVRPSDMFTTGWPFLPDIMNLA------TVRIGITIELSSE  105

Query  445  ---ELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCG--VDGSKLI-VPMDILDRWFK  284
               ++   P +D+      + +A K+  NLF F++SF G   + S+ I VP  +LDRWF 
Sbjct  106  LIVKVENKPPIDIN-----KEIAKKIALNLFRFIESFNGNNTNSSECIRVPQMVLDRWFV  160

Query  283  IFQERAIRDPEY  248
             F+E+  RDP +
Sbjct  161  KFEEKYNRDPYF  172



>ref|XP_007267412.1| DUF775-domain-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJD01996.1| DUF775-domain-containing protein [Fomitiporia mediterranea MF3/22]
Length=209

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 88/201 (44%), Gaps = 38/201 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG V   R   +  ++  QID TH      TF   +  +I  +C+FLL     P     
Sbjct  1    MFGCVVAGR---LVQTNMQQIDETH-----ATFELPSVSTINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL-------------PWPEPGGELQLTADATPLS  470
             V++  PG  F   GA++  +PSA+  +              + +P   +     +T  +
Sbjct  53   TVHLHWPGKGFQLLGALSNDKPSAIFRVRGTFSSTTTLNRSAFQDPNNGMSDGVASTGET  112

Query  469  AKIGVSVE-------ELATLPSLDVAAGKKIER------LAMKVGENLFNFMQSFC----  341
            A +G++VE       +LA++PS  VA             LA K+ ++LFNF+ SF     
Sbjct  113  AILGIAVEPLSVIQAQLASIPSAAVAPRSSASALSDPTVLAEKIVKHLFNFISSFAVPPG  172

Query  340  GVDGSKLIVPMDILDRWFKIF  278
            GV   +  + M  + RW++ F
Sbjct  173  GVMTPETYIQMSAITRWYESF  193



>gb|KJA23817.1| hypothetical protein HYPSUDRAFT_137223 [Hypholoma sublateritium 
FD-334 SS-4]
Length=202

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/197 (24%), Positives = 87/197 (44%), Gaps = 31/197 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++   TQ+D TH   ++   V     +I  +C+FLL +   P     
Sbjct  1    MFGCCVAGRLLQTNM---TQVDQTHAYFELANAV-----AINHICVFLLGDVPFPEGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL----------PWPEPGGELQLTADATPLSAKI  461
             V+   PG  F   G ++  +PSA+  +            P    E    ++   ++A +
Sbjct  53   TVHFLWPGKGFQVLGMISNDKPSAIFRVKSTYSENATSAAPTKFSEYSTFSNDQNVTAIL  112

Query  460  GVSVE-------ELATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFCG--VDGSKL  320
            G+SVE       +L  +P    +    + +    LA +V ++L N++  F G     S  
Sbjct  113  GLSVEPIHQIEPQLQNIPGASGSGTPNLVQNSAALAERVVKHLVNYISGFAGGAAVNSNT  172

Query  319  IVPMDILDRWFKIFQER  269
            ++PM++++RW++IF  +
Sbjct  173  MIPMNLIERWYEIFMSK  189



>ref|XP_001878996.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR10546.1| predicted protein [Laccaria bicolor S238N-H82]
Length=202

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/197 (28%), Positives = 85/197 (43%), Gaps = 31/197 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    D+    QID TH      +F   A  SI  +C+FLL     P     
Sbjct  1    MFGCCVAGRLLQTDLQ---QIDDTH-----ASFQLPAASSINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP--EPGGEL--------QLTADATPLSAKI  461
             V+   PG  F   G ++  +PSA+  L       G           Q  A  T ++A +
Sbjct  53   TVHFFWPGKGFQLLGMLSNEKPSAIFRLKGTGFTSGTSTINAFSAFSQQGALQTDVTATL  112

Query  460  GVSVE-------ELATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFCGVDGSK--L  320
            G+S+E       ++ TLPS     G  + R    LA ++ ++LFN++  F G  G    +
Sbjct  113  GLSIEPLSEIQLQMQTLPSALTKPGVDMMRDPTVLAERIVKHLFNYVSGFTGGAGMSPDV  172

Query  319  IVPMDILDRWFKIFQER  269
             VPM ++ +W++ F  +
Sbjct  173  AVPMSVIAKWYESFMGK  189



>gb|KIW33601.1| hypothetical protein PV07_00437 [Cladophialophora immunda]
Length=192

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 82/201 (41%), Gaps = 31/201 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I+    +    + +        A      V +FL  N  LPP  A 
Sbjct  1    MFGVFIPTRPI---ITEMATVSPNQFAVSF-----PASPPFHNVGVFLHPNNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PG   F F GA+   +PSA+  +  PE      +  + +     +G+SVE    
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNLPE-----AIANNPSAGQVNLGISVEPAEN  107

Query  433  L-----------PSLDVAAG-----KKIERLAMKVGENLFNFMQSFCGVDGSKL-IVPMD  305
            +           P++  A            LA ++  N FNF+ SF G   + + +VP+ 
Sbjct  108  IQAQMLQLQQQSPTVSNATALVKRPPDTRVLAQRIIRNAFNFLASFAGNTANGIEVVPLK  167

Query  304  ILDRWFKIFQERAIRDPEYLK  242
                W+  F+ R   DP +L+
Sbjct  168  SFQDWWTKFERRVQNDPGFLE  188



>emb|CDO74338.1| hypothetical protein BN946_scf184850.g10 [Trametes cinnabarina]
Length=202

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 88/194 (45%), Gaps = 31/194 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    ++    QID TH + ++         +I  VC+FLL     P     
Sbjct  1    MFGCLVAGRPLQTNLQ---QIDETHAIFEL-----PQAGTINHVCVFLLGPVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTA-------DATP--LSAKIG  458
             V+   PG  F   G ++  +PSA+  L            A       DA+P  ++A +G
Sbjct  53   TVHFYWPGKGFQLLGMLSNEKPSAIFRLRGTYTAQSTNTHAVFSGAASDASPSDVTAFLG  112

Query  457  VSVE-------ELATLPSLDVAAGK---KIERLAMKVGENLFNFMQSFCGVDGSKL----  320
            +++E       E++TLPS    A         +A ++ ++LFN++ SF G D + L    
Sbjct  113  LAIEPLTQIAQEVSTLPSAVAKANSPALDATLMAERIVKHLFNYVSSFVGGDPTSLSPEF  172

Query  319  IVPMDILDRWFKIF  278
            ++PM ++ +W++ F
Sbjct  173  LIPMGVIAKWYENF  186



>gb|KDQ12484.1| hypothetical protein BOTBODRAFT_34450 [Botryobasidium botryosum 
FD-172 SS1]
Length=220

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 88/211 (42%), Gaps = 48/211 (23%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            +FG V   RS   ++    QID TH   D++        S+  +C+FLL    LPP  A 
Sbjct  2    VFGCVVAGRSLQTNLQ---QIDDTHAAFDIDNAA-----SVNHICVFLLGTVPLPPGYAA  53

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--PWPEPGGELQ-----LTADATP--LSAKIG  458
             V+   PG  F   G ++  +PSAV  L   + +     Q     LT  A P  ++A +G
Sbjct  54   TVHFHWPGRGFQLLGMISNEKPSAVFRLRGTYTDAAAAPQSHSAFLTPGAQPSSVTATLG  113

Query  457  VSVEEL----ATLPSLDVAAGKKIER---------------------------LAMKVGE  371
            +++E L    A + SL  +   +  R                           L  ++  
Sbjct  114  IAIEPLDAVEAQMASLQTSQASQAPRSPQASSTALTPLGSASASASRLSDPAYLVERILT  173

Query  370  NLFNFMQSFCGVDGSKLIVPMDILDRWFKIF  278
            +LFN++ SF     ++ +V +  + RW+++ 
Sbjct  174  HLFNYLSSFASPGTTQGLVELATIQRWYEML  204



>gb|KIW64416.1| hypothetical protein PV04_09350 [Capronia semiimmersa]
Length=188

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 86/192 (45%), Gaps = 17/192 (9%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     +    + +        A  +   V +FL  N  LPPD A 
Sbjct  1    MFGVFIPTRPV---IPEMATVGPNQFAVSF-----PATPAFHNVGVFLHPNSPLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPG--GELQL--TADATPLSAKIGVSVE  446
             VY+Q PG   F F GA+   +PSA+  +  P+ G  G++ L  + + TP        ++
Sbjct  53   GVYMQLPGEQGFRFLGAIANEKPSALFRVNLPDGGVVGDVNLGISVEPTPNIQAQMAQLQ  112

Query  445  ELATLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWFKIF  278
            +    P    A  K+      LA ++ +N FNF+ SF G   + + +VP+     W+  F
Sbjct  113  QQQQPPPSPNAPAKRTPDTRVLAQRIIKNAFNFLASFAGNTANGIEVVPLKSFQDWWAKF  172

Query  277  QERAIRDPEYLK  242
            + +   DP +L+
Sbjct  173  ERKVQNDPGFLE  184



>ref|XP_657803.1| hypothetical protein AN0199.2 [Aspergillus nidulans FGSC A4]
 gb|EAA66072.1| hypothetical protein AN0199.2 [Aspergillus nidulans FGSC A4]
Length=363

 Score = 65.9 bits (159),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 78/173 (45%), Gaps = 30/173 (17%)
 Frame = -2

Query  673  SIREVCIFLLNNFTLPPDKALAVYIQSPGSPFLFCGAVTLSRPSAVL----SLPWPEPGG  506
            S  E+ +F L    LP D A A+YIQ PGS F F GA+   +PS+V+    S+     GG
Sbjct  184  SFSELVVFFLPGTVLPQDTAAAIYIQYPGSEFRFIGALANEKPSSVIKVSPSVRTGAQGG  243

Query  505  ELQLTADATPLSAKIGVSVEELAT----LPSLDVAAGKK------------------IER  392
            +  + A    +   +G+S+E +      L  L+ A G                     + 
Sbjct  244  DQMVDAGNGGM-VTLGISIEPVQVVAPQLAQLEAANGGNGGASTDLIKQTPQQKGITTKV  302

Query  391  LAMKVGENLFNFMQSFCGVDGS---KLIVPMDILDRWFKIFQERAIRDPEYLK  242
            LA ++  N FNF+ SF   D S   + +VP+     W+  F+ R   DP +L+
Sbjct  303  LAQRIVGNAFNFLASFASSDPSNRGQEVVPLKAFHDWWTKFERRINVDPTFLE  355



>gb|KIY03920.1| hypothetical protein Z520_00612 [Fonsecaea multimorphosa CBS 
102226]
Length=193

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 82/202 (41%), Gaps = 32/202 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I+    +    + +        A      V +FL  N  LPP  A 
Sbjct  1    MFGVFIPTRPI---IAEMATVSPNQFAVSF-----PASPPFHNVGVFLHPNNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELA-  437
             VY+Q PG   F F GA+   +PSA+  +  P+      +  + +     +G+SVE    
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNLPD-----AIANNPSAGQVNLGISVEPAEN  107

Query  436  -------------TLPSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPM  308
                         T  S   A  K+      LA ++  N FNF+ SF G   + + +VP+
Sbjct  108  IQAQMLQLQQQSPTAASNSTAVAKRPPDTRVLAQRIIRNAFNFLASFAGNTANGVEVVPL  167

Query  307  DILDRWFKIFQERAIRDPEYLK  242
                 W+  F+ R   DP +L+
Sbjct  168  KSFQDWWTKFERRVQNDPGFLE  189



>ref|XP_002046638.1| GJ12989 [Drosophila virilis]
 gb|EDW68980.1| GJ12989 [Drosophila virilis]
Length=196

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 93/202 (46%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + F  +D    L+++        +++  V IFL     LP   A 
Sbjct  1    MFGLIISGR---LPQTDFVAVDENKLLINVPDI-----EAVNYVVIFLTGISPLPLGTAA  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQLTAD-----ATPLS--AK  464
            A+Y   P +     + + G +  ++PSA+  +   + G EL   A+     A  +S  A+
Sbjct  53   AIYFSWPDANAAPTWQYLGHINNNKPSAIFKIAQLKKGHELGTQANGMVFGAQEISHIAQ  112

Query  463  IGVSVEELATLPSLD--VAAGKKIERLAMKVGENLFNFMQSFC-GV-----DGSKLIVPM  308
            IG+S+E   T+      V++    ++   ++ EN FN+  SFC GV       ++  VP 
Sbjct  113  IGISIEPELTVAQQTPAVSSANDNKQFGQRMLENFFNYASSFCVGVPEIPPATTETFVPF  172

Query  307  DILDRWFKIFQERAIRDPEYLK  242
             ++  W+  FQ R  ++P Y K
Sbjct  173  SVVQNWYTNFQRRMEQNPNYWK  194



>ref|XP_003044631.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU38918.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=198

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 75/160 (47%), Gaps = 16/160 (10%)
 Frame = -2

Query  676  DSIREVCIFLLNNFTLPPDKALAVYI----------QSPGSP-FLFCGAVTLSRPSAVLS  530
             S   + IF+L   +LPP+ A A+Y+          QS G+P F F G +   + SA+  
Sbjct  36   KSFSHIVIFMLPGVSLPPNTAAAIYLATAQDVAAAAQSGGTPNFRFLGGIGPGKESAMFK  95

Query  529  LPWPEPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGKKIER--LAMKVGENLFNF  356
            +        L +     P    +G  ++ELA   +   ++G +     LA ++ +N FNF
Sbjct  96   VSGGGDASGLMVGVSVEP-EESVGQRLQELAANKASGNSSGGQPSTTVLAQRIIQNAFNF  154

Query  355  MQSFCGVDGSKL--IVPMDILDRWFKIFQERAIRDPEYLK  242
            + SF G  G     +VP+   + W++ F+ R   DP +L+
Sbjct  155  LSSFSGTAGPGGVEVVPLKAFEDWWRKFESRVRADPSFLE  194



>ref|NP_001017577.1| protein Hikeshi [Danio rerio]
 gb|AAH92729.1| Zgc:110091 [Danio rerio]
Length=197

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 85/204 (42%), Gaps = 29/204 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R          Q D      D   F    Y+ +  V +FLL     P     
Sbjct  1    MFGCLVAGR--------LVQTDAQQVASDKFVFNLPDYEHVNHVVVFLLGTVPFPEGLGG  52

Query  610  AVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEPG-GELQ----LTADATPLSAKIG  458
            AVY+  PG      +   G +T  +PSA+  +   + G G       + A A P  A++G
Sbjct  53   AVYLCVPGGAAGQVWQLLGFITNEKPSAIFRISGLKAGEGSSHPFGMMDAPAAPSMAQVG  112

Query  457  VSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFC------GVDGSKLIV  314
            VSVE L  L       S  V+      +   K+ ++LFNF  SF         + S++ +
Sbjct  113  VSVEGLHLLAQQTPVSSSAVSTLDSFTQFTQKMLDSLFNFTSSFALSQSRMSPNPSEMFI  172

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P   + RW++ FQ R +++P + K
Sbjct  173  PASSIRRWYENFQRRLMQNPNFWK  196



>sp|Q568T4.2|HIKES_DANRE RecName: Full=Protein Hikeshi [Danio rerio]
Length=197

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 85/204 (42%), Gaps = 29/204 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R          Q D      D   F    Y+ +  V +FLL     P     
Sbjct  1    MFGCLVAGR--------LVQTDAQQVASDKFVFNLPDYEHVNHVVVFLLGTVPFPEGLGG  52

Query  610  AVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEPG-GELQ----LTADATPLSAKIG  458
            AVY+  PG      +   G +T  +PSA+  +   + G G       + A A P  A++G
Sbjct  53   AVYLCVPGGAAGQVWQLLGFITNEKPSAIFRISGLKAGEGSSHPFGMMDAPAAPSMAQVG  112

Query  457  VSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFC------GVDGSKLIV  314
            VSVE L  L       S  V+      +   K+ ++LFNF  SF         + S++ +
Sbjct  113  VSVEGLHLLAQQTPVSSSAVSTLDSFTQFTQKMLDSLFNFTSSFALSQSQMSPNPSEMFI  172

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P   + RW++ FQ R +++P + K
Sbjct  173  PASSIRRWYENFQRRLMQNPNFWK  196



>ref|XP_004523766.1| PREDICTED: protein OPI10 homolog [Ceratitis capitata]
Length=195

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 92/203 (45%), Gaps = 29/203 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  ++FT +D    +++++       D +  + +FL     LP   A 
Sbjct  1    MFGLIISGR---LPQTNFTPVDENKVVINVSDI-----DHVNYIVVFLTGVTALPETTAA  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQ-------LTADATPLSAK  464
            AVY   P S     + + G ++ ++PSA+  +   +   EL+         A     +A+
Sbjct  53   AVYFSWPDSNSAPTWQYLGHISNAKPSAIFKISQLKKSHELEAEEHGMIFGAQEISHTAQ  112

Query  463  IGVSVEELATLPSLDVAAGKKIERL--AMKVGENLFNFMQSFCGVD-------GSKLIVP  311
            IG+SVE+  T+  L  A       L  + K+ E+ FN+  SF G+         ++  VP
Sbjct  113  IGISVEQELTVAQLTPAVQNANANLQFSQKMLESFFNYASSF-GLTPQQIPPLSTETFVP  171

Query  310  MDILDRWFKIFQERAIRDPEYLK  242
            +  L  W+  FQ R  ++P + K
Sbjct  172  LSTLQNWYTNFQRRMAQNPNFWK  194



>ref|XP_011183817.1| PREDICTED: protein OPI10 homolog [Bactrocera cucurbitae]
Length=196

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (44%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + FT +D    ++++        D +  + +FL     LP   A 
Sbjct  2    MFGLIISGR---LPQTDFTPVDENKVVINVPDI-----DHVNYIVVFLTGLTALPEGTAA  53

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQLT-------ADATPLSAK  464
            AVY   P +     + + G ++ ++PSA+  +   +   EL+         A     +A+
Sbjct  54   AVYFSWPDANSAPTWQYLGHISNAKPSAIFKISQLKKSHELEAAEHGMSFGAQEISHTAQ  113

Query  463  IGVSVEELATLPSLDVAAGKKIERL--AMKVGENLFNFMQSFCGVD------GSKLIVPM  308
            IG+SVE   T+  L  A       L  + K+ EN FN+  SF           S+ +VP+
Sbjct  114  IGISVEPELTISQLTPAVQNANANLQFSQKMLENFFNYASSFTVTPQQIPAMSSETLVPL  173

Query  307  DILDRWFKIFQERAIRDPEYLK  242
              L  W+  FQ R  ++P + K
Sbjct  174  STLQNWYTNFQRRMAQNPNFWK  195



>pdb|3WW0|A Chain A, Crystal Structure Of F97a Mutant, A New Nuclear Transport 
Receptor Of Hsp70
Length=199

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 77/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  32   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  91

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q  A A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  92   GEGSQHPAGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  151

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  152  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  198



>gb|KEF52933.1| hypothetical protein A1O9_10839 [Exophiala aquamarina CBS 119918]
Length=190

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 85/195 (44%), Gaps = 21/195 (11%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P+R     I   + +  T + + + T           + +FL  N  LP D A 
Sbjct  1    MFGVFIPSRPV---IPEMSTVSATQFAISIPT-----APIFHNIGVFLHPNQLLPADMAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWP----EPGGELQLTADATPLSAKIGVSVE  446
             VY+Q PG+  F F GA+   +PSA+  +         GGE+ L     P+   I V + 
Sbjct  53   GVYMQLPGAQGFQFLGAIANEKPSALFKVNLTPQAINSGGEINLGISVEPVQ-NIQVQMA  111

Query  445  ELATLPSLDVAAGKK------IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRWF  287
            +L        + GK          LA ++ +N FNF+  F G   + + +VP+     W+
Sbjct  112  QLQQQQQGSNSGGKSGTAAPDTRLLAQRIIKNAFNFLAGFAGNTANGIEVVPLKSFQDWW  171

Query  286  KIFQERAIRDPEYLK  242
              F+ R   DP +L+
Sbjct  172  TKFERRVQNDPAFLE  186



>pdb|3WW0|B Chain B, Crystal Structure Of F97a Mutant, A New Nuclear Transport 
Receptor Of Hsp70
Length=198

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 77/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  31   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  90

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q  A A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  91   GEGSQHPAGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  150

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  151  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  197



>ref|XP_002007273.1| GI12844 [Drosophila mojavensis]
 gb|EDW17749.1| GI12844 [Drosophila mojavensis]
Length=196

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 93/202 (46%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + F  +D    L+++        D++  V IFL     LP   A 
Sbjct  1    MFGLIISGR---LPQTDFVAVDENKLLINVPDI-----DNVNYVVIFLTGITPLPLGTAA  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQLTAD-----ATPLS--AK  464
            A+Y   P +     + + G +  ++PSA+  +   + G EL+  ++     A  +S  A+
Sbjct  53   AIYFSWPDANAAPTWQYLGHINNTKPSAIFKIAQLKKGPELETYSNGMVFGAQEISHIAQ  112

Query  463  IGVSVE-ELATLPSL-DVAAGKKIERLAMKVGENLFNFMQSFC-GV-----DGSKLIVPM  308
            IG+S+E ELA       V+      +   ++ EN FN+  SFC GV       ++  VP 
Sbjct  113  IGISIEPELAVAQQTPAVSTANDNIQFGQRMLENFFNYASSFCVGVPDIPPATTETFVPF  172

Query  307  DILDRWFKIFQERAIRDPEYLK  242
             ++  W+  FQ R  ++P Y K
Sbjct  173  SVVQNWYTNFQRRMEQNPNYWK  194



>dbj|GAM90125.1| hypothetical protein ANO11243_081650 [fungal sp. No.11243]
Length=195

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 96/211 (45%), Gaps = 48/211 (23%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MF ++ P+R     + S T +  T +      F   +  +   + IFLL + TLPPD   
Sbjct  1    MFALLLPSRP----LQSATTLSPTQY-----AFTVPSQPAFSHLAIFLLPDATLPPDAGA  51

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL----PWPEPGGELQL---TADATPLSAK--IG  458
             ++IQ P + F   GA+  S+PSA+  L    P  +  G++ L   +  A P +++  IG
Sbjct  52   TIWIQLPNTAFRLLGALGPSKPSAIFRLRSSGPQADTEGDVMLDDSSTSAAPRASEVVIG  111

Query  457  VSV-------EELATL------------PSLDVAAGKKIERLAMKVGENLFNFMQSFCGV  335
            V +       E+L TL            P +D         LA ++  N FNF+ SF   
Sbjct  112  VQIEPAARVQEQLETLRAQQQQRPAQAKPKVDTKV------LAQRIIGNAFNFLSSF---  162

Query  334  DGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
             GS+ I P+     W++ F+ +   DP +L+
Sbjct  163  -GSETI-PLKAFQDWWRKFESKIELDPGFLE  191



>ref|XP_007805398.1| hypothetical protein EPUS_08173 [Endocarpon pusillum Z07020]
 gb|ERF68939.1| hypothetical protein EPUS_08173 [Endocarpon pusillum Z07020]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 99/232 (43%), Gaps = 58/232 (25%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MF V+  NR     ++++  I  T +      F   +      + +F+L   TLPP+ A 
Sbjct  1    MFSVIPANRPC---LTNYITISPTQF-----AFSFPSRPHFSHLVVFILPGNTLPPNTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAV--LSLPWPEPG-GELQLTADATPLSA--------  467
             ++IQ PGSP F F GA+   +PSA+  ++LP P+P  G+    A++  +S         
Sbjct  53   GIHIQLPGSPEFRFLGAIGNEKPSAIFKINLPGPKPPPGDFDAMANSD-ISGLPAAMAAT  111

Query  466  ------------KIGVSVEELATLPSLDVAAGK-----------------------KIER  392
                         IG+SVE  A + +   A                          + + 
Sbjct  112  ASTAAEPDIGDINIGISVEPAANIQAQLAALQSQTQSQSLSSTSADLALVIHRPPPQTKE  171

Query  391  LAMKVGENLFNFMQSFCGV--DGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            LA ++ +N FNF+ SF G    G + +VP+     W+  F+ +   DP +L+
Sbjct  172  LAQRIIKNAFNFLASFAGEAGPGGQEVVPLRSFQEWWTKFERKVQNDPGFLE  223



>ref|XP_005189077.1| PREDICTED: protein OPI10 homolog [Musca domestica]
Length=195

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 88/202 (44%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + FT +D    L+++        D +  + +FL     LP   + 
Sbjct  1    MFGLIISGR---LPQTDFTPVDENKLLINVPDI-----DHVNYIVVFLTGVQPLPDGMSA  52

Query  610  AVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEPGGEL-------QLTADATPLSAK  464
            AVY   P +     + + G ++ S+PSA+  +   +   EL       Q  A     +A+
Sbjct  53   AVYFSWPDASAAPTWQYLGHISNSKPSAIFKISQLKKSHELEAQENAMQFGAQEISHTAQ  112

Query  463  IGVSVEELATLPSLDVAAGKKIERL--AMKVGENLFNFMQSFCGVD------GSKLIVPM  308
            IG+SVE   T+  L  A       L  + K+ EN FN+  SF           ++ +VP+
Sbjct  113  IGISVEPEMTITQLTPAVSNANANLQFSQKMLENFFNYASSFSVTPHELSPMSNQPMVPL  172

Query  307  DILDRWFKIFQERAIRDPEYLK  242
              L  W+  FQ R  ++P + K
Sbjct  173  STLQNWYTNFQRRMEQNPNFWK  194



>gb|KIJ37109.1| hypothetical protein M422DRAFT_33960 [Sphaerobolus stellatus 
SS14]
Length=198

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 91/191 (48%), Gaps = 30/191 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG V P +     +++  Q+D TH +     ++G   + I  +C+FLL     P   A 
Sbjct  1    MFGCVLPGKPV---LTNLQQVDETHAVF----YLGHPAE-INHICVFLLGTVPFPDGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGG-----ELQLTADATPLSAKIGVSVE  446
             V++  PG  F   G ++  +PSA+  +     G          ++D +  +A +G+++E
Sbjct  53   TVHMHWPGRGFQLLGMLSNEKPSAIFRVRGSFSGAGQAAFSAAASSDPSDFNAMLGLAIE  112

Query  445  ELATLPSLDVAAG---------KKIE--RLAMKVGENLFNFMQSFCGVDGSKLI----VP  311
             LA +     AAG         K+++   LA ++ ++LFN++ SF    GS +     VP
Sbjct  113  PLAAVQE-QCAAGTGASSSALTKQLDPTALAERIVKHLFNYLSSFA-TSGSAVTPETYVP  170

Query  310  MDILDRWFKIF  278
            M  + +W++ F
Sbjct  171  MGAITKWYESF  181



>ref|XP_007760947.1| hypothetical protein A1O7_08768 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ55837.1| hypothetical protein A1O7_08768 [Cladophialophora yegresii CBS 
114405]
Length=191

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 86/204 (42%), Gaps = 38/204 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     +    + +        A      V +FL     LPPD A 
Sbjct  1    MFGVFIPTRPV---IPEMLTVGPGQFAVSF-----PASPPFHNVGVFLHPGSPLPPDTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PGS  F F GA+   +PSA+           + L A  T     +GVS+E +  
Sbjct  53   GVYMQLPGSQDFRFLGALANEKPSALF---------RVNLPATPTGDVVNLGVSIEPVQN  103

Query  433  L--------------PSLD--VAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IV  314
            +              P+ +  VAA K+      LA ++ +N FNF+ SF G   + + +V
Sbjct  104  IQAQMAQLQQQGTQSPTSNNTVAAAKRQPDTRVLAQRIIKNAFNFLASFAGNTANGIEVV  163

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P+     W+  F+ +   DP +L+
Sbjct  164  PLKSFQDWWAKFERKVQVDPGFLE  187



>ref|XP_001362527.1| PREDICTED: protein Hikeshi isoform X1 [Monodelphis domestica]
Length=197

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 78/167 (47%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSP---GSP-FLFCGAVTLSRPSAVLSLPWPEP  512
            Y SI  V +F+L     P     +VY   P   G+P +   G VT  +PS +  +   + 
Sbjct  30   YQSINHVVVFMLGTVPFPDGMGGSVYFSYPDSSGTPVWQLLGFVTNEKPSVIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVE---ELATLPSLDVAAGKKIE---RLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE    LA L  +  AA  +I+   +   K+ ++ 
Sbjct  90   GESSQHPFGAMNIIRTPTVAQIGISVELLDNLAQLTPVGSAAVSQIDSFTQFTQKMLDSF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEVFIPANVILKWYENFQRRLTQNPHFWK  196



>ref|XP_003764643.1| PREDICTED: protein Hikeshi [Sarcophilus harrisii]
Length=197

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 75/169 (44%), Gaps = 25/169 (15%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPW---  521
            Y SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +     
Sbjct  30   YQSINHVVVFMLGTVPFPDGMGGSVYFSYPDSSGMPVWQLLGFVTNGKPSAIFKISGLKY  89

Query  520  ----PEPGGELQLTADATPLSAKIGVSVEELATLPSLD------VAAGKKIERLAMKVGE  371
                  P G + +T   TP  A+IG+SVE L  L  L       V++     +   K+ +
Sbjct  90   GEGSQHPFGTMSIT--RTPTVAQIGISVELLDNLAQLTPVGNAAVSSVDSFTQFTQKMLD  147

Query  370  NLFNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            N +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  148  NFYNFASSFAVSQAQMTPNPSEVFIPANVVLKWYENFQRRLSQNPLFWK  196



>ref|XP_003992701.1| PREDICTED: protein Hikeshi [Felis catus]
Length=197

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_009261864.1| hypothetical protein FPSE_10472 [Fusarium pseudograminearum CS3096]
 gb|EKJ69359.1| hypothetical protein FPSE_10472 [Fusarium pseudograminearum CS3096]
Length=197

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 15/155 (10%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYIQSP----------GSP-FLFCGAVTLSRPSAVLSLPWP  518
             + +F+L   TLPP+ A A+Y+ +           G+P F F G +   + SA+  +   
Sbjct  40   HIVVFMLPGITLPPNTAAAIYLATATDVAAAAQTGGTPNFRFLGGIGPGKESAMFKVSGG  99

Query  517  EPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGK-KIERLAMKVGENLFNFMQSFC  341
                +L +     P    +G  ++ELA   + + ++G+     LA ++ +N FNF+ SF 
Sbjct  100  GEASDLVIGVSVEP-EESVGQRLQELAANKASNPSSGQPSTAILAQRIIQNAFNFLSSFS  158

Query  340  GVDGSK--LIVPMDILDRWFKIFQERAIRDPEYLK  242
            G  G     +VP+   + W++ F+ R   DP +L+
Sbjct  159  GTAGPGGVEVVPLKAFENWWRKFESRVRTDPSFLE  193



>ref|NP_595931.1| inositol metabolism protein Opi10 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O60175.1|OPI10_SCHPO RecName: Full=Protein OPI10 homolog [Schizosaccharomyces pombe 
972h-]
 emb|CAA18866.1| inositol metabolism protein Opi10 (predicted) [Schizosaccharomyces 
pombe]
Length=200

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/204 (24%), Positives = 86/204 (42%), Gaps = 32/204 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  Q+    ++  +     ++ +S+  + +FLL N   P     
Sbjct  1    MFGAICAGR---LVQTNLQQVADNQFVFQL-----DSAESLNHIVVFLLPNSPFPVGMGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
             VY Q PG PF F G +T  +PSA+  L        L    +   ++A +G+SVE L   
Sbjct  53   KVYFQWPGKPFQFLGYLTNEKPSAIFRL--KNTIQTLSENENCVGITAMLGISVEPLTNF  110

Query  430  ---PSLDVAAGKKIER-------LAMKVGENLFNFMQSFC------------GVDGSKLI  317
               P++  +A   I +       +A K+  NL+NF+ SF              +  +   
Sbjct  111  TETPAVSTSASNVIAKPLPPVTSVAQKILTNLYNFLASFATSQLPPNSIGLGDLRPNDTF  170

Query  316  VPMDILDRWFKIFQERAIRDPEYL  245
            +P+ +   W   F  +   +P +L
Sbjct  171  IPLRVFQDWHAKFLNKLSNNPNFL  194



>ref|XP_003380090.1| protein OPI10-like protein [Trichinella spiralis]
 gb|EFV60294.1| protein OPI10-like protein [Trichinella spiralis]
Length=199

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 93/210 (44%), Gaps = 39/210 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+ P R+     ++FTQID TH +  +     +  + +  + + L      P     
Sbjct  1    MFGVLVPGRAVQ---TNFTQIDDTHCVFSL-----DDAEHVNHIIVLLTGQVAFPQGYGG  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVL------SLPWPE---PGGELQLTADATPLS  470
            AVY+  P S     +L+ G V+  +PSA+       S+  P+   PGG +     +T + 
Sbjct  53   AVYLCYPSSDGQQAWLYLGFVSNEKPSAIFRVTKLKSMIVPQTNVPGGFVGFNKSSTVV-  111

Query  469  AKIGVSVEELATLPSL------DVAAGKKIERLAMKVGENLFNFMQSFCG--------VD  332
             ++G+SVE L ++ SL      D        +    + ++ FN+  SF           D
Sbjct  112  -QLGISVEPLTSITSLTPVGDLDPPITDNFVQFTQNMLQSFFNYALSFSANKADIVNKAD  170

Query  331  GSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            G    VP++++  W++ F  R   DP + K
Sbjct  171  GP--YVPVNVVQGWYEQFSRRLAADPNFWK  198



>ref|XP_001910288.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP71423.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP30821.1| Putative Protein OPI10 [Podospora anserina S mat+]
Length=201

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 76/159 (48%), Gaps = 20/159 (13%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYIQSP------GSPF--LFCGAVTLSRPSAVLSLPWPEPG  509
             + +FLL   TLPP  A A+++ +P      G  F   F GA+   +PSA+  L      
Sbjct  42   HIVVFLLPGITLPPAHAAAIHLLTPSTDPNSGQEFDIAFLGALGHGKPSAIFKLSNDTSK  101

Query  508  GELQLTADATPLSAKIGVSVEELA---------TLPSLDVAAGKKIERLAMKVGENLFNF  356
            G + +     P  A +G+ ++ELA         T        G +  +LA ++  N FNF
Sbjct  102  G-VAIGISVEP-EAAVGLKMQELAEKQSKALVPTAAGTGSNGGGQTLQLAQRIINNAFNF  159

Query  355  MQSFCG-VDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            + S+ G +   + +VP+   ++W++ F+ R   DP +L+
Sbjct  160  LSSYSGRMHNGEEVVPIKAFEQWWRKFEGRVRADPAFLE  198



>gb|EJK64196.1| hypothetical protein THAOC_15100 [Thalassiosira oceanica]
Length=209

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 81/181 (45%), Gaps = 22/181 (12%)
 Frame = -2

Query  721  THWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALAVYIQ------------SPGSP-  581
            + + L ++   G    ++ E+  FLL   +LP D    ++ Q            +P +P 
Sbjct  26   SRFALALSGITGRDISAVSELVFFLLPGVSLPEDTGAMLFWQIISVPASNNMTSTPFAPP  85

Query  580  -----FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATLPSLDV  416
                 F   GA+T  RPS      W            +  ++  +GVS+E ++ + ++ V
Sbjct  86   STTTEFELMGAITNDRPSGSFRTGWATNETLSTAMNSSNVVTINLGVSLEPISQIRNVGV  145

Query  415  AAGKKIERLAMKVGENLFNFMQSF-CGVDGS-KLIVPMDILDRWFKIFQERAIRDPE-YL  245
                    +A  + ++LFN+M SF  G  G+  ++VP +I DRW   F+ R+  DP  YL
Sbjct  146  RI-DNTANVARFIAKDLFNYMSSFDNGTGGAGNMVVPRNIFDRWMNRFEARSRADPHFYL  204

Query  244  K  242
            K
Sbjct  205  K  205



>gb|EUC66321.1| inositol metabolism protein OPI10, putative [Rhizoctonia solani 
AG-3 Rhs1AP]
Length=215

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 88/207 (43%), Gaps = 44/207 (21%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG+V   R    +     QID TH       F  E+  ++  +C+F+L   + PP  A 
Sbjct  1    MFGIVVAGRLLQTECQ---QIDETHV-----AFTIESAVNVNHICVFMLGTVSFPPGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATP-------------LS  470
             V+   PG  F   G ++  +PSAV  L       +LQ  +  +              ++
Sbjct  53   TVHFHWPGKGFQLLGMLSNEKPSAVFRLRGSYTPAQLQSHSTLSSAAAIGGPAPAVNDVT  112

Query  469  AKIGVSVEELATLPSLDVA-----AGKKIER---------------LAMKVGENLFNFMQ  350
            A +G++VE +  + +   A     AG+  +                LA ++ +++F ++ 
Sbjct  113  AILGIAVEPIQAVEAQISANATSQAGQSTDNRLIKPGSQGLADPTVLAERIVKHMFTYLS  172

Query  349  SFCGVDGS---KLIVPMDILDRWFKIF  278
            SF    GS     +VP++I+ RW+  F
Sbjct  173  SFVSDPGSLTTDTVVPLNIIRRWYDNF  199



>ref|XP_008069261.1| PREDICTED: protein Hikeshi isoform X2 [Tarsius syrichta]
Length=197

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPFFWK  196



>ref|XP_008069256.1| PREDICTED: protein Hikeshi isoform X1 [Tarsius syrichta]
Length=198

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  31   YESINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  90

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  91   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  150

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  151  YNFASSFAVSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPFFWK  197



>dbj|BAD96918.1| hypothetical protein HSPC138 variant [Homo sapiens]
Length=197

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 77/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+L +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAILKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_002065862.1| GK16958 [Drosophila willistoni]
 gb|EDW76848.1| GK16958 [Drosophila willistoni]
Length=195

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 88/202 (44%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + F  +D    L+++        +S+  + +FL     LP   A 
Sbjct  1    MFGLIISGR---LPQTDFAAVDENKLLINVPDI-----ESVNYIVVFLTGMTPLPVGTAA  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQ-------LTADATPLSAK  464
            A+Y   P +     + + G +  ++PSA+  +   + G EL+         A      A+
Sbjct  53   AIYFSWPDANAAPTWQYLGHINNNKPSAIFKIAQLKKGHELEAHSHGMVFGAQEISTIAQ  112

Query  463  IGVSVEELATLPSLD--VAAGKKIERLAMKVGENLFNFMQSFC-GVD-----GSKLIVPM  308
            IGVS+E   T+      V++    ++   ++ EN FN+  SFC G        S   VP 
Sbjct  113  IGVSIEPELTVAQQTPAVSSANDNKQFGQRMLENFFNYASSFCVGAQDISPASSTSYVPF  172

Query  307  DILDRWFKIFQERAIRDPEYLK  242
             ++  W+  FQ R  ++P + K
Sbjct  173  SVVQNWYVNFQRRMEQNPNFWK  194



>ref|XP_002904338.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY54516.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=185

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 87/185 (47%), Gaps = 18/185 (10%)
 Frame = -2

Query  787  FGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALA  608
            FG+V   R     I+ F +I   H+++D+          + ++  FLL    +PP     
Sbjct  11   FGLVIAGRPV---ITDFREIGPAHYVVDI-----LEPTQVTDLTFFLLPGSPVPPGFGAV  62

Query  607  VYIQSPG-SPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELATL  431
            +Y   P    +   G V   +PSA+    WP             P+  ++GVS+E L  +
Sbjct  63   LYFALPALQNWQLLGTVFAEKPSAIFRTSWPT-----HPDVVGQPV-LQLGVSIESLDNV  116

Query  430  PSLDVAAGKKIER--LAMKVGENLFNFMQSFCGVDGSK-LIVPMDILDRWFKIFQERAIR  260
             +L + A    ER   A+K+ ++LFN++ SF   +    + +P ++LD+W + F+ +  R
Sbjct  117  KNLGIEASGLEERKAFALKIAQDLFNYLSSFSSSNSQSYMTIPTNLLDKWMERFEAKYRR  176

Query  259  DPEYL  245
            DP ++
Sbjct  177  DPNFM  181



>ref|XP_003660422.1| hypothetical protein MYCTH_2052653 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55177.1| hypothetical protein MYCTH_2052653 [Myceliophthora thermophila 
ATCC 42464]
Length=203

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 74/160 (46%), Gaps = 24/160 (15%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYIQSPGSPFL-----FCGAVTLSRPSAVLSLPWPEPGGEL  500
             + +FLL   TLPP  A A+Y+ +P S        F G +   + SA+  L  P      
Sbjct  46   HIVVFLLPGITLPPGTAAAIYLVTPDSQTQEPNTKFLGGIGPGKESAIFKLSPP-----T  100

Query  499  QLTADATPLSAKIGVSVE----------EL--ATLPSLDVAAGKKIERL--AMKVGENLF  362
               A     +  IGVSVE          EL  A +P+   A G++   L  A ++ +N F
Sbjct  101  NAAAAGAESNVVIGVSVEPAESVSARIAELSGALVPASRPAMGQQPSTLVLAQRIIKNAF  160

Query  361  NFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            NF+ SF G  G   +VP+   + W++ F+ +   DP +L+
Sbjct  161  NFLASFSGNAGQPEMVPLKAFEEWWRKFEGKVRSDPGFLE  200



>ref|XP_005379802.1| PREDICTED: protein Hikeshi isoform X1 [Chinchilla lanigera]
Length=194

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  27   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  86

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  87   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  146

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  147  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  193



>ref|XP_011212939.1| PREDICTED: protein OPI10 homolog [Bactrocera dorsalis]
Length=195

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 88/202 (44%), Gaps = 27/202 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG++   R   +  + FT +D    ++++        D +  + +FL     LP   A 
Sbjct  1    MFGLIISGR---LPQTDFTPVDENKVVINVPDI-----DHVNYIVVFLTGLTALPEGTAA  52

Query  610  AVYIQSPGS----PFLFCGAVTLSRPSAVLSLPWPEPGGELQLT-------ADATPLSAK  464
            AVY   P +     + + G ++ ++PSA+  +   +   EL+         A     +A+
Sbjct  53   AVYFSWPDANSAPTWQYLGHISNAKPSAIFKISQLKKSHELEAAEHGMIFGAQEISHTAQ  112

Query  463  IGVSVEELATLPSLDVAAGKKIERL--AMKVGENLFNFMQSFCGVD------GSKLIVPM  308
            IG+SVE   T+  L  A       L  + K+ EN FN+  SF           ++ +VP+
Sbjct  113  IGISVEPELTITQLTPAVQNANANLQFSQKMLENFFNYASSFTVSPQQIPPLSNETLVPL  172

Query  307  DILDRWFKIFQERAIRDPEYLK  242
              L  W+  FQ R  ++P + K
Sbjct  173  STLQNWYTNFQRRMAQNPNFWK  194



>ref|XP_504694.1| YALI0E32637p [Yarrowia lipolytica]
 emb|CAG80298.1| YALI0E32637p [Yarrowia lipolytica CLIB122]
Length=205

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 90/212 (42%), Gaps = 41/212 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV+   R    D   F Q+D   + + +     +   ++  + +FLL   TL P  A 
Sbjct  1    MFGVICAGREAQTD---FQQVDNNKYGIQI-----QNGGTVNHIVVFLLPGATLDPTVAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP--------EPGGELQLTADATPLSAKIGV  455
            +VY Q PG+ F   GA++ S+PSA+  L           +P   +   A    +   IG+
Sbjct  53   SVYFQLPGTDFQLLGALSSSKPSAIFKLKNTGSLVNDTLDPDEMVDEGAPQEQVPISIGI  112

Query  454  SVEELATL--------PSLD--------------VAAGKKIERLAMKVGENLFNFMQSFC  341
            S+E + T+         S D              V   ++   LA K+ +N +N++  F 
Sbjct  113  SIEPINTVEQQLAALKASRDSNSALVSASAVKPTVQNSQQTAVLANKIIQNAYNYLSGFT  172

Query  340  GVDGSKLIVPMDILDRWFKIFQERAIRDPEYL  245
              +    +V M+  + W+  F+ +   +P +L
Sbjct  173  VNNN---MVSMNHFNDWWSKFKSKMANNPSFL  201



>emb|CCX10230.1| Similar to Protein OPI10 homolog; acc. no. O60175 [Pyronema omphalodes 
CBS 100304]
Length=204

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 85/208 (41%), Gaps = 33/208 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    D+ +  + + T        F      S+  + IF+L    +P   A 
Sbjct  1    MFGCIAAGRWVQTDMQTINETNFT--------FTISNGRSVNHIVIFILPGVIIPETHAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWP-EPGGELQLTADATPLSAKIGV------  455
             V+++ P SP F   G ++ S+PSAV  L    +P  +L L  D   +   I +      
Sbjct  53   TVHVRFPNSPDFKILGGISNSKPSAVFRLRGMLDPNSQLMLGGDDWNVVVGIAIQEVAVA  112

Query  454  ----------SVEELATLPSLDVAAGKKIER-------LAMKVGENLFNFMQSFCGVDGS  326
                      +  E    PS  +      +R       LA ++  N FN++ SF    G 
Sbjct  113  EAALAQIPQTAAGEAGGAPSGALVVAGVTQRGAMGTLQLARRIISNAFNYLGSFSKNVGG  172

Query  325  KLIVPMDILDRWFKIFQERAIRDPEYLK  242
            + +VP+     W+K F+++   DP +L+
Sbjct  173  EEMVPLAAFQEWWKKFEKKVEYDPSFLE  200



>gb|KIK53316.1| hypothetical protein GYMLUDRAFT_49338 [Gymnopus luxurians FD-317 
M1]
Length=209

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 87/207 (42%), Gaps = 45/207 (22%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    ++    QID TH + ++         ++  VC+FLL N   P     
Sbjct  1    MFGCLVAGRLLQTNLQ---QIDETHAIFEL-----PNASTVNHVCVFLLGNIPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL---------------PWPEPGGELQLTADATP  476
             V++  PG  F   G ++  +PSA+  L                   PG +   T+DA  
Sbjct  53   TVHLHWPGRGFQLLGMLSNEKPSAIFRLRASFSSSTTTRAFQGSSSTPGAD---TSDAD-  108

Query  475  LSAKIGVSVEELATL-PSLDVAAGKKIER----------------LAMKVGENLFNFMQS  347
            ++A +G+S+E L+ + P L   +  +                    A ++  +LFN++  
Sbjct  109  VTAVLGISIEPLSQIFPQLASISNAQTNNNGNQSSLLKPLPDATLFAERIVRHLFNYLSG  168

Query  346  FCGVD-GSKLIVPMDILDRWFKIFQER  269
            F     G  + VPM ++++W++ F  +
Sbjct  169  FATTTLGPDVAVPMGVIEKWYETFSNK  195



>ref|XP_004886952.1| PREDICTED: protein Hikeshi [Heterocephalus glaber]
 ref|XP_004868286.1| PREDICTED: protein Hikeshi isoform X2 [Heterocephalus glaber]
 ref|XP_005379803.1| PREDICTED: protein Hikeshi isoform X2 [Chinchilla lanigera]
Length=197

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_002917352.1| PREDICTED: protein Hikeshi [Ailuropoda melanoleuca]
 ref|XP_004763594.1| PREDICTED: protein Hikeshi [Mustela putorius furo]
 ref|XP_004796065.1| PREDICTED: protein Hikeshi [Mustela putorius furo]
 ref|XP_006736271.1| PREDICTED: protein Hikeshi [Leptonychotes weddellii]
 ref|XP_007079054.1| PREDICTED: protein Hikeshi [Panthera tigris altaica]
 ref|XP_008702642.1| PREDICTED: protein Hikeshi [Ursus maritimus]
Length=197

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_002594234.1| hypothetical protein BRAFLDRAFT_113596 [Branchiostoma floridae]
 gb|EEN50245.1| hypothetical protein BRAFLDRAFT_113596 [Branchiostoma floridae]
Length=196

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 86/203 (42%), Gaps = 28/203 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    D     Q+  T ++ +++       DSI  + +FL      P     
Sbjct  1    MFGCIVAGRLVQTDPQ---QMSETQFVFNLSD-----ADSINHIVVFLTGTTPFPDGLCG  52

Query  610  AVYIQSP---GSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLS-----AKIGV  455
            AVY   P   G  + F G +   +PSA+  +   +PG E   T     +      A+IG+
Sbjct  53   AVYFGYPNPDGMAWQFLGYIANDKPSAIFKVAKVKPGDETSNTVFGQLMPGQQKMAQIGI  112

Query  454  SVEELA-----TLPS-LDVAAGKKIERLAMKVGENLFNFMQSFCGVDG------SKLIVP  311
            SVE LA     T PS +  +     +    K+ E+  N+  SF           +K  VP
Sbjct  113  SVEPLAQVTQQTPPSHITPSTVSSFQEFTRKMLESFHNYASSFALTQAQMVPEPNKSFVP  172

Query  310  MDILDRWFKIFQERAIRDPEYLK  242
            +++L +WF  FQ R  ++P + K
Sbjct  173  LNVLQQWFDNFQRRLAQNPNFWK  195



>ref|XP_005875688.1| PREDICTED: protein Hikeshi [Myotis brandtii]
 ref|XP_006092950.1| PREDICTED: protein Hikeshi [Myotis lucifugus]
 ref|XP_006755939.1| PREDICTED: protein Hikeshi [Myotis davidii]
 gb|ELK36129.1| hypothetical protein MDA_GLEAN10010438 [Myotis davidii]
Length=197

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L TL       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDTLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAISQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>dbj|GAM34523.1| DUF775 domain protein [Talaromyces cellulolyticus]
Length=224

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 96/221 (43%), Gaps = 41/221 (19%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMN-TFVGEAYDSIREVCIFLLNNFTLPPDKA  614
            MF VV P R    DI   T +D    +      F   A      + IF L    LPPD A
Sbjct  1    MFSVVIPGRPCLTDI---TAVDAQPGIQPTKFAFTFPAAPKFNHIVIFFLPGTVLPPDTA  57

Query  613  LAVYIQSP-------GSPFLFCGAVTLSRPSAVLSL----PWPEPGGELQLTADATPLSA  467
             A+Y+Q+P       G  F F GA+   +PSA+  +       + G + ++  +   ++ 
Sbjct  58   AAIYLQTPTSKPTPNGPEFRFLGAIGNEKPSAIFKVGSGTSQAQGGMDDEMVDEGATIAG  117

Query  466  ---KIGVSVE-------ELATL-------PSLDVA----AGKKI--ERLAMKVGENLFNF  356
                +G+S+E       ++A L       PS D+       K+I  + LA +V  N FNF
Sbjct  118  GQVTLGISIEPAQNVAAQMAALNASRVSQPSTDLVRMPPQQKQITTKLLAQRVIGNAFNF  177

Query  355  MQSFCGVDGSKL---IVPMDILDRWFKIFQERAIRDPEYLK  242
            + SF   D ++    +VP+     W+  F+ R   DP +L+
Sbjct  178  LASFAESDPNRKGEDVVPLKSFRDWWTKFERRIDMDPSFLE  218



>ref|XP_010632032.1| PREDICTED: protein Hikeshi [Fukomys damarensis]
 gb|KFO29249.1| hypothetical protein H920_09392 [Fukomys damarensis]
Length=197

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_008716342.1| hypothetical protein HMPREF1541_03770 [Cyphellophora europaea 
CBS 101466]
 gb|ETN41833.1| hypothetical protein HMPREF1541_03770 [Cyphellophora europaea 
CBS 101466]
Length=206

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 74/167 (44%), Gaps = 28/167 (17%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTA  488
             + +FLL     PPD A  V++Q PG   F F GA+   + SA+  +  P          
Sbjct  37   HIVVFLLPGNAFPPDTAAGVHVQLPGQQGFRFLGALANEKQSAIFKVSLPS--SGGGGGQ  94

Query  487  DATPLSAKIGVSVEELAT----LPSLDVAAGKK-------------------IERLAMKV  377
              T    ++G+SVE + +    L +L+    ++                    + LA ++
Sbjct  95   QETLAETQVGISVESVESIRGQLEALEAEKARQGGGAGSGGGGGDGSGARPSTKVLAQRI  154

Query  376  GENLFNFMQSFCGV--DGSKLIVPMDILDRWFKIFQERAIRDPEYLK  242
             +N FNF+ SF G    G + +VP+   + W++ F+ R   DP +L+
Sbjct  155  IKNAFNFLASFSGTLGPGGQEVVPLKSFEEWWRKFERRVEVDPGFLE  201



>ref|XP_011321347.1| hypothetical protein FGSG_04271 [Fusarium graminearum PH-1]
 gb|ESU08848.1| hypothetical protein FGSG_04271 [Fusarium graminearum PH-1]
 gb|EYB24800.1| hypothetical protein FG05_04271 [Fusarium graminearum]
 emb|CEF79247.1| unnamed protein product [Fusarium graminearum]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 74/155 (48%), Gaps = 15/155 (10%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYIQSP----------GSP-FLFCGAVTLSRPSAVLSLPWP  518
             + +F+L   TLPP+ A A+Y+ +           G+P F F G +   + SA+  +   
Sbjct  40   HIVVFMLPGITLPPNTAAAIYLATATDVAAAAQTGGTPNFRFLGGIGPGKESAMFKVSGG  99

Query  517  EPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGK-KIERLAMKVGENLFNFMQSFC  341
                +L +     P    +G  ++ELA     + ++G+     LA ++ +N FNF+ SF 
Sbjct  100  GEASDLVIGVSVEP-EESVGQRLQELAANKVSNPSSGQPSTAILAQRIIQNAFNFLSSFS  158

Query  340  GVDGSK--LIVPMDILDRWFKIFQERAIRDPEYLK  242
            G  G     +VP+   + W++ F+ R   DP +L+
Sbjct  159  GTAGPGGVEVVPLKAFENWWRKFESRVRTDPSFLE  193



>ref|XP_006189600.1| PREDICTED: protein Hikeshi [Camelus ferus]
 ref|XP_010971692.1| PREDICTED: protein Hikeshi isoform X1 [Camelus bactrianus]
 ref|XP_010988828.1| PREDICTED: protein Hikeshi isoform X1 [Camelus dromedarius]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_005323347.1| PREDICTED: protein Hikeshi [Ictidomys tridecemlineatus]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPTVAQIGISVESLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAISQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_004632627.1| PREDICTED: protein Hikeshi [Octodon degus]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_004416965.1| PREDICTED: protein Hikeshi [Odobenus rosmarus divergens]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_002171863.1| inositol metabolism protein Opi10 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB05570.1| inositol metabolism protein Opi10 [Schizosaccharomyces japonicus 
yFS275]
Length=199

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 36/207 (17%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QI    +L     FV E  +SI  + +F+L     P     
Sbjct  1    MFGAICAGR---LVQTNLQQISENQFL-----FVLENAESINHIVVFVLPTSPFPNGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLS---AKIGVSVEEL  440
             VY Q P  PF + G +T  +PSA+  L         Q T  A P+S   A +G+SVE L
Sbjct  53   KVYFQWPDKPFQYLGYLTNEKPSAIFRL----KNTVQQFTQGAGPVSGITASLGISVEPL  108

Query  439  ATLPSLDVAAGKKI---------ERLAMKVGENLFNFMQSFC------------GVDGSK  323
             ++    +A+               +A ++ +NL+NF+ SF              +  + 
Sbjct  109  ESIAQEAMASSSSTALAKPAAPPSSIAERILKNLYNFLASFAVSNLPPYATGLGDLRPND  168

Query  322  LIVPMDILDRWFKIFQERAIRDPEYLK  242
              VP+ +   W   F  +   +P +L 
Sbjct  169  TYVPLRVFQDWHAKFLSKLTNNPNFLN  195



>gb|KIL86874.1| hypothetical protein FAVG1_10130 [Fusarium avenaceum]
Length=197

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 15/155 (10%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYI----------QSPGSP-FLFCGAVTLSRPSAVLSLPWP  518
             + +F+L   ++PP+ A A+Y+          QS  +P F F G +   + SA+  +   
Sbjct  40   HIVVFMLPGVSIPPNTAAAIYLATATDVAAAAQSGSTPNFRFLGGIGPGKESAMFKVSGG  99

Query  517  EPGGELQLTADATPLSAKIGVSVEELA-TLPSLDVAAGKKIERLAMKVGENLFNFMQSFC  341
                +L +     P    +G  ++ELA + PS           LA ++ +N FNF+ SF 
Sbjct  100  GEASDLVIGVSVEP-EESVGQRLQELAASKPSSSTGGQPSTVILAQRIIQNAFNFLSSFS  158

Query  340  GVDGSK--LIVPMDILDRWFKIFQERAIRDPEYLK  242
            G  G     +VP+   + W++ F+ R   DP +L+
Sbjct  159  GAAGPGGVEVVPLKAFENWWQKFESRVRTDPSFLE  193



>ref|XP_007634574.1| PREDICTED: protein Hikeshi isoform X3 [Cricetulus griseus]
Length=197

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S     +   G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>emb|CAK43588.1| unnamed protein product [Aspergillus niger]
Length=230

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 78/174 (45%), Gaps = 32/174 (18%)
 Frame = -2

Query  670  IREVCIFLLNNFTLPPDKALAVYIQSP----GSPFLFCGAVTLSRPSAVLSLPWPE-PG-  509
            + E+ +F L    LPPD A A+YIQ P       F F GA+   RPSA+L +  P+ PG 
Sbjct  39   LTELVVFFLPGTVLPPDTAAAIYIQFPDPNNAPQFKFIGALANERPSAILKVQAPQIPGL  98

Query  508  GELQLTADATPLSAKIGVSVEEL-ATLPSLDV-------AAGKKIER-------------  392
                  A A P+   +G+S+E + A  P +          AG  +E              
Sbjct  99   QNGNAMAGAAPM-VTLGISLEPVQAVAPQIAALEAEQAGGAGSSLELVRHTRQQKEITTK  157

Query  391  -LAMKVGENLFNFMQSFCGVDGS---KLIVPMDILDRWFKIFQERAIRDPEYLK  242
             LA ++  N FNF+ SF   D S   +  VP+     W+  F+ +   DP +L+
Sbjct  158  VLAQRIIGNAFNFLASFASEDPSNRGQETVPLKTFRDWWTKFERKVEMDPTFLE  211



>gb|KGB78387.1| hypothetical protein CNBG_3949 [Cryptococcus gattii R265]
 gb|KIR70768.1| hypothetical protein I310_05619 [Cryptococcus gattii CA1014]
Length=202

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 87/201 (43%), Gaps = 32/201 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTMPFPEGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPLSAKIGV  455
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL     +
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPQLEAI  112

Query  454  SVE-------ELATLPSLDVAAGKKIER------LAMKVGENLFNFMQSFCGVDGSK--L  320
            + E         A  P  D A GK++ R      +A KV  NLFNF+ SF G    +   
Sbjct  113  TAELSQNASASGAGAPGGD-AKGKELVRSVDVGKVAEKVVRNLFNFLHSFGGEGALRPDT  171

Query  319  IVPMDILDRWFKIFQERAIRD  257
             +P+ +  +W+  F  +   D
Sbjct  172  QIPLSVFQQWYTNFTRKIEND  192



>ref|XP_001388656.2| hypothetical protein ANI_1_282014 [Aspergillus niger CBS 513.88]
 gb|EHA26240.1| hypothetical protein ASPNIDRAFT_52045 [Aspergillus niger ATCC 
1015]
Length=219

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 78/174 (45%), Gaps = 32/174 (18%)
 Frame = -2

Query  670  IREVCIFLLNNFTLPPDKALAVYIQSP----GSPFLFCGAVTLSRPSAVLSLPWPE-PG-  509
            + E+ +F L    LPPD A A+YIQ P       F F GA+   RPSA+L +  P+ PG 
Sbjct  39   LTELVVFFLPGTVLPPDTAAAIYIQFPDPNNAPQFKFIGALANERPSAILKVQAPQIPGL  98

Query  508  GELQLTADATPLSAKIGVSVEEL-ATLPSLDV-------AAGKKIER-------------  392
                  A A P+   +G+S+E + A  P +          AG  +E              
Sbjct  99   QNGNAMAGAAPM-VTLGISLEPVQAVAPQIAALEAEQAGGAGSSLELVRHTRQQKEITTK  157

Query  391  -LAMKVGENLFNFMQSFCGVDGS---KLIVPMDILDRWFKIFQERAIRDPEYLK  242
             LA ++  N FNF+ SF   D S   +  VP+     W+  F+ +   DP +L+
Sbjct  158  VLAQRIIGNAFNFLASFASEDPSNRGQETVPLKTFRDWWTKFERKVEMDPTFLE  211



>gb|KIV86846.1| hypothetical protein PV11_02430 [Exophiala sideris]
Length=183

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 79/188 (42%), Gaps = 14/188 (7%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     +    + +        A      V +F+     LP + A 
Sbjct  1    MFGVFIPARPV---IPEMATVSPNQFAVSF-----PASPQFHNVGVFMHPGNMLPLETAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPE--PGGELQLTADATPLSAKIGVSVEEL  440
             VY+Q PG   F F GA+   +PSA+  +  P+    GE+ L     P +  I   + +L
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFKVNIPDSMAAGEINLGISVEP-AQNIQAQMSQL  111

Query  439  ATLPSLDVAAGK--KIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERA  266
                +  V A +      LA ++ +N FNF+ SF G      +VP+     W+  F+ + 
Sbjct  112  QQDSTAMVVAKRPPDTRVLAQRIIKNAFNFLASFGGSVNGVEVVPVKSFQDWWTKFERKV  171

Query  265  IRDPEYLK  242
              DP +L+
Sbjct  172  QNDPSFLE  179



>ref|XP_004455307.1| PREDICTED: protein Hikeshi isoform 2 [Dasypus novemcinctus]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEVFIPANVVLKWYENFQRRLAQNPLFWK  196



>gb|KIM41441.1| hypothetical protein M413DRAFT_411155 [Hebeloma cylindrosporum 
h7]
Length=210

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 79/181 (44%), Gaps = 30/181 (17%)
 Frame = -2

Query  745  SSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFLFCG  566
            ++ TQ+D +H   ++         +I  VC+FL+ N   P     AV+   PG  F   G
Sbjct  19   TNLTQVDESHAYFELAN-----ASTINHVCVFLVGNVPFPEGYGAAVHFFWPGKGFQLLG  73

Query  565  AVTLSRPSAVLSLPWPEPGGELQLTADA------------TPLSAKIGVSVE-------E  443
             ++  +PSA+  L     G    L  D               ++A +G+S+E       +
Sbjct  74   LLSNEKPSAIFRLRGTFQGSVGSLVQDKFSSFSTADVNMQQDVTAILGLSIEPLLQIQAQ  133

Query  442  LATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFCGVD--GSKLIVPMDILDRWFKI  281
            + +LP    A G  + R    LA +V ++LFN++ SF G         +PM ++ RW+  
Sbjct  134  ILSLPKPLTAPGMDLARDPTLLAERVVKHLFNYISSFIGGGPVSPDTTIPMSVIARWYDN  193

Query  280  F  278
            F
Sbjct  194  F  194



>gb|KII91494.1| hypothetical protein PLICRDRAFT_38256 [Plicaturopsis crispa FD-325 
SS-3]
Length=202

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 84/201 (42%), Gaps = 45/201 (22%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++    Q+D TH L ++      A  +I  +C+FLL     P     
Sbjct  1    MFGCCVAGRLLQTNLQ---QVDETHALFEL-----PAAGTINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATP---------------  476
             V+   PG  F   G ++  +PSA+  L           +ADAT                
Sbjct  53   TVHFFWPGKGFQLLGMLSNDKPSAIFRL-------RGTFSADATSANPTAFTNTVSGGAG  105

Query  475  --LSAKIGVSVE-------ELATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFC--  341
              ++A +G+SVE       ++ATL S  V  G    +    LA ++ ++LFN++  F   
Sbjct  106  DNVTAVLGLSVEPLSTIEPQIATLHSALVRPGSDPSKDPTLLAERIVKHLFNYISGFVPG  165

Query  340  GVDGSKLIVPMDILDRWFKIF  278
            G      ++PM +L RW+  F
Sbjct  166  GTVSPDAMIPMSVLARWYDSF  186



>ref|XP_003418595.1| PREDICTED: protein Hikeshi [Loxodonta africana]
 ref|XP_004385582.1| PREDICTED: protein Hikeshi [Trichechus manatus latirostris]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSSGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLTQNPLFWK  196



>ref|XP_004658324.1| PREDICTED: protein Hikeshi [Jaculus jaculus]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSDGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAISQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|NP_080580.1| protein Hikeshi isoform a [Mus musculus]
 ref|XP_003508058.1| PREDICTED: protein Hikeshi isoform X1 [Cricetulus griseus]
 ref|XP_005357620.1| PREDICTED: protein Hikeshi [Microtus ochrogaster]
 ref|XP_006229724.1| PREDICTED: protein Hikeshi isoform X1 [Rattus norvegicus]
 sp|Q9DD02.1|HIKES_MOUSE RecName: Full=Protein Hikeshi; AltName: Full=Lethal gene on chromosome 
7 Rinchik 6 protein [Mus musculus]
 sp|Q5M808.2|HIKES_RAT RecName: Full=Protein Hikeshi [Rattus norvegicus]
 dbj|BAB22001.1| unnamed protein product [Mus musculus]
 gb|AAH03916.1| Lethal, Chr 7, Rinchik 6 [Mus musculus]
 gb|ABA26460.1| l7RN6 protein [Mus musculus]
 gb|EDL06777.1| RIKEN cDNA 0610007P06, isoform CRA_e [Mus musculus]
 gb|EDM18567.1| similar to RIKEN cDNA 0610007P06, isoform CRA_b [Rattus norvegicus]
 gb|EGW05905.1| Uncharacterized protein C11orf73-like [Cricetulus griseus]
 gb|ERE77962.1| Protein of unknown function DUF775 containing protein [Cricetulus 
griseus]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S     +   G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>dbj|BAB28072.1| unnamed protein product [Mus musculus]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S     +   G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGVPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       S  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQAPVGSAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFALSQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|NP_057485.2| protein Hikeshi [Homo sapiens]
 ref|NP_001229498.1| protein Hikeshi [Pan troglodytes]
 ref|NP_001247909.1| protein Hikeshi [Macaca mulatta]
 ref|XP_003254611.1| PREDICTED: protein Hikeshi [Nomascus leucogenys]
 ref|XP_003833026.1| PREDICTED: protein Hikeshi isoform X1 [Pan paniscus]
 ref|XP_003910558.1| PREDICTED: protein Hikeshi isoform X1 [Papio anubis]
 ref|XP_005579340.1| PREDICTED: protein Hikeshi isoform X2 [Macaca fascicularis]
 ref|XP_008018625.1| PREDICTED: protein Hikeshi isoform X1 [Chlorocebus sabaeus]
 ref|XP_009005539.1| PREDICTED: protein Hikeshi [Callithrix jacchus]
 ref|XP_010354325.1| PREDICTED: protein Hikeshi [Rhinopithecus roxellana]
 ref|XP_011793884.1| PREDICTED: protein Hikeshi isoform X1 [Colobus angolensis palliatus]
 ref|XP_011840304.1| PREDICTED: protein Hikeshi isoform X2 [Mandrillus leucophaeus]
 ref|XP_011930985.1| PREDICTED: protein Hikeshi [Cercocebus atys]
 ref|XP_011717649.1| PREDICTED: protein Hikeshi [Macaca nemestrina]
 sp|Q53FT3.2|HIKES_HUMAN RecName: Full=Protein Hikeshi [Homo sapiens]
 dbj|BAA91698.1| unnamed protein product [Homo sapiens]
 gb|AAH01677.1| Chromosome 11 open reading frame 73 [Homo sapiens]
 gb|AAH06476.1| Chromosome 11 open reading frame 73 [Homo sapiens]
 gb|AAH15991.1| Chromosome 11 open reading frame 73 [Homo sapiens]
 gb|AAH21621.1| Chromosome 11 open reading frame 73 [Homo sapiens]
 gb|EAW75136.1| hypothetical protein HSPC138, isoform CRA_d [Homo sapiens]
 gb|ABM83657.1| chromosome 11 open reading frame 73 [synthetic construct]
 gb|ABM86903.1| chromosome 11 open reading frame 73 [synthetic construct]
 gb|EHH23302.1| hypothetical protein EGK_06742 [Macaca mulatta]
 gb|AIC51508.1| C11orf73, partial [synthetic construct]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>gb|KIW86168.1| hypothetical protein Z517_01563 [Fonsecaea pedrosoi CBS 271.37]
Length=201

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 84/209 (40%), Gaps = 38/209 (18%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I     +    + +        A  +   V +FL  N  LPP  A 
Sbjct  1    MFGVFIPTRPI---IPEMATVSPNQFAVSF-----PASPAFHNVGVFLHPNNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PG   F F GA+   +PSA+  +  P+ G    +  + +     +G+SVE    
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNLPDSG----VANNPSAGQVNLGISVEPAEN  108

Query  433  L-----------------PSLDVAAGKKIER-------LAMKVGENLFNFMQSFCGVDGS  326
            +                 P+   +    + +       LA ++  N FNF+ SF G   +
Sbjct  109  IQAQMLQLQQQQQQSPISPTTASSNSSALVKRPPDTRVLAQRIIRNAFNFLASFAGNTAN  168

Query  325  KL-IVPMDILDRWFKIFQERAIRDPEYLK  242
             + +VP+     W+  F+ R   DP +L+
Sbjct  169  GVEVVPLKSFQDWWTKFERRVQNDPGFLE  197



>gb|KIR25130.1| hypothetical protein I309_06033 [Cryptococcus gattii LA55]
 gb|KIR90653.1| hypothetical protein I304_05302 [Cryptococcus gattii CBS 10090]
Length=202

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 87/201 (43%), Gaps = 32/201 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTVPFPEGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPLSAKIGV  455
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL     +
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPQLEAI  112

Query  454  SVE-------ELATLPSLDVAAGKKIER------LAMKVGENLFNFMQSFCGVDGSK--L  320
            + E         A  P  D A GK++ R      +A KV  NLFNF+ SF G    +   
Sbjct  113  TAELSQNASASGAGAPGGD-AKGKELVRSVDVGKVAEKVVRNLFNFLHSFGGEGALRPDT  171

Query  319  IVPMDILDRWFKIFQERAIRD  257
             +P+ +  +W+  F  +   D
Sbjct  172  QIPLSVFQQWYTNFTRKIEND  192



>pdb|3WVZ|A Chain A, Crystal Structure Of Hikeshi, A New Nuclear Transport 
Receptor Of Hsp70
 pdb|3WVZ|B Chain B, Crystal Structure Of Hikeshi, A New Nuclear Transport 
Receptor Of Hsp70
Length=201

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  34   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  93

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  94   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  153

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  154  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  200



>gb|ETO07139.1| hypothetical protein RFI_30252 [Reticulomyxa filosa]
Length=209

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/196 (24%), Positives = 96/196 (49%), Gaps = 27/196 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            +F V+ P R  P++ +   QI  T  ++D+    GE     +   I +++  T+P +K  
Sbjct  28   VFCVMVPGR--PVNTTCL-QISPTRCIMDIPK-PGEC----KYFGISIIDPKTIPKNKGF  79

Query  610  AVYIQ-SPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             +Y    P + + F G + L  P+ ++  PW      +           KIG+ ++++  
Sbjct  80   IIYYSLPPFNEWSFIGTLHLKSPTQMMESPW------MVFKKITVCPMCKIGIELKDITF  133

Query  433  LPSLDV------AAGKKI----ERLAMKVGENLFNFMQSFCGV--DGSKLIVPMDILDRW  290
            + SL+V      +  K I    E  A+KV ++L+N++ S+     +G  ++ P   L++W
Sbjct  134  VQSLEVKEETEHSKNKFIATINEEFALKVAKDLYNYLSSYVKTSPNGEMMVCPASCLEKW  193

Query  289  FKIFQERAIRDPEYLK  242
             + F+E+ + DP+++K
Sbjct  194  HEKFKEKYVLDPKFMK  209



>gb|EHH56635.1| hypothetical protein EGM_06088 [Macaca fascicularis]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_009245196.1| PREDICTED: protein Hikeshi [Pongo abelii]
Length=202

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y+SI  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  35   YESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  94

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L ++       +  V++     +   K+ +N 
Sbjct  95   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNF  154

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  155  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  201



>ref|XP_007254894.1| PREDICTED: protein Hikeshi [Astyanax mexicanus]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 84/204 (41%), Gaps = 29/204 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R          Q D      D   F    Y+++  + +F+L     P     
Sbjct  1    MFGCLVAGR--------LVQTDAQQVASDKFVFNLPDYENVNHIVVFMLGTVPFPAGMGG  52

Query  610  AVYIQSP----GSPFLFCGAVTLSRPSAVLSLPWPEPG-GELQ----LTADATPLSAKIG  458
            AVY   P    G  +   G +T  +PSA+  +   + G G       + A   P  A++G
Sbjct  53   AVYFSFPDPNVGQVWQLLGFITNEKPSAIFKISGLKAGEGGAHPFGMMAAPQAPSVAQVG  112

Query  457  VSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFC------GVDGSKLIV  314
            VS+E L  L       S  V+      +   K+ E+L+NF  SF         + S++ V
Sbjct  113  VSIEALDQLAQQTPVSSAAVSTMDSFTQFTQKMLESLYNFTSSFALSQSQMTPNPSEMYV  172

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P   + +W++ FQ R +++P + K
Sbjct  173  PASSILKWYENFQRRMVQNPNFWK  196



>ref|XP_533984.1| PREDICTED: protein Hikeshi isoformX1 [Canis lupus familiaris]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSSGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>gb|KIR32514.1| hypothetical protein I352_04939 [Cryptococcus gattii MMRL2647]
Length=202

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 87/201 (43%), Gaps = 32/201 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTVPFPEGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPLSAKIGV  455
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL     +
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPQLEAI  112

Query  454  SVE-------ELATLPSLDVAAGKK------IERLAMKVGENLFNFMQSFCGVDGSK--L  320
            + E         A  P  D A GK+      + ++A KV  NLFNF+ SF G    +   
Sbjct  113  TAELSQNASTSGAGAPGGD-AKGKELVRSVDVSKVAEKVVRNLFNFLHSFGGEGALRPDT  171

Query  319  IVPMDILDRWFKIFQERAIRD  257
             +P+ +  +W+  F  +   D
Sbjct  172  QIPLSVFQQWYTNFTRKIEND  192



>ref|XP_007944460.1| PREDICTED: protein Hikeshi [Orycteropus afer afer]
Length=197

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLTQNPLFWK  196



>gb|KIW90766.1| hypothetical protein Z519_08549 [Cladophialophora bantiana CBS 
173.52]
Length=192

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 82/201 (41%), Gaps = 31/201 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I+    +    + +        A      V +FL  +  LPP  A 
Sbjct  1    MFGVFIPTRPI---ITELATVSPNQFAISF-----PASPPFHNVGVFLHPSNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATPLSAKIGVSVEELAT  434
             VY+Q PG   F F GA+   +PSA+  +  P+      +  + +     +G+SVE    
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNLPD-----SIANNPSAGQVNLGISVEPAQN  107

Query  433  L-------------PSLDVAAGKK---IERLAMKVGENLFNFMQSFCGVDGSKL-IVPMD  305
            +              S   A  K+      LA ++  N FNF+ SF G   + + +VP+ 
Sbjct  108  IQAQMAQLQQQSPTASNSTALVKRPPDTRVLAQRIIRNAFNFLASFAGNTANGIEVVPLK  167

Query  304  ILDRWFKIFQERAIRDPEYLK  242
                W+  F+ R   DP +L+
Sbjct  168  SFQDWWTKFERRVQNDPGFLE  188



>ref|XP_010210558.1| PREDICTED: protein Hikeshi, partial [Tinamus guttatus]
 gb|KGL75648.1| Protein Hikeshi, partial [Tinamus guttatus]
Length=187

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (45%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTLPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L +L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLESLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>gb|EPS93222.1| hypothetical protein FOMPIDRAFT_1170730 [Fomitopsis pinicola 
FP-58527 SS1]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 85/191 (45%), Gaps = 30/191 (16%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++    Q+D TH + ++        ++I  +C+FLL     P     
Sbjct  1    MFGCCIAGRLLQTNLQ---QVDDTHAVFELPN-----AETINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPW---PEPGGELQLTADATP---LSAKIGVSV  449
             V+   PG  F   G ++  +PSA+  L      +         DA P    +A +G+++
Sbjct  53   TVHFHWPGKGFQLLGMLSNDKPSAIFRLRGTFSAQTSRPALFNPDAAPAAETTAILGIAI  112

Query  448  E-------ELATLPSLDVAAGKKIER---LAMKVGENLFNFMQSFCGVDGSKL----IVP  311
            E       ELA+LPS        +     LA ++ ++LFN++  F G  G  +    +VP
Sbjct  113  EPLPTIDAELASLPSAVARPNTALPDATLLAERIVKHLFNYISGFMG--GGPVTPDSVVP  170

Query  310  MDILDRWFKIF  278
            M ++ +W++IF
Sbjct  171  MAMIAKWYEIF  181



>dbj|GAA91755.1| DUF775 domain protein [Aspergillus kawachii IFO 4308]
Length=221

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 79/176 (45%), Gaps = 34/176 (19%)
 Frame = -2

Query  670  IREVCIFLLNNFTLPPDKALAVYIQSP-----GSPFLFCGAVTLSRPSAVLSLPWPE-PG  509
            + E+ +F L    LPPD A A+YIQ P        F F GA+   RPSA+L +  P+ PG
Sbjct  39   LTELVVFFLPGTVLPPDTAAAIYIQFPDPNNNAPQFKFIGALANERPSAILKVQAPQIPG  98

Query  508  -GELQLTADATPLSAKIGVSVEEL-ATLPSLDV--------AAGKKIER-----------  392
                   A A P+   +G+S+E + A  P +           AG+ +E            
Sbjct  99   LQNGNAMAGAAPM-VTLGISLEPVQAVAPQVAALEAEQAGGGAGQSLELVRHNRQQKEIT  157

Query  391  ---LAMKVGENLFNFMQSFCGVDGS---KLIVPMDILDRWFKIFQERAIRDPEYLK  242
               LA ++  N FNF+ SF   D S   +  VP+     W+  F+ +   DP +L+
Sbjct  158  TKVLAQRIIGNAFNFLASFASEDPSNRGQETVPLKTFRDWWTKFERKVEMDPTFLE  213



>gb|KEP55510.1| putative inositol metabolism protein OPI10 [Rhizoctonia solani 
123E]
Length=215

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 87/207 (42%), Gaps = 44/207 (21%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG+V   R    +     QID TH       F  E+  ++  +C+F+L     PP  A 
Sbjct  1    MFGIVVAGRLLQTECQ---QIDETHV-----AFTIESAVNVNHICVFMLGTVPFPPGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQLTADATP-------------LS  470
             V+   PG  F   G ++  +PSAV  L       +LQ  +  +              ++
Sbjct  53   TVHFHWPGKGFQLLGMLSNEKPSAVFRLRGSYTPAQLQSHSTLSSAAAIGGPAPAVNDVT  112

Query  469  AKIGVSVEELATLPSLDVA-----AGKKIER---------------LAMKVGENLFNFMQ  350
            A +G++VE +  + +   A     AG+  +                LA ++ +++F ++ 
Sbjct  113  AILGIAVEPIQAVEAQISANATSQAGQSTDNRLIKPGSQGLADPTVLAERIVKHMFTYLS  172

Query  349  SFCGVDGS---KLIVPMDILDRWFKIF  278
            SF    GS     +VP++I+ RW+  F
Sbjct  173  SFVSDPGSLTTDTVVPLNIIRRWYDNF  199



>ref|XP_011117646.1| hypothetical protein AOL_s00006g35 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX53707.1| hypothetical protein AOL_s00006g35 [Arthrobotrys oligospora ATCC 
24927]
Length=235

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/241 (24%), Positives = 89/241 (37%), Gaps = 69/241 (29%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    ++ + +Q   T +L     FV  +  +I  + +FLL +  LPP  A 
Sbjct  1    MFGCICAGRQVQTNLQAVSQ---TEFL-----FVLPSAQTINHIVVFLLPDTQLPPGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL---PWPEPGGELQLTADATP------------  476
             VY Q PG PF   G +++ + SA+  L   P   P G       +T             
Sbjct  53   TVYFQWPGKPFQLLGGLSMEKQSAIFRLKSGPQTIPSGTATAAGTSTSDAMADENGFYPT  112

Query  475  ----LSAKIGVSVEELA---------------------------------------TLPS  425
                ++A++G+S+E +                                         L S
Sbjct  113  GAENITAQLGISIEPIGQAQQKLMMLPVHLSGLSASATLTSYGATIVPRDGTSDSNALAS  172

Query  424  LDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKLIVPMDILDRWFKIFQERAIRDPEYL  245
             D AA   + R  MK   N FN++ SF        +VPM     W+  F+ R   D  +L
Sbjct  173  RDSAATLTLARRIMK---NAFNYLGSFSSGPPGSEVVPMREFQSWWNKFERRLTVDSSFL  229

Query  244  K  242
            +
Sbjct  230  E  230



>gb|KIY33230.1| hypothetical protein I305_04096 [Cryptococcus gattii E566]
 gb|KJE03556.1| hypothetical protein I311_02596 [Cryptococcus gattii NT-10]
Length=202

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 86/200 (43%), Gaps = 30/200 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTVPFPKGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPLSA--KI  461
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL     I
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPHLEAI  112

Query  460  GVSVEELATLPSLDV----AAGKK------IERLAMKVGENLFNFMQSFCGVDGSK--LI  317
               + + A+ P          GK+      + ++A KV  NLFNF+ SF G    +    
Sbjct  113  AAGLSQSASAPGAGAPDGDGKGKELVKSVDVGKVAEKVVRNLFNFLHSFGGEGALRPDTQ  172

Query  316  VPMDILDRWFKIFQERAIRD  257
            +P+ +  +W+  F  +   D
Sbjct  173  IPLSVFQQWYTNFTRKIEND  192



>gb|EPQ13581.1| Hypothetical protein D623_10014362 [Myotis brandtii]
Length=230

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  63   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  122

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L TL       +  V++     +   K+ +N 
Sbjct  123  GEGSQHPFGAMNIVRTPSVAQIGISVELLDTLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  182

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  183  YNFASSFAISQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  229



>ref|XP_008588244.1| PREDICTED: protein Hikeshi isoform X1 [Galeopterus variegatus]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>emb|CCT73472.1| uncharacterized protein FFUJ_09729 [Fusarium fujikuroi IMI 58289]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 76/155 (49%), Gaps = 15/155 (10%)
 Frame = -2

Query  664  EVCIFLLNNFTLPPDKALAVYI----------QSPGSP-FLFCGAVTLSRPSAVLSLPWP  518
             + +F+L   +LPP+ A A+Y+          QS G+P F F G +   + SA+  +   
Sbjct  40   HIVVFILPGISLPPNTAAAIYLATAADVAAAAQSGGTPNFRFLGGIGPGKESAMFKISGG  99

Query  517  EPGGELQLTADATPLSAKIGVSVEELATLPSLDVAAGK-KIERLAMKVGENLFNFMQSFC  341
               G+L +     P    +G  ++ELA   S + + G+     LA ++ +N FNF+ SF 
Sbjct  100  GEAGDLVIGVSVEP-EESVGQRLQELAATKSGNPSGGQPSTAILAQRIIQNAFNFLSSFS  158

Query  340  GVDGSK--LIVPMDILDRWFKIFQERAIRDPEYLK  242
            G  G     +VP+   + W++ F+ R   DP +L+
Sbjct  159  GTAGPGGVEVVPLKAFENWWRKFESRVRADPSFLE  193



>ref|XP_007124970.1| PREDICTED: protein Hikeshi isoform X1 [Physeter catodon]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGMSVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_001490181.1| PREDICTED: protein Hikeshi [Equus caballus]
 ref|XP_003780890.1| PREDICTED: protein Hikeshi [Otolemur garnettii]
 ref|XP_004434138.1| PREDICTED: protein Hikeshi [Ceratotherium simum simum]
 ref|XP_006144986.1| PREDICTED: protein Hikeshi-like [Tupaia chinensis]
 ref|XP_008538577.1| PREDICTED: protein Hikeshi [Equus przewalskii]
Length=197

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_007848394.1| inositol metabolism protein opi10 [Moniliophthora roreri MCA 
2997]
 gb|ESK92258.1| inositol metabolism protein opi10 [Moniliophthora roreri MCA 
2997]
Length=200

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 35/198 (18%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++    Q+D TH L ++         +I  VC+FLL     P     
Sbjct  1    MFGCCVAGRPLQTNLQ---QVDETHALFELPN-----ASTINHVCVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL-----PWPEPGG------ELQLTADATPLSAK  464
             V+   PG  F   G ++  + SA+  L     P    G        +  TAD T   A 
Sbjct  53   TVHFHWPGKGFQLLGMLSNEKQSAIFKLRGSFSPSTSYGAFDTSNTPMGATADVT---AM  109

Query  463  IGVSVE-------ELATLPSLDVAAGKKIER----LAMKVGENLFNFMQSFC--GVDGSK  323
            +G S+E       ++  LPS  V +   + +    LA ++ ++LFN++ SF   GV  S+
Sbjct  110  LGFSIEPLPQIQAQITALPSSVVTSQNDLSKNPTLLAERIVKHLFNYLSSFSGGGVMSSE  169

Query  322  LIVPMDILDRWFKIFQER  269
            + VP  ++ +W++ F  +
Sbjct  170  VPVPTGVILKWYENFMGK  187



>gb|KIM28437.1| hypothetical protein M408DRAFT_69974 [Serendipita vermifera MAFF 
305830]
Length=196

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/192 (23%), Positives = 90/192 (47%), Gaps = 27/192 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG     R    ++    Q+D +H +     F  E+ ++I  +C+F+L     PP  A 
Sbjct  1    MFGCCVAGRLLQTNLQ---QVDESHCV-----FALESAETINHLCVFMLGTVPFPPGYAA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPWP-------EPGGELQLTADATPL---SAKI  461
             V+   PG  F   G ++  +PSA+  +          +     +L   + P+   +A++
Sbjct  53   TVHFYWPGRGFQLLGMLSNDKPSAIFRVKGAFGASESSQVSSSRELFLASQPMAGTTAQL  112

Query  460  GVSVE-------ELATLPSLDVAAGKKIERLAMKVGENLFNFMQSFCGVD-GSKLIVPMD  305
            G+++E       +++ +P+ +      +  LA K+G++L N++ SF     G +  VP++
Sbjct  113  GIAIEPIDTVVQQVSGMPTANKPVTDPVT-LAEKIGKHLMNYLSSFGESGPGGQSYVPVN  171

Query  304  ILDRWFKIFQER  269
             + RW++ F  +
Sbjct  172  AVGRWYESFMSK  183



>ref|XP_002708700.1| PREDICTED: protein Hikeshi isoform X1 [Oryctolagus cuniculus]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGTMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLTQNPLFWK  196



>ref|XP_010143400.1| PREDICTED: protein Hikeshi, partial [Buceros rhinoceros silvestris]
 gb|KFO85684.1| Protein Hikeshi, partial [Buceros rhinoceros silvestris]
Length=187

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (45%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTVPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L +L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLESLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>ref|XP_003192557.1| hypothetical protein CGB_C0210C [Cryptococcus gattii WM276]
 gb|ADV20770.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
 gb|KIR82379.1| hypothetical protein I306_00526 [Cryptococcus gattii EJB2]
Length=202

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 86/200 (43%), Gaps = 30/200 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTVPFPEGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPLSA--KI  461
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL     I
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPHLEAI  112

Query  460  GVSVEELATLPSLDV----AAGKK------IERLAMKVGENLFNFMQSFCGVDGSK--LI  317
               + + A+ P          GK+      + ++A KV  NLFNF+ SF G    +    
Sbjct  113  AAGLSQSASAPGAGAPDGDGKGKELVKSVDVGKVAEKVVRNLFNFLHSFGGEGALRPDTQ  172

Query  316  VPMDILDRWFKIFQERAIRD  257
            +P+ +  +W+  F  +   D
Sbjct  173  IPLSVFQQWYTNFTRKIEND  192



>ref|XP_005038378.1| PREDICTED: protein Hikeshi-like isoform X2 [Ficedula albicollis]
Length=203

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 75/169 (44%), Gaps = 21/169 (12%)
 Frame = -2

Query  685  EAYDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWP  518
            E Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   
Sbjct  34   EDYENINHVVVFMLGTIPFPDGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGL  93

Query  517  EPGGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGE  371
            + G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +
Sbjct  94   KSGKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLD  153

Query  370  NLFNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            N +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  154  NFYNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  202



>ref|XP_010191985.1| PREDICTED: protein Hikeshi [Mesitornis unicolor]
Length=220

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 82/191 (43%), Gaps = 21/191 (11%)
 Frame = -2

Query  751  DISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKALAVYI----QSPGS  584
            D++S  Q        D   F    Y++I  V +F+L     P     +VY     QS  +
Sbjct  29   DVASRVQAAPQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMA  88

Query  583  PFLFCGAVTLSRPSAVLSLPWPEPGGELQ-----LTADATPLSAKIGVSVEELATL----  431
             +   G VT  +PSA+  +   + G   Q     +    TP  A+IG+SVE L  L    
Sbjct  89   VWQLLGFVTNEKPSAIFKISGLKSGKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQT  148

Query  430  --PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDG------SKLIVPMDILDRWFKIFQ  275
               S  V++         K+ +N +NF  SF           S+  +P++++ +W++ FQ
Sbjct  149  PVASAAVSSVDSFTEFTQKMLDNFYNFASSFAVTQAQMTPNPSEAFIPVNVVLKWYENFQ  208

Query  274  ERAIRDPEYLK  242
             R  ++P + K
Sbjct  209  RRLTQNPLFWK  219



>ref|XP_004019450.1| PREDICTED: protein Hikeshi isoform X1 [Ovis aries]
 ref|XP_005699498.1| PREDICTED: protein Hikeshi [Capra hircus]
 ref|XP_005983662.1| PREDICTED: protein Hikeshi [Pantholops hodgsonii]
 ref|XP_011998928.1| PREDICTED: protein Hikeshi isoform X1 [Ovis aries musimon]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGTMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_006895323.1| PREDICTED: protein Hikeshi [Elephantulus edwardii]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLTQNPLFWK  196



>gb|KFQ11297.1| Protein Hikeshi, partial [Haliaeetus albicilla]
Length=187

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>ref|XP_008547509.1| PREDICTED: protein OPI10 homolog [Microplitis demolitor]
Length=196

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 93/203 (46%), Gaps = 29/203 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            M G++   R    D   F QI    +L++    V +A D++  + IFL     LP     
Sbjct  1    MLGIIVSGRLVQTD---FQQISDNQFLIN----VPDA-DNVNHIVIFLTGTIPLPEGMGG  52

Query  610  AVYIQ--SPGSP--FLFCGAVTLSRPSAVLSLPWPEPGGELQ-----LTADATPLSAKIG  458
            AVY     P +P  + F G ++ S+PSA+  +   +   E +     +       SA+IG
Sbjct  53   AVYFSWPDPNAPPNWQFLGYISNSKPSAIFRISDLKKNHEFENSNVGIFGAKISHSAQIG  112

Query  457  VSVEELATL-PSLDVAAGKKIE---RLAMKVGENLFNFMQSFCGVDGSKLI-------VP  311
            +SVE L+ + P   + A    E   + A K+  N  N++ SF  V  S+++       VP
Sbjct  113  ISVEPLSVIEPQAALVASTTTESHVKFAQKMIINFLNYVSSFS-VTQSQMVPNPTENFVP  171

Query  310  MDILDRWFKIFQERAIRDPEYLK  242
            +  +  W++ F+ R  ++P + K
Sbjct  172  LSSVQSWYETFERRLQQNPNFWK  194



>ref|XP_006197517.1| PREDICTED: protein Hikeshi [Vicugna pacos]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_009871085.1| PREDICTED: protein Hikeshi, partial [Apaloderma vittatum]
 ref|XP_009985129.1| PREDICTED: protein Hikeshi, partial [Tauraco erythrolophus]
 gb|KFP62786.1| Protein Hikeshi, partial [Cariama cristata]
 gb|KFW84698.1| Protein Hikeshi, partial [Manacus vitellinus]
 gb|KGL90222.1| Protein Hikeshi, partial [Charadrius vociferus]
Length=187

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>ref|XP_009879553.1| PREDICTED: protein Hikeshi [Charadrius vociferus]
Length=203

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  36   YENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  95

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  96   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  155

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  156  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  202



>ref|XP_006865017.1| PREDICTED: protein Hikeshi [Chrysochloris asiatica]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (45%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGIPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L  L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDNLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLTQNPLFWK  196



>ref|XP_010151124.1| PREDICTED: protein Hikeshi, partial [Eurypyga helias]
Length=187

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNDKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>ref|XP_007740093.1| hypothetical protein A1O5_01284 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ76776.1| hypothetical protein A1O5_01284 [Cladophialophora psammophila 
CBS 110553]
Length=192

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/196 (26%), Positives = 77/196 (39%), Gaps = 21/196 (11%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFGV  P R     I+    +    + +        A      V +FL  +  LPP  A 
Sbjct  1    MFGVFIPTRPI---ITELATVSPNQFAVSF-----PASPPFHNVGVFLHPSNLLPPGTAA  52

Query  610  AVYIQSPGSP-FLFCGAVTLSRPSAVLSLPWPE------PGGELQLTADATPLSAKIGVS  452
             VY+Q PG   F F GA+   +PSA+  +  P+        G++ L     P        
Sbjct  53   GVYMQLPGEQGFKFLGAIGNEKPSALFRVNLPDSIANNPSAGQVNLGISVEPAQNIQAQM  112

Query  451  VEELATLPSLD-----VAAGKKIERLAMKVGENLFNFMQSFCGVDGSKL-IVPMDILDRW  290
             +     P+       V        LA ++  N FNF+ SF G   + + +VP+     W
Sbjct  113  AQIQQQSPTASNSTALVKRPPDTRVLAQRIIRNAFNFLASFAGNTANGIEVVPLKSFQDW  172

Query  289  FKIFQERAIRDPEYLK  242
            +  F+ R   DP +L+
Sbjct  173  WTKFERRVQNDPGFLE  188



>ref|XP_005038377.1| PREDICTED: protein Hikeshi-like isoform X1 [Ficedula albicollis]
Length=215

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 75/169 (44%), Gaps = 21/169 (12%)
 Frame = -2

Query  685  EAYDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWP  518
            E Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   
Sbjct  46   EDYENINHVVVFMLGTIPFPDGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGL  105

Query  517  EPGGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGE  371
            + G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +
Sbjct  106  KSGKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLD  165

Query  370  NLFNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            N +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  166  NFYNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  214



>gb|KIR47955.1| hypothetical protein I312_02469 [Cryptococcus gattii CA1280]
 gb|KIR57529.1| hypothetical protein I314_06668 [Cryptococcus gattii CA1873]
Length=202

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 86/200 (43%), Gaps = 30/200 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R   +  ++  QID TH++  +     + Y+ I  + +FLL     P     
Sbjct  1    MFGAIVAGR---LVQTNLQQIDETHFVFPLE----QPYE-INHLTVFLLGTVPFPEGFGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSL--------PWPEPGGELQLTADATPL----SA  467
            +V+   PG  ++  G +T ++PSA+  +        P  +P    QL  +  PL    + 
Sbjct  53   SVHFAWPGKEYIPLGVLTNTKPSAIFRVRSHLPSNAPIGQPSPPAQLGIEIAPLPQLEAI  112

Query  466  KIGVSVEELATLPSLDVAAGKKIE--------RLAMKVGENLFNFMQSFCGVDGSK--LI  317
              G+S    A+   +    GK  E        ++A KV  NLFNF+ SF G    +    
Sbjct  113  AAGLSQSASASGAGVPGGDGKGKELVKSVDVGKVAEKVVRNLFNFLHSFGGEGALRPDTQ  172

Query  316  VPMDILDRWFKIFQERAIRD  257
            +P+ +  +W+  F  +   D
Sbjct  173  IPLSVFQQWYTNFTRKIEND  192



>ref|XP_009693939.1| PREDICTED: protein Hikeshi [Cariama cristata]
Length=200

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 87/204 (43%), Gaps = 26/204 (13%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R      ++  Q+    ++ D+       Y++I  V +F+L     P     
Sbjct  1    MFGCLVAGRKKSAVQAAPQQVAEDKFVFDL-----PDYENINHVVVFMLGTIPFPEGMGG  55

Query  610  AVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEPGGELQ-----LTADATPLSAKIG  458
            +VY     QS  + +   G VT  +PSA+  +   + G   Q     +    TP  A+IG
Sbjct  56   SVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKSGKGSQHPFGAMNLPQTPTVAQIG  115

Query  457  VSVEELATL------PSLDVAAGKKIERLAMKVGENLFNFMQSFCGVDG------SKLIV  314
            +SVE L  L       S  V++         K+ +N +NF  SF           S+  +
Sbjct  116  ISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNFYNFASSFAVTQAQMTPNPSEAFI  175

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P +++ +W++ FQ R  ++P + K
Sbjct  176  PANVVLKWYENFQRRLTQNPLFWK  199



>ref|XP_005029808.1| PREDICTED: protein Hikeshi-like isoform X3 [Anas platyrhynchos]
Length=197

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTIPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  89

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  90   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  196



>ref|XP_004271912.1| PREDICTED: protein Hikeshi [Orcinus orca]
 ref|XP_004319637.1| PREDICTED: protein Hikeshi [Tursiops truncatus]
 ref|XP_007448899.1| PREDICTED: protein Hikeshi [Lipotes vexillifer]
Length=197

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_004683327.1| PREDICTED: protein Hikeshi [Condylura cristata]
Length=197

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINRVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_007538512.1| PREDICTED: protein Hikeshi [Erinaceus europaeus]
Length=197

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSP----FLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S     +   G V+  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGVPVWQLLGFVSNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNILRTPSVAQIGISVELLGSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAVSQAQMTPNPSEMFIPANVVLKWYESFQRRLAQNPLFWK  196



>ref|XP_004082189.1| PREDICTED: protein Hikeshi [Oryzias latipes]
Length=197

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/204 (26%), Positives = 81/204 (40%), Gaps = 29/204 (14%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R          Q D      D   F    Y+++  V +F+L     P     
Sbjct  1    MFGCLVAGR--------LVQTDALQVAADKFVFNLPDYENVNHVVVFMLGTVPFPAGMGG  52

Query  610  AVYIQSP----GSP-FLFCGAVTLSRPSAVLSLPWPEPG----GELQLTADATPLSAKIG  458
            AVY   P    G P +   G +T  +PSA+  +   + G        + A A    A++G
Sbjct  53   AVYFSFPDPLSGGPVWQLLGFITNDKPSAIFKISGLKAGKGGAHPFGMMAAAPSSVAQLG  112

Query  457  VSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFCGVDG------SKLIV  314
            VSVE L  L       S  V+      +   K+ ENL+NF  SF           ++  +
Sbjct  113  VSVETLDQLAQQTPVSSAAVSTVDSFMQFTQKMMENLYNFAASFAVTQAQMTPNLTETFI  172

Query  313  PMDILDRWFKIFQERAIRDPEYLK  242
            P   + RW++ FQ R  ++P + K
Sbjct  173  PSSCMLRWYENFQRRMAQNPNFWK  196



>gb|EMD37125.1| hypothetical protein CERSUDRAFT_115045 [Ceriporiopsis subvermispora 
B]
Length=200

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/204 (26%), Positives = 85/204 (42%), Gaps = 47/204 (23%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R    ++    Q+D TH L ++         +I  +C+FLL     P     
Sbjct  1    MFGCLVAGRPLQTNLQ---QVDETHALFEL-----PMASAINHICVFLLGTVPFPDGYGA  52

Query  610  AVYIQSPGSPFLFCGAVTLSRPSAVLSLPW---------------PEPGGELQLTADATP  476
             V+   PG  F   G ++  +PSA+  L                 P  GG   LT     
Sbjct  53   TVHFYWPGKGFQLLGMLSNEKPSAIFRLRGTFSAVSSNDTLFAGSPASGGGPALT-----  107

Query  475  LSAKIGVSVE-------ELATLPSLDVAA---GKKIERLAMKVGENLFNFMQSFCGVDGS  326
              A +G+S+E       E+ TLPS    A         +A +V ++LFN++ SF  V G 
Sbjct  108  --ALLGLSIEPLPEILNEMTTLPSAISRAAPVASDATLMAERVVKHLFNYVSSF--VSGG  163

Query  325  KLI-----VPMDILDRWFKIFQER  269
            + +     VPM ++ +W++ F  +
Sbjct  164  QTLTPDTQVPMALIAKWYETFMSK  187



>ref|XP_004619098.1| PREDICTED: protein Hikeshi [Sorex araneus]
Length=197

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (46%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYIQSPGSPFL----FCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY   P S  +      G VT  +PSA+  +   + 
Sbjct  30   YENINHVVVFMLGTVPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKS  89

Query  511  GGELQLTADA-----TPLSAKIGVSVEELATLP------SLDVAAGKKIERLAMKVGENL  365
            G   Q    A     TP  A+IG+SVE L +L       +  V++     +   K+ +N 
Sbjct  90   GEGSQHPFGAMNIIRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQKMLDNF  149

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S++ +P +++ +W++ FQ R  ++P + K
Sbjct  150  YNFASSFAISQAQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFWK  196



>ref|XP_009071559.1| PREDICTED: protein Hikeshi, partial [Acanthisitta chloris]
 gb|KFP79028.1| Protein Hikeshi, partial [Acanthisitta chloris]
Length=187

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 74/167 (44%), Gaps = 21/167 (13%)
 Frame = -2

Query  679  YDSIREVCIFLLNNFTLPPDKALAVYI----QSPGSPFLFCGAVTLSRPSAVLSLPWPEP  512
            Y++I  V +F+L     P     +VY     QS  + +   G VT  +PSA+  +   + 
Sbjct  20   YENINHVVVFMLGTVPFPEGMGGSVYFCYPDQSGMAVWQLLGFVTNEKPSAIFKISGLKS  79

Query  511  GGELQ-----LTADATPLSAKIGVSVEELATL------PSLDVAAGKKIERLAMKVGENL  365
            G   Q     +    TP  A+IG+SVE L  L       S  V++         K+ +N 
Sbjct  80   GKGSQHPFGAMNLPQTPTVAQIGISVELLENLAQQTPVASAAVSSVDSFTEFTQKMLDNF  139

Query  364  FNFMQSFCGVDG------SKLIVPMDILDRWFKIFQERAIRDPEYLK  242
            +NF  SF           S+  +P +++ +W++ FQ R  ++P + K
Sbjct  140  YNFASSFAVTQAQMTPNPSEAFIPANVVLKWYENFQRRLTQNPLFWK  186



>ref|XP_008312903.1| PREDICTED: protein Hikeshi isoform X1 [Cynoglossus semilaevis]
Length=199

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 80/206 (39%), Gaps = 31/206 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG V   R          Q D      D   F    Y+++  V +F+L     P     
Sbjct  1    MFGCVVAGR--------LVQTDAVQVAADKFVFDLPDYENVNHVVVFMLGTVPFPAGMGG  52

Query  610  AVYIQSP------GSPFLFCGAVTLSRPSAVL---SLPWPEPGGELQ--LTADATPLSAK  464
            AVY   P      G  +   G +T  +PSA+     L   E G   Q   TA  T   A+
Sbjct  53   AVYFCFPNPGGGDGPVWQLLGFITNDKPSAIFKISGLKLAEGGTPAQPFGTAATTSCMAQ  112

Query  463  IGVSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFCGVDG------SKL  320
            +GVSVE L  L       S  V+          K+ +NL+N+  SF           S+ 
Sbjct  113  LGVSVEPLQHLAQQVPVSSATVSTVDSFHLFTHKMLDNLYNYASSFAVSQAQMTPNPSET  172

Query  319  IVPMDILDRWFKIFQERAIRDPEYLK  242
             +P   + RW++ FQ R  ++P + K
Sbjct  173  FIPSSCVRRWYENFQRRMSQNPNFWK  198



>ref|XP_005456017.1| PREDICTED: protein Hikeshi-like [Oreochromis niloticus]
Length=198

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 84/205 (41%), Gaps = 30/205 (15%)
 Frame = -2

Query  790  MFGVVFPNRSFPMDISSFTQIDTTHWLLDMNTFVGEAYDSIREVCIFLLNNFTLPPDKAL  611
            MFG +   R          Q D      D   F    Y+++  V +F+L     P     
Sbjct  1    MFGCLVAGR--------LVQTDAVQLSPDKFVFNLSDYENVNHVVVFMLGTVPFPAGMGG  52

Query  610  AVYIQSP----GSP-FLFCGAVTLSRPSAVLSLPWPEPG-GELQ----LTADATPLSAKI  461
            AVY   P    G P +   G +T  +PSA+  +   + G G       +T+ A+P  A++
Sbjct  53   AVYFSFPDPASGGPVWQLLGFITNDKPSAIFKISGLKAGEGGAHPFGIMTSSASPSVAQV  112

Query  460  GVSVEELATLP------SLDVAAGKKIERLAMKVGENLFNFMQSFCGVDGSKL------I  317
            GVSVE L  L       S  V+      +   K+ ++L+NF  SF       L       
Sbjct  113  GVSVEALEQLAQQIPVSSAAVSTVDTFLQFTQKMLDSLYNFASSFAVSQAQMLPNPTETF  172

Query  316  VPMDILDRWFKIFQERAIRDPEYLK  242
            +P   + +W++ FQ R  ++P + K
Sbjct  173  IPSSCILKWYENFQRRMAQNPNFWK  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1963610081719