BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6912

Length=909
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        389   3e-123   Sesamum indicum [beniseed]
dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        367   6e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     379   1e-121   Eucalyptus grandis [rose gum]
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    372   8e-121   Solanum tuberosum [potatoes]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        382   8e-121   Nicotiana tomentosiformis
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               361   1e-120   Trifolium pratense [peavine clover]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        380   3e-120   Solanum lycopersicum
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        379   7e-120   Nicotiana sylvestris
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           377   8e-120   Nicotiana tabacum [American tobacco]
gb|EEC83021.1|  hypothetical protein OsI_28098                          369   1e-119   Oryza sativa Indica Group [Indian rice]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        379   1e-119   Cucumis melo [Oriental melon]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        379   2e-119   Eucalyptus grandis [rose gum]
dbj|BAG16527.1|  putative aconitase                                     378   2e-119   Capsicum chinense [bonnet pepper]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    378   2e-119   Solanum tuberosum [potatoes]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     365   2e-119   Vitis vinifera
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    378   3e-119   Nicotiana sylvestris
ref|XP_010100637.1|  Aconitate hydratase                                376   3e-119   
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      376   5e-119   Gossypium arboreum [tree cotton]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    368   7e-119   
gb|KHG08189.1|  hypothetical protein F383_11434                         374   1e-118   Gossypium arboreum [tree cotton]
ref|XP_012089852.1|  PREDICTED: aconitate hydratase, cytoplasmic        376   1e-118   Jatropha curcas
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   371   1e-118   Citrus sinensis [apfelsine]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic        376   1e-118   Cucumis sativus [cucumbers]
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        376   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    374   2e-118   
gb|ADZ57218.1|  aconitase protein                                       373   2e-118   Litchi chinensis [litchi]
gb|KJB60835.1|  hypothetical protein B456_009G327800                    375   2e-118   Gossypium raimondii
gb|KJB30565.1|  hypothetical protein B456_005G149700                    373   2e-118   Gossypium raimondii
ref|XP_003605929.1|  Aconitate hydratase                                375   3e-118   Medicago truncatula
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        374   5e-118   Fragaria vesca subsp. vesca
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    374   5e-118   Gossypium arboreum [tree cotton]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    374   8e-118   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    374   8e-118   Gossypium raimondii
gb|ADP03320.1|  aconitate hydratase                                     355   1e-117   Pinus pinaster [cluster pine]
gb|KJB62843.1|  hypothetical protein B456_009G439700                    357   1e-117   Gossypium raimondii
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        373   1e-117   Solanum lycopersicum
gb|AAP30039.1|  aconitase                                               371   2e-117   Solanum pennellii
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        371   2e-117   Glycine soja [wild soybean]
emb|CBE71057.1|  aconitate hydratase 3                                  371   2e-117   Citrus clementina [clementine]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    372   2e-117   Nicotiana tomentosiformis
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             372   4e-117   Phaseolus vulgaris [French bean]
gb|ADP03120.1|  aconitate hydratase                                     354   4e-117   Pinus sylvestris [Scotch pine]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    372   4e-117   Glycine max [soybeans]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    372   5e-117   Cicer arietinum [garbanzo]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    372   5e-117   Glycine max [soybeans]
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    372   5e-117   Solanum tuberosum [potatoes]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             372   6e-117   Citrus clementina [clementine]
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    369   7e-117   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               360   8e-117   
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   366   8e-117   Citrus sinensis [apfelsine]
gb|ADP03123.1|  aconitate hydratase                                     353   1e-116   Pinus sylvestris [Scotch pine]
gb|ADP03151.1|  aconitate hydratase                                     353   1e-116   Pinus sylvestris [Scotch pine]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    371   1e-116   Gossypium raimondii
gb|ADP03134.1|  aconitate hydratase                                     353   1e-116   Pinus sylvestris [Scotch pine]
gb|ADP03144.1|  aconitate hydratase                                     353   1e-116   Pinus sylvestris [Scotch pine]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    371   1e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    370   1e-116   Nelumbo nucifera [Indian lotus]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         368   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      368   2e-116   Citrus limon [lemon]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        368   2e-116   Glycine soja [wild soybean]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        370   2e-116   Glycine soja [wild soybean]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    370   2e-116   Glycine max [soybeans]
gb|ABK25210.1|  unknown                                                 358   2e-116   Picea sitchensis
ref|XP_006828850.1|  PREDICTED: aconitate hydratase, cytoplasmic        369   3e-116   Amborella trichopoda
gb|AAO62410.1|  aconitase                                               367   3e-116   Solanum pennellii
gb|EEE68177.1|  hypothetical protein OsJ_26310                          369   3e-116   Oryza sativa Japonica Group [Japonica rice]
gb|ADP03143.1|  aconitate hydratase                                     352   3e-116   Pinus sylvestris [Scotch pine]
ref|NP_001159192.1|  uncharacterized protein LOC100304277               348   4e-116   
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             369   5e-116   Eutrema salsugineum [saltwater cress]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             369   6e-116   Prunus persica
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        369   6e-116   Prunus mume [ume]
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    369   6e-116   Glycine max [soybeans]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             369   6e-116   
emb|CDX97969.1|  BnaA06g07200D                                          369   8e-116   
emb|CDX93088.1|  BnaA03g38100D                                          369   8e-116   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    369   8e-116   Camelina sativa [gold-of-pleasure]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    368   1e-115   Arabis alpina [alpine rockcress]
ref|NP_178634.2|  aconitate hydratase 3                                 368   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    368   1e-115   Tarenaya hassleriana [spider flower]
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    352   1e-115   
emb|CBE71058.1|  aconitate hydratase 2                                  366   1e-115   Citrus clementina [clementine]
emb|CDY18054.1|  BnaC07g04160D                                          368   1e-115   Brassica napus [oilseed rape]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        368   1e-115   Vitis vinifera
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    368   2e-115   
gb|ADM34980.1|  cytosolic aconitase                                     365   2e-115   Pyrus pyrifolia [sha li]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    367   2e-115   Gossypium raimondii
ref|XP_006376779.1|  aconitate hydratase family protein                 367   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    367   2e-115   
emb|CDY50945.1|  BnaC03g74450D                                          367   3e-115   Brassica napus [oilseed rape]
emb|CDP10817.1|  unnamed protein product                                367   3e-115   Coffea canephora [robusta coffee]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    367   3e-115   Populus euphratica
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        367   4e-115   Populus euphratica
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   367   4e-115   Citrus sinensis [apfelsine]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             367   4e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002870438.1|  predicted protein                                  366   5e-115   Arabidopsis lyrata subsp. lyrata
gb|KJB48278.1|  hypothetical protein B456_008G061900                    364   5e-115   Gossypium raimondii
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    366   6e-115   Brassica rapa
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             366   7e-115   Citrus clementina [clementine]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        366   7e-115   
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    364   8e-115   Cucurbita maxima [Boston marrow]
ref|XP_007045642.1|  Aconitase 3                                        366   8e-115   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        366   8e-115   Pyrus x bretschneideri [bai li]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                366   8e-115   Erythranthe guttata [common monkey flower]
ref|XP_003596988.1|  Aconitate hydratase                                365   1e-114   Medicago truncatula
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    365   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002524184.1|  aconitase, putative                                365   1e-114   Ricinus communis
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    360   2e-114   
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          365   2e-114   Sorghum bicolor [broomcorn]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        365   2e-114   Vitis vinifera
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   353   2e-114   Citrus sinensis [apfelsine]
ref|XP_011620315.1|  PREDICTED: aconitate hydratase, cytoplasmic        364   3e-114   Amborella trichopoda
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        362   3e-114   Gossypium arboreum [tree cotton]
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    365   4e-114   Sesamum indicum [beniseed]
gb|KHG02134.1|  hypothetical protein F383_25649                         364   4e-114   Gossypium arboreum [tree cotton]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             364   5e-114   Capsella rubella
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    363   5e-114   Camelina sativa [gold-of-pleasure]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        362   5e-114   Gossypium arboreum [tree cotton]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   362   6e-114   Nelumbo nucifera [Indian lotus]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   363   9e-114   Citrus sinensis [apfelsine]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    363   1e-113   Brassica rapa
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    363   1e-113   Phoenix dactylifera
ref|XP_012070836.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    358   2e-113   Jatropha curcas
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                362   2e-113   Erythranthe guttata [common monkey flower]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    362   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    362   3e-113   Elaeis guineensis
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    361   4e-113   Cicer arietinum [garbanzo]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    361   6e-113   
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    362   6e-113   Nicotiana tomentosiformis
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   354   7e-113   Citrus sinensis [apfelsine]
ref|XP_007046597.1|  Aconitase 1                                        359   7e-113   
ref|XP_002530635.1|  aconitase, putative                                358   2e-112   Ricinus communis
ref|XP_002532564.1|  aconitase, putative                                360   2e-112   
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    360   3e-112   Nicotiana sylvestris
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   354   4e-112   Citrus sinensis [apfelsine]
ref|NP_001159229.1|  uncharacterized protein LOC100304315               351   6e-112   
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     354   6e-112   Gossypium arboreum [tree cotton]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    358   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             358   1e-111   Eutrema salsugineum [saltwater cress]
ref|XP_012070835.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    358   1e-111   Jatropha curcas
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    352   2e-111   Camelina sativa [gold-of-pleasure]
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              349   3e-111   
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    352   3e-111   Medicago truncatula
emb|CBE71056.1|  aconitate hydratase 1                                  354   4e-111   Citrus clementina [clementine]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     354   4e-111   Cucumis melo [Oriental melon]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   354   4e-111   Citrus sinensis [apfelsine]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   354   4e-111   Citrus sinensis [apfelsine]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   354   4e-111   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   354   4e-111   Citrus sinensis [apfelsine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             354   4e-111   Citrus clementina [clementine]
gb|KGN48958.1|  Aconitase                                               353   6e-111   Cucumis sativus [cucumbers]
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   354   6e-111   Vitis vinifera
ref|XP_004134842.1|  PREDICTED: aconitate hydratase                     353   7e-111   Cucumis sativus [cucumbers]
emb|CBI24446.3|  unnamed protein product                                353   8e-111   Vitis vinifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   1e-110   Elaeis guineensis
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    355   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   350   1e-110   
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   353   1e-110   Citrus sinensis [apfelsine]
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              350   2e-110   
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    354   2e-110   Phoenix dactylifera
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    350   2e-110   
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    354   2e-110   Brassica rapa
emb|CDY66424.1|  BnaAnng22230D                                          354   2e-110   Brassica napus [oilseed rape]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    354   2e-110   Solanum tuberosum [potatoes]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   352   3e-110   
ref|XP_003612247.1|  Aconitate hydratase                                352   3e-110   Medicago truncatula
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    354   3e-110   Elaeis guineensis
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    353   4e-110   Setaria italica
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   351   4e-110   Pyrus x bretschneideri [bai li]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    353   5e-110   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY14291.1|  BnaA08g14220D                                          353   7e-110   Brassica napus [oilseed rape]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              350   8e-110   Pyrus x bretschneideri [bai li]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    353   9e-110   Arabis alpina [alpine rockcress]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              350   9e-110   Pyrus x bretschneideri [bai li]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             352   1e-109   
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               349   1e-109   Triticum urartu
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    352   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             351   3e-109   
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    351   4e-109   
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    351   4e-109   Phoenix dactylifera
gb|AAL13084.1|  putative aconitase                                      348   6e-109   Prunus avium [gean]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    350   6e-109   Brachypodium distachyon [annual false brome]
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          350   6e-109   Sorghum bicolor [broomcorn]
ref|XP_012088458.1|  PREDICTED: aconitate hydratase 1                   348   6e-109   Jatropha curcas
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             348   7e-109   Prunus persica
emb|CAB36543.1|  putative aconitase                                     348   8e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     345   8e-109   Eucalyptus grandis [rose gum]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               349   9e-109   
ref|NP_001119125.1|  aconitate hydratase 1                              345   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    349   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             349   2e-108   Capsella rubella
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    349   2e-108   Brachypodium distachyon [annual false brome]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               346   2e-108   Triticum urartu
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   347   2e-108   Prunus mume [ume]
dbj|BAJ85661.1|  predicted protein                                      348   3e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    348   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567763.2|  aconitase 2                                           348   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   345   8e-108   Eucalyptus grandis [rose gum]
ref|XP_006383042.1|  aconitate hydratase family protein                 345   9e-108   Populus trichocarpa [western balsam poplar]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     345   9e-108   Eucalyptus grandis [rose gum]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             345   1e-107   Phaseolus vulgaris [French bean]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              345   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    345   1e-107   
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   345   1e-107   Populus euphratica
ref|NP_195308.1|  aconitate hydratase 1                                 345   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    345   2e-107   Arabis alpina [alpine rockcress]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          345   2e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010113288.1|  Aconitate hydratase 1                              345   3e-107   
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              344   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   344   3e-107   Brassica rapa
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    344   4e-107   Glycine max [soybeans]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   343   4e-107   Camelina sativa [gold-of-pleasure]
emb|CDX69174.1|  BnaC01g02790D                                          344   4e-107   
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   343   5e-107   Glycine max [soybeans]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    345   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             343   5e-107   Capsella rubella
gb|EEC74472.1|  hypothetical protein OsI_09921                          345   6e-107   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                       345   7e-107   
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             343   8e-107   Populus trichocarpa [western balsam poplar]
emb|CDP05740.1|  unnamed protein product                                345   9e-107   Coffea canephora [robusta coffee]
dbj|BAJ92965.1|  predicted protein                                      345   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              342   1e-106   Brassica rapa
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             342   1e-106   Eutrema salsugineum [saltwater cress]
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    335   1e-106   
ref|XP_007020807.1|  Aconitase 3                                        341   2e-106   
emb|CDY24823.1|  BnaA08g14870D                                          342   2e-106   Brassica napus [oilseed rape]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        342   3e-106   Glycine soja [wild soybean]
gb|KHN41868.1|  Aconitate hydratase 1                                   341   3e-106   Glycine soja [wild soybean]
emb|CDX75532.1|  BnaA01g01700D                                          342   4e-106   
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   340   8e-106   Tarenaya hassleriana [spider flower]
emb|CDY41626.1|  BnaC03g62580D                                          340   1e-105   Brassica napus [oilseed rape]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   339   3e-105   Fragaria vesca subsp. vesca
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              338   7e-105   Cicer arietinum [garbanzo]
gb|ACK56134.1|  putative aconitase                                      315   1e-104   Dimocarpus longan [longan]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               347   1e-104   
ref|XP_007020811.1|  Aconitase 3                                        336   9e-104   
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              332   1e-102   Tarenaya hassleriana [spider flower]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             332   2e-102   
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          333   2e-102   Sorghum bicolor [broomcorn]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    333   2e-102   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    333   3e-102   Zea mays [maize]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             331   3e-102   
gb|ERM97865.1|  hypothetical protein AMTR_s00115p00015570               328   2e-101   Amborella trichopoda
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              327   1e-100   Eucalyptus grandis [rose gum]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     327   2e-100   Eucalyptus grandis [rose gum]
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    322   6e-99    Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                322   8e-99    
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    314   2e-98    
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              315   2e-98    
gb|ACR36825.1|  unknown                                                 311   4e-98    Zea mays [maize]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    318   2e-97    Gossypium raimondii
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    313   9e-97    Cucumis melo var. conomon [snake cucumber]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             317   1e-96    
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             317   1e-96    
ref|XP_001780674.1|  predicted protein                                  315   2e-96    
ref|XP_001779205.1|  predicted protein                                  315   4e-96    
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    311   1e-95    
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    311   3e-95    
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    303   5e-95    
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    311   7e-95    Zea mays [maize]
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    311   3e-94    Camelina sativa [gold-of-pleasure]
emb|CAA58046.1|  aconitase                                              310   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    311   4e-94    Zea mays [maize]
ref|XP_001770969.1|  predicted protein                                  308   1e-93    
ref|NP_001147431.1|  aconitase2                                         308   1e-93    Zea mays [maize]
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    308   4e-93    
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               307   5e-93    Triticum urartu
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               305   5e-92    
emb|CDY56501.1|  BnaAnng14360D                                          300   2e-90    Brassica napus [oilseed rape]
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             276   2e-88    
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   293   4e-88    
ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        262   2e-84    
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    262   5e-83    Myotis lucifugus
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    261   7e-83    
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            255   1e-81    Phaseolus vulgaris [French bean]
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         259   2e-81    Perkinsus marinus ATCC 50983
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   276   2e-81    
ref|XP_001016756.1|  aconitate hydratase                                273   9e-81    Tetrahymena thermophila SB210
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         255   9e-80    Galeopterus variegatus [Malayan flying lemur]
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    253   2e-78    Notothenia coriiceps [yellowbelly rockcod]
gb|AGC69746.1|  putative iron regulatory protein                        265   7e-78    
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         265   8e-78    
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         259   9e-78    
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-78    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         263   1e-77    
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         265   2e-77    
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    264   3e-77    
gb|EDL98627.1|  rCG55067                                                263   3e-77    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         263   4e-77    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       263   5e-77    
gb|AAH05454.1|  Aconitase 1                                             263   5e-77    
emb|CAA43455.1|  iron response element binding protein                  263   5e-77    
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         263   5e-77    
emb|CAD20353.1|  cytoplasmic aconitase                                  263   6e-77    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         263   7e-77    
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            263   7e-77    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         259   7e-77    
gb|ENN73657.1|  hypothetical protein YQE_09735                          246   8e-77    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         262   9e-77    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         259   9e-77    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         258   1e-76    
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         262   1e-76    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         261   1e-76    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         258   1e-76    
gb|EGT30572.1|  CBN-ACO-1 protein                                       262   1e-76    
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         260   1e-76    
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         262   1e-76    
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         260   1e-76    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         258   1e-76    
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         260   1e-76    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         258   1e-76    
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         262   2e-76    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-76    
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  260   2e-76    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         261   2e-76    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         261   2e-76    
gb|KIH47318.1|  putative aconitate hydratase 1                          259   2e-76    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    261   2e-76    
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         261   3e-76    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         261   3e-76    
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         257   3e-76    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    261   3e-76    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    258   3e-76    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         261   3e-76    
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         261   3e-76    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         259   3e-76    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         261   4e-76    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         259   4e-76    
gb|ACF33175.1|  aconitase-1                                             261   4e-76    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         261   4e-76    
ref|XP_002765934.1|  aconitase, putative                                261   4e-76    
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         260   4e-76    
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    260   5e-76    
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         259   5e-76    
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   6e-76    
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    260   6e-76    
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   260   6e-76    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         259   6e-76    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         260   6e-76    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         259   6e-76    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         260   6e-76    
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   6e-76    
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    260   6e-76    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         260   6e-76    
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         260   6e-76    
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   7e-76    
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         260   7e-76    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         260   7e-76    
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         260   7e-76    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         260   7e-76    
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   7e-76    
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         260   8e-76    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         260   8e-76    
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         259   8e-76    
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    259   8e-76    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         259   8e-76    
ref|XP_001464867.1|  putative aconitase                                 260   9e-76    
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like    254   9e-76    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-76    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-76    
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-76    
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-76    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
ref|XP_012005122.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         259   1e-75    
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    260   1e-75    
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      259   1e-75    
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
ref|XP_004004476.2|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    256   1e-75    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
emb|CAP35039.2|  Protein CBR-ACO-1                                      259   1e-75    
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   1e-75    
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         260   1e-75    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  259   1e-75    
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         259   1e-75    
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         260   2e-75    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   2e-75    
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   2e-75    
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         259   2e-75    
ref|XP_001563981.1|  putative aconitase                                 259   2e-75    
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         258   2e-75    
ref|XP_011584460.1|  PREDICTED: cytoplasmic aconitate hydratase         258   2e-75    
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         258   2e-75    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    258   2e-75    
ref|XP_001682457.1|  putative aconitase                                 258   3e-75    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    258   3e-75    
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    258   3e-75    
ref|XP_010307150.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|NP_509898.1|  Protein ACO-1                                         258   3e-75    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|XP_001462506.1|  hypothetical protein                               253   3e-75    
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|XP_003761451.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         258   3e-75    
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    258   3e-75    
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    258   4e-75    
ref|XP_003884224.1|  Iron regulatory protein-like protein, related      259   4e-75    
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    258   4e-75    
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    258   4e-75    
ref|XP_010697897.1|  aconitase, putative                                258   5e-75    
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         259   5e-75    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         257   6e-75    
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         257   6e-75    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         257   7e-75    
ref|XP_001365420.1|  PREDICTED: cytoplasmic aconitate hydratase         257   8e-75    
ref|XP_002784977.1|  aconitase, putative                                239   9e-75    
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         257   1e-74    
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         257   1e-74    
ref|XP_011871581.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    256   1e-74    
ref|XP_011871579.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    256   1e-74    
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         256   1e-74    
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    256   1e-74    
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase         256   1e-74    
ref|XP_004333270.1|  aconitate hydratase, cytoplasmic, putative         246   1e-74    
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                257   2e-74    
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    256   2e-74    
ref|XP_011871580.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    256   2e-74    
ref|XP_011704722.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    256   2e-74    
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
ref|XP_011704721.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    256   2e-74    
emb|CAA04136.1|  iron regulatory protein                                242   2e-74    
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         256   2e-74    
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    256   2e-74    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    256   2e-74    
ref|NP_059017.1|  cytoplasmic aconitate hydratase                       256   3e-74    
ref|XP_007948891.1|  PREDICTED: cytoplasmic aconitate hydratase         256   3e-74    
emb|CCW69174.1|  unnamed protein product                                256   3e-74    
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like    255   3e-74    
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase            255   3e-74    
ref|XP_003874065.1|  putative aconitase                                 255   4e-74    
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     254   4e-74    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    255   5e-74    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    255   5e-74    
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase         255   5e-74    
gb|ETE68888.1|  Iron-responsive element-binding protein 2               254   5e-74    
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    254   6e-74    
ref|XP_002788756.1|  aconitase, putative                                253   6e-74    
ref|XP_004362727.1|  putative iron regulatory protein                   254   6e-74    
gb|AFI44047.1|  iron regulatory protein                                 254   7e-74    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              254   7e-74    
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like    254   7e-74    
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         236   8e-74    
gb|EPY31043.1|  aconitase                                               254   8e-74    
ref|XP_011924721.1|  PREDICTED: cytoplasmic aconitate hydratase i...    253   8e-74    
gb|EPY23614.1|  aconitate hydratase 1                                   254   9e-74    
gb|AJQ30117.1|  aconitate hydratase 1                                   254   9e-74    
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    254   1e-73    
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       254   1e-73    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    254   1e-73    
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    254   1e-73    
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         254   1e-73    
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    254   1e-73    
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase         254   1e-73    
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         254   1e-73    
ref|XP_007176909.1|  PREDICTED: cytoplasmic aconitate hydratase         254   1e-73    
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase         253   2e-73    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    253   2e-73    
ref|XP_002429734.1|  aconitase, putative                                253   2e-73    
ref|XP_977148.1|  aconitate hydratase 1 family protein                  254   2e-73    
ref|XP_011746263.1|  PREDICTED: cytoplasmic aconitate hydratase         253   2e-73    
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    253   2e-73    
gb|EHH57327.1|  hypothetical protein EGM_06925                          253   2e-73    
gb|EHH24050.1|  hypothetical protein EGK_07631                          253   2e-73    
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    253   2e-73    
ref|XP_008059371.1|  PREDICTED: cytoplasmic aconitate hydratase         253   2e-73    
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         253   3e-73    
ref|XP_002366326.1|  aconitate hydratase, putative                      254   3e-73    
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             254   3e-73    
ref|XP_011924723.1|  PREDICTED: cytoplasmic aconitate hydratase i...    253   3e-73    
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             254   3e-73    
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             254   3e-73    
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         253   3e-73    
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             254   3e-73    
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase         253   3e-73    
dbj|BAM18054.1|  iron regulatory protein 1A                             242   3e-73    
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         253   3e-73    
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             254   3e-73    



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   389 bits (998),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/193 (96%), Positives = 189/193 (98%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAM+YK
Sbjct  809   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYK  868

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  869   SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  928

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTV TD+GK FTCT RFDTEVELAYFNHG
Sbjct  929   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVVTDSGKQFTCTVRFDTEVELAYFNHG  988

Query  367   GILPYVIRQLTQQ  329
             GILPYVIRQLT+Q
Sbjct  989   GILPYVIRQLTKQ  1001



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   367 bits (943),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  136  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  195

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  196  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  255

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  256  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  315

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  316  GILPYVIRNLSKQ  328



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAM+YK
Sbjct  603  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  663  SAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GED DTLGLTGHERY+IDLPS IS+IRPGQDVTV TDTGK FTCTARFDTEVELAYFNHG
Sbjct  723  GEDTDTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHG  782

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L  Q
Sbjct  783  GILPYVIRNLINQ  795



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   372 bits (954),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVH+P+GEKL VFDAAM+YK
Sbjct  424  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYK  483

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  484  SAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  543

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  544  GEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHG  603

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLTQ+
Sbjct  604  GILQYVIRQLTQR  616



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   382 bits (980),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 181/193 (94%), Positives = 188/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL VFDAAM+YK
Sbjct  805  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYK  864

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  865  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  924

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP  IS+IRPGQDVTV+T+TGK FTCT RFDTEVELAYFNHG
Sbjct  925  GEDADTLGLTGHERYTIDLPENISEIRPGQDVTVRTETGKSFTCTVRFDTEVELAYFNHG  984

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQLT+Q
Sbjct  985  GILPYVIRQLTKQ  997



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+M+RGTFANIR+VNKLLNGEVGPKTVH+PTGEKL+VFDAA RYK
Sbjct  123  ERKDFNSYGSRRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHVPTGEKLFVFDAAERYK  182

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG  T++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  183  AAGHATIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKS  242

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KIS+I+PGQDVTV TD GK FTCTARFDTEVEL YFNHG
Sbjct  243  GEDADTLGLTGHERYTIDLPNKISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHG  302

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L  +
Sbjct  303  GILPYVIRNLINK  315



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   380 bits (975),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIP+GEKL VFDAAM+YK
Sbjct  789  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYK  848

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  849  SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  908

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  909  GEDADSLGLTGHERYTIDLPDNISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHG  968

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQL+QQ
Sbjct  969  GILPYVIRQLSQQ  981



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   379 bits (974),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/193 (93%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL VFDAAM+YK
Sbjct  804  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  864  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP  IS+IRPGQDV V+TDTGK FTC  RFDTEVELAYFNHG
Sbjct  924  GEDADTLGLTGHERYTIDLPENISEIRPGQDVAVRTDTGKSFTCIVRFDTEVELAYFNHG  983

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQLT+Q
Sbjct  984  GILPYVIRQLTKQ  996



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   377 bits (968),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIPTGEKL VFDAAM+YK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  766  SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTIDLP KIS+I PGQDVTV+TDTGK FTC  RFDTEVELAYFNHG
Sbjct  826  GEDAETLGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQL QQ
Sbjct  886  GILPYVIRQLIQQ  898



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKTVH+PTGEKLYVFDAA++YK
Sbjct  429  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYK  488

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  489  SEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT RFDTEVELAYFNHG
Sbjct  549  GEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHG  608

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L Q 
Sbjct  609  GILPYVIRNLAQN  621



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   379 bits (972),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  797  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYK  856

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  857  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  916

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLPS IS+IRPGQDVTV TD+GK FTCT RFDTEVELAYFNHG
Sbjct  917  GEDADSLGLTGHERYSIDLPSNISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNHG  976

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  977  GILPYVIRNLIKQ  989



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   379 bits (972),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAM+YK
Sbjct  804  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  864  SAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GED DTLGLTGHERY+IDLPS IS+IRPGQDVTV TDTGK FTCTARFDTEVELAYFNHG
Sbjct  924  GEDTDTLGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHG  983

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L  Q
Sbjct  984  GILPYVIRNLINQ  996



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/193 (93%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  803  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ+T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  863  SAGQNTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP  IS+IRPGQDV+VQTDTGK FTCT RFDTEVELAYFNHG
Sbjct  923  GEDADTLGLTGHERYTIDLPENISEIRPGQDVSVQTDTGKSFTCTVRFDTEVELAYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLT+Q
Sbjct  983  GILQYVIRQLTKQ  995



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   378 bits (970),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIP+GEKL VFDAAM+YK
Sbjct  789  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYK  848

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  849  SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  908

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP  IS+IRPGQDVTV+TDTGK FTC  RFDTEVELAYFNHG
Sbjct  909  GEDADSLGLTGHERYTIDLPDNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHG  968

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQL+QQ
Sbjct  969  GILPYVIRQLSQQ  981



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKL VFDAAM+YK
Sbjct  328  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYK  387

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +A Q T+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  388  TANQGTIILAGAEYGSGSSRDWAAKGPMLLGVKAXIAKSFERIHRSNLVGMGIIPLCFKP  447

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS I +IRPGQD+TV T+TGK F CTARFDTEVELAYFNHG
Sbjct  448  GEDADTLGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHG  507

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  508  GILPYVIRNLIKQ  520



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   378 bits (970),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIPTGEKL VFDAAM+YK
Sbjct  797  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYK  856

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  857  SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  916

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTIDLP KIS+I PGQDVTV+TDTGK FTC  RFDTEVELAYFNHG
Sbjct  917  GEDAETLGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHG  976

Query  367  GILPYVIRQLTQQ  329
            GILPYVIRQL QQ
Sbjct  977  GILPYVIRQLIQQ  989



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   376 bits (966),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/193 (92%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  746  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYK  805

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI KSFERIHRSNLVGMGIIPLCFKA
Sbjct  806  SAGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKA  865

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTIDLPS ISDIRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  866  GEDAETLGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  925

Query  367  GILPYVIRQLTQQ  329
            GILPY IR L +Q
Sbjct  926  GILPYAIRNLIKQ  938



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   376 bits (965),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKLYVFDAAMRYK
Sbjct  741  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYK  800

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  801  DAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  860

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPSKI+DIRPGQDVTV TD GK FTCT RFDTEVELAYFN+G
Sbjct  861  GEDADTLGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNG  920

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  921  GILPYVIRNLIKQ  933



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   368 bits (944),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  466  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  525

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDTVILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  526  SAGQDTVILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  585

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ I +IRPGQDVTV TD GK FTCT RFDTEVELAY+NHG
Sbjct  586  GEDADTLGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHG  645

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  646  GILPYVIRNLSKQ  658



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  687  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  746

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  747  DAGHDTIVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  806

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV TD GK FTCT RFDTEVELAYFN+G
Sbjct  807  GEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNG  866

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  867  GILPYVIRNLIKQ  879



>ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic [Jatropha curcas]
 gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   376 bits (966),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYVFDAAM+YK
Sbjct  806  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMKYK  865

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  866  TAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  925

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGLTGHERYTIDLPS ISDIRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  926  GQDADTLGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  985

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L ++
Sbjct  986  GILPYVIRNLMKE  998



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  603  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  663  AAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  723  GEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHG  782

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  783  GILPYVIRNLIKQ  795



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   376 bits (965),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  797  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYK  856

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  857  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  916

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP  IS+IRPGQDV+V TD+GK FTCT RFDTEVELAYFNHG
Sbjct  917  GEDADSLGLTGHERYSIDLPDNISEIRPGQDVSVTTDSGKSFTCTVRFDTEVELAYFNHG  976

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  977  GILPYVIRNLIKQ  989



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   376 bits (965),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+HIPTGEKLYVFDAAMRYK
Sbjct  800  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYK  859

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  860  AAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  919

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLPSK+S+IRPGQDVTV TDTGK FTCT RFDTEVELAYFNHG
Sbjct  920  GEDADTLGLTGQERYTIDLPSKVSEIRPGQDVTVVTDTGKSFTCTVRFDTEVELAYFNHG  979

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L + 
Sbjct  980  GILPYVIRNLMKH  992



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYV+DAAMRYK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQD+TV TD GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLTGHERYTIDLPTKISDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR LT+Q
Sbjct  886  GILQYVIRNLTKQ  898



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGP+TVH+PTGEKL+VFDAA RYK
Sbjct  691  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPQTVHVPTGEKLFVFDAAQRYK  750

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  751  DAGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  810

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+ IS+IRPGQDVTV TDTGK FTCT RFDTEVELAYFNHG
Sbjct  811  GEDADTLGLTGHERYTIDLPNSISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHG  870

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  871  GILPYVIRNLIEQ  883



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   375 bits (964),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKLYVFDAAMRYK
Sbjct  798  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYK  857

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  858  DAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  917

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPSKI+DIRPGQDVTV TD GK FTCT RFDTEVELAYFN+G
Sbjct  918  GEDADTLGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNG  977

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  978  GILPYVIRNLIKQ  990



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  706  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  DAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT RFDTEVELAYFN+G
Sbjct  826  GEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  886  GILPYVIRNLIKQ  898



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   375 bits (962),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  787  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  846

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC+K 
Sbjct  847  TSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKP  906

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+TIDLPSKIS+I+PGQDV V TD+GK FTC ARFDTEVELAYFNHG
Sbjct  907  GEDADTLGLTGHERFTIDLPSKISEIKPGQDVKVTTDSGKSFTCIARFDTEVELAYFNHG  966

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  967  GILPYVIRNLIKQ  979



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   374 bits (961),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+P+GEKL VFDAAM+YK
Sbjct  798  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYK  857

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  858  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  917

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD+GK F CT RFDTEVELAYFNHG
Sbjct  918  GEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDSGKSFVCTVRFDTEVELAYFNHG  977

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  978  GILPYVIRNLSKQ  990



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   374 bits (960),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  781  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  840

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  841  DAGHDTIVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  900

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV TD GK FTCT RFDTEVELAYFN+G
Sbjct  901  GEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNG  960

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  961  GILPYVIRNLIKQ  973



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   374 bits (959),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  793  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  852

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  853  DAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  912

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT RFDTEVELAYFN+G
Sbjct  913  GEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNG  972

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  973  GILPYVIRNLIKQ  985



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   374 bits (960),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  800  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  859

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  860  DAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  919

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KISDIRPGQDVTV T+ GK FTCT RFDTEVELAYFN+G
Sbjct  920  GEDADTLGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNG  979

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  980  GILPYVIRNLIKQ  992



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D+KDFNSYGSRRGNDE+MARGTFANIR+V+KLL GEVGPKT+H+PTGEKLYV+DAAMRYK
Sbjct  225  DKKDFNSYGSRRGNDEVMARGTFANIRIVSKLLKGEVGPKTIHVPTGEKLYVYDAAMRYK  284

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT++LAGAEYGSGSSRDWAAKG MLLGVKAVI KSFERIHRSNLVGMGIIPLCFK 
Sbjct  285  AAGQDTIVLAGAEYGSGSSRDWAAKGQMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKP  344

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV T TGK FTCT RFDTEVELAYF+HG
Sbjct  345  GEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTVTGKSFTCTVRFDTEVELAYFDHG  404

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L ++
Sbjct  405  GILPFVIRNLNKE  417



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   373 bits (958),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  803  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  863  SAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  923  GEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLT+Q
Sbjct  983  GILQYVIRQLTKQ  995



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  766  SAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLT+ 
Sbjct  886  GILQYVIRQLTKH  898



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   371 bits (953),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+HIPTGEKLYVFDAA RYK
Sbjct  726  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYK  785

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  786  ASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  845

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI+LPS I++IRPGQDVTV TD GK FTCTARFDTEVELAYFNHG
Sbjct  846  GEDADTLGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHG  905

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  906  GILPYVIRNLIKQ  918



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  AAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  886  GILPYVIRNLIKQ  898



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   372 bits (956),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIPTGEKL VFDAAM+YK
Sbjct  793  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYK  852

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  853  SAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  912

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLP  IS+IRPGQDVTV+TDTGK FTC  RFDTEVELAYFNHG
Sbjct  913  GEDAETHGLTGHERYTIDLPKNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHG  972

Query  367  GILPYVIRQLTQ  332
            GILPYVIRQL Q
Sbjct  973  GILPYVIRQLIQ  984



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   372 bits (955),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVG KTVHIPTGEKLYVFDAA RYK
Sbjct  791  EQKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGAKTVHIPTGEKLYVFDAAQRYK  850

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  851  AEGKDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  910

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPSKIS+IRPGQDVTV TD GK FTCTARFDTEVELAYFNHG
Sbjct  911  GEDADTLGLTGHERYTIDLPSKISEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHG  970

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  971  GILPYVIRNLIKQ  983



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ IS ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   372 bits (954),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+HIPTGEKLYVFDAA RYK
Sbjct  792  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYK  851

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  852  ASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  911

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI+LPS I++IRPGQDVTV TD GK FTCTARFDTEVELAYFNHG
Sbjct  912  GEDADTLGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHG  971

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  972  GILPYVIRNLIKQ  984



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   372 bits (954),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTG+KLYVFDAAMRY 
Sbjct  787  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGDKLYVFDAAMRYM  846

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLC+K+
Sbjct  847  TSGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKS  906

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPSKIS+IRPGQDV V TD GK FTC  RFDTEVELAYFNHG
Sbjct  907  GEDADTLGLTGHERYTIDLPSKISEIRPGQDVKVTTDNGKSFTCIVRFDTEVELAYFNHG  966

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  967  GILPYVIRNLIKQ  979



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   372 bits (954),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  792  EQKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYK  851

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+
Sbjct  852  AEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKS  911

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T TGK FTCT RFDTEVELAYFNHG
Sbjct  912  GEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTTTGKSFTCTVRFDTEVELAYFNHG  971

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  972  GILPYVIRNLIKQ  984



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   372 bits (955),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVH+P+GEKL VFDAAM+YK
Sbjct  805  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYK  864

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  865  SAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  924

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  925  GEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHG  984

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLTQ+
Sbjct  985  GILQYVIRQLTQR  997



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   372 bits (954),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  810   DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  869

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             +AG +T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  870   AAGHETIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  929

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  930   GEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHG  989

Query  367   GILPYVIRQLTQQ  329
             GILPYVIR L +Q
Sbjct  990   GILPYVIRNLIKQ  1002



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   369 bits (948),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKTVH+PTGEKLYVFDAA++YK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  SEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L Q 
Sbjct  886  GILPYVIRNLAQN  898



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   360 bits (923),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+H+PTGEKL VFDAAMRYK
Sbjct  371  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYK  430

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  431  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  490

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  RFDTEVELAYFNHG
Sbjct  491  GEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHG  550

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  551  GILPYVIRNL  560



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   366 bits (940),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKL VFDAAM+YK
Sbjct  603  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  663  SAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  723  GEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHG  782

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L +Q
Sbjct  783  GILPFVIRNLIKQ  795



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   371 bits (952),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  804  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  864  DAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP KI +IRPGQDVTV TD GK FTCT RFDTEVELAYFN+G
Sbjct  924  GEDADTLGLTGHERYTIDLPRKIDEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNG  983

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  984  GILPYVIRNLIRQ  996



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDITKLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   371 bits (953),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVH+PTGEKLYVFDAAM+YK
Sbjct  823   DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHVPTGEKLYVFDAAMKYK  882

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              AG  T++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMG+IPLCFKA
Sbjct  883   EAGHQTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGVIPLCFKA  942

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTGHERYTIDLPSK+S+IRPGQD+TV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  943   GEDADTLGLTGHERYTIDLPSKVSEIRPGQDITVTTDTGKSFTCTLRFDTEVELAYFDHG  1002

Query  367   GILPYVIRQLTQQ  329
             GILPYVIRQL + 
Sbjct  1003  GILPYVIRQLMKN  1015



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   370 bits (951),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYVFDAAMRYK
Sbjct  805  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYK  864

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT++LAG EYGSGSSRDWAAKGPMLLGV+AVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  865  TAGQDTIVLAGTEYGSGSSRDWAAKGPMLLGVQAVIAKSFERIHRSNLVGMGIIPLCFKP  924

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTIDLPSKIS+IRPGQDVTV TDTGK FTCT RFDTEVEL YFN+G
Sbjct  925  GEDAETLGLTGHERYTIDLPSKISEIRPGQDVTVVTDTGKSFTCTVRFDTEVELEYFNNG  984

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L + 
Sbjct  985  GILPYVIRNLMKH  997



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  706  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  886  GILPYVIRNLSKQ  898



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGII LCFK 
Sbjct  766  AAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIILLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGL GHERYTI+LP+K+S+IRPGQD+TV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  886  GILPYVIRNLIKQ  898



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY 
Sbjct  711  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYM  770

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  771  ASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  830

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERY+IDLPSKIS+IRPGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  831  GEDADTLGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHG  890

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  891  GILPYVIRNLIKQ  903



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   370 bits (950),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  792  EQKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYK  851

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+
Sbjct  852  AEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKS  911

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T+TGK FTCT RFDTEVELAYFN+G
Sbjct  912  GEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNG  971

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  972  GILPYVIRNLIKQ  984



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   370 bits (949),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  792  EQKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYK  851

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+
Sbjct  852  AEGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKS  911

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+IRPGQDVTV T+TGK FTCT RFDTEVELAYFN+G
Sbjct  912  GEDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNG  971

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  972  GILPYVIRNLIKQ  984



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAA+RYK
Sbjct  371  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAIRYK  430

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  431  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  490

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERY+IDLP+ I+ ++PGQD+TV TDTGK FTC ARFDT+VEL YFNHG
Sbjct  491  GEDAESLGLTGHERYSIDLPNDIAQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHG  550

Query  367  GILPYVIRQL  338
            GILPYVIRQL
Sbjct  551  GILPYVIRQL  560



>ref|XP_006828850.1| PREDICTED: aconitate hydratase, cytoplasmic [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   369 bits (948),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRY 
Sbjct  783  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYN  842

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  843  TQGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  902

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+GK FTCTARFDTEVELAYF+HG
Sbjct  903  GEDADTLGLTGHERYTIDLPSTVSEIRPGQDVTVVTDSGKSFTCTARFDTEVELAYFDHG  962

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  963  GILPYVIRNL  972



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKL+NGEV PKTVHIP+GEKL VFDAAM+YK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLVNGEVAPKTVHIPSGEKLSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQ T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  766  SAGQSTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP  IS+IRPGQDVTVQTDTGK FTC  RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQLT+ 
Sbjct  886  GILQYVIRQLTKH  898



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   369 bits (946),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKTVH+PTGEKLYVFDAA++YK
Sbjct  764  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYK  823

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  824  SEGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  883

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP+ +S+IRPGQD+TV TD GK FTCT RFDTEVELAYFNHG
Sbjct  884  GEDADSLGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHG  943

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L Q 
Sbjct  944  GILPYVIRNLAQN  956



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT++IPTGEKL V+DAAMRYK
Sbjct  177  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIYIPTGEKLSVYDAAMRYK  236

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGIIPLCFK+
Sbjct  237  SAGHDTIVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKS  296

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTGHERYTID+P+ IS ++PGQD+TV TDTGK FTC ARFDT+VEL YFNH 
Sbjct  297  GEDAESLGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHA  356

Query  367  GILPYVIRQL  338
            GILPYV+RQL
Sbjct  357  GILPYVMRQL  366



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   348 bits (893),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK
Sbjct  95   ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYK  154

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLC+KA
Sbjct  155  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKA  214

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY++HG
Sbjct  215  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHG  274

Query  367  GILPYVIRQLTQQ  329
            GILPYV R++ +Q
Sbjct  275  GILPYVARKIAEQ  287



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   369 bits (948),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  803  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTVHIPSGEKLSVFDAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  863  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  923  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  983  GILPYVIRNLSKQ  995



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   369 bits (947),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  804  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  864  ADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  924  GEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  983

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  984  GILHYVIRNLSKQ  996



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   369 bits (947),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  802  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  862  ADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  922  GEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  981

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  982  GILHYVIRNLSKQ  994



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   369 bits (946),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY 
Sbjct  787  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYM  846

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++GQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  847  ASGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  906

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERY+IDLPSKIS+IRPGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  907  GEDADTLGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHG  966

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  967  GILPYVIRNLIKQ  979



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   369 bits (947),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  801  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  860

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  861  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  920

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI+LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  921  GEDADTLGLTGHERYTINLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  980

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  981  GILPYVIRNLSKQ  993



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   369 bits (946),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  799  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  859  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  919  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  978

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  979  GILPYVIRNLSKQ  991



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   369 bits (946),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  802  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  862  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  922  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  981

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  982  GILPYVIRNLSKQ  994



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   369 bits (946),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  799  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  859  SAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  919  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  978

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  979  GILPYVIRNLSKQ  991



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKLLNGEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  794  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMRYK  853

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  854  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  913

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  914  GEDADTLGLTGHERYTIHLPTNISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  973

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  974  GILPYVIRNLSKQ  986



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  798  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  857

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  858  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  917

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  918  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  977

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  978  GILPYVIRNLSKQ  990



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   368 bits (945),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  806  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYK  865

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDTVILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  866  SAGQDTVILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  925

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ I +IRPGQDVTV TD GK FTCT RFDTEVELAY+NHG
Sbjct  926  GEDADTLGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHG  985

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  986  GILPYVIRNLSKQ  998



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYK
Sbjct  243  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDAAMRYK  302

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGIIPLCFK 
Sbjct  303  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKP  362

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP+ +SDI+PGQDVTV TD GK F CT RFDTEVELAY+NHG
Sbjct  363  GEDAETLGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHG  422

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  423  GILPFVIRNL  432



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   366 bits (939),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKL VFDAAM+YK
Sbjct  706  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  SAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L +Q
Sbjct  886  GILPFVIRNLIKQ  898



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   368 bits (944),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  794  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  853

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  854  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  913

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  914  GEDADSLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  973

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  974  GILPYVIRNLSKQ  986



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   368 bits (944),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+H+PTGEKL VFDAAM+YK
Sbjct  795  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYK  854

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +A Q T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  855  TANQGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  914

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS I +IRPGQD+TV T+TGK F CTARFDTEVELAYFNHG
Sbjct  915  GEDADTLGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHG  974

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  975  GILPYVIRNLIKQ  987



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   368 bits (944),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  799  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  859  SAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+I+PGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  919  GEDADTLGLTGHERYTIHLPTDISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  978

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  979  GILPYVIRNLSKQ  991



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL+VFDAA RYK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  ADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  826  GEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  886  GILQYVIRNLSKQ  898



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   367 bits (943),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D+KDFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+H+PTGEKLYV+DAAMRYK
Sbjct  801  DKKDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTIHVPTGEKLYVYDAAMRYK  860

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT++LAGAEYGSGSSRDWAAKGPML+GVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  861  AAGQDTIVLAGAEYGSGSSRDWAAKGPMLVGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  920

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  921  GEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHG  980

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L ++
Sbjct  981  GILPFVIRNLNKE  993



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   367 bits (943),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNK LNGEVGPKTVHIPTGEKL V+DAAMRYK
Sbjct  803  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  863  NAGLDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGLTGHERYTIDLPS IS+IRPGQDVTV TD GK FTCTARFDT VEL YFNHG
Sbjct  923  GQDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTARFDTAVELEYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GILPY IR L +Q
Sbjct  983  GILPYAIRSLMKQ  995



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   367 bits (943),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL+VFDAA RYK
Sbjct  800  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLFVFDAATRYK  859

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  860  ADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  919

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  920  GEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKAFTCTVRFDTEVELEYFNHG  979

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  980  GILQYVIRNLSKQ  992



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   367 bits (943),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  803  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  863  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK F+CT RFDTEVELAYFNHG
Sbjct  923  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFSCTVRFDTEVELAYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  983  GILPYVIRNLSKQ  995



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   367 bits (943),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             +RKDFNSYGSRRGNDEIMARGTFANIRLVNKL + + GPKT+HIPTGEKLYVFDAAMRYK
Sbjct  818   ERKDFNSYGSRRGNDEIMARGTFANIRLVNKLCSKD-GPKTIHIPTGEKLYVFDAAMRYK  876

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  877   ADGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  936

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTGHERYTIDLPSKI +IRPGQDVTV TDTGK FTCTARFDTEVELAYFNHG
Sbjct  937   GEDADTLGLTGHERYTIDLPSKIDEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHG  996

Query  367   GILPYVIRQLTQQ  329
             GILPYV+RQLT+Q
Sbjct  997   GILPYVVRQLTKQ  1009



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   367 bits (942),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNK LNGEVGPKTVHIPTGEKL V+DAAMRYK
Sbjct  803  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  863  NAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGLTGHERYTIDLPS IS+IRPGQDVTV TD GK FTCT RFDT VEL YFNHG
Sbjct  923  GQDADTLGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTVRFDTAVELEYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GILPY IR L +Q
Sbjct  983  GILPYAIRNLMKQ  995



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   367 bits (942),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIRLVNK LNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  809   DRKDFNSYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLYVFDAAMRYK  868

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             SAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  869   SAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  928

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             G+DADTLGLTGHERY+IDLPS I +IRPGQDVTV TD GK F CT RFDTEVELAYFNHG
Sbjct  929   GQDADTLGLTGHERYSIDLPSNIDEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHG  988

Query  367   GILPYVIRQLTQQ  329
             GIL Y IR L +Q
Sbjct  989   GILQYAIRNLMKQ  1001



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   367 bits (942),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKL VFDAAM+YK
Sbjct  804  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  864  SAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  924  GEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHG  983

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L +Q
Sbjct  984  GILPFVIRNLIKQ  996



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   367 bits (941),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK
Sbjct  807  DPKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  866

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  867  SAGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKD  926

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGLTGHERY+IDLPS I +IRPGQDVTV TD GK F CT RFDTEVELAYFNHG
Sbjct  927  GQDADTLGLTGHERYSIDLPSNIGEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHG  986

Query  367  GILPYVIRQLTQQ  329
            GILPY IR L +Q
Sbjct  987  GILPYAIRNLMKQ  999



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   366 bits (940),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL VFDAAMRYK
Sbjct  785  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMRYK  844

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  845  AAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  904

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT RFDTEVELAYFNHG
Sbjct  905  GEDADTLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHG  964

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  965  GILPYVIRNLSKQ  977



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   364 bits (935),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  TAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   366 bits (940),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  799  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSS DWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  859  SSGEDTIILAGAEYGSGSSSDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  919  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  978

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  979  GILPYVIRNLSKQ  991



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   366 bits (940),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKL VFDAAM+YK
Sbjct  808  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYK  867

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  868  SAGHGTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  927

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  928  GEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHG  987

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L +Q
Sbjct  988  GILPFVIRNLIKQ  1000



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   366 bits (940),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL+VFDAA RYK
Sbjct  802  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  862  ADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  922  GEDADTLGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHG  981

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  982  GILQYVIRNLSKQ  994



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   364 bits (934),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VF+AA +YK
Sbjct  706  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLDGEVGPKTVHVPTGEKLSVFEAAEKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  SAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLP  IS IRPGQDVTV TD+GK FTCT RFDTEVELAYFN+G
Sbjct  826  GEDADSLGLTGHERYTIDLPDDISKIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNNG  885

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  886  GILPYVIRNLIKQ  898



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   366 bits (939),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKLYVF+AAMRYK
Sbjct  803  EHKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFEAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  863  AAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS I+ IRPGQDV+V T+ GK FTCT RFDTEVELAYFN+G
Sbjct  923  GEDADTLGLTGHERYTIDLPSNITHIRPGQDVSVTTNNGKSFTCTVRFDTEVELAYFNNG  982

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  983  GILPYVIRNLIKQ  995



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   366 bits (939),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIP+GEKL+VFDAA RYK
Sbjct  802  DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  862  ADGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS IS+I+PGQDVTV TD GK FTCT RFDTEVEL YFNHG
Sbjct  922  GEDADTLGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHG  981

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L++Q
Sbjct  982  GILQYVIRNLSKQ  994



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   366 bits (940),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYV+DAAMRYK
Sbjct  818   DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVYDAAMRYK  877

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             S+GQDT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  878   SSGQDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGILPLCFKA  937

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDA+TLGLTGHERYTIDLP K SDI+PGQD+TV TD GK FTCT RFDTEVEL YF+HG
Sbjct  938   GEDAETLGLTGHERYTIDLPEKTSDIKPGQDITVTTDNGKSFTCTLRFDTEVELTYFDHG  997

Query  367   GILPYVIRQLTQQ  329
             GIL YVIR L++Q
Sbjct  998   GILQYVIRNLSKQ  1010



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   365 bits (938),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDE+M+RGTFANIR+VNKLLNGEVGPKTVHIPTGEKLYVFDAA RYK
Sbjct  787  EKKDFNSYGSRRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYK  846

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            ++G  T++LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  847  ASGHATIVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKS  906

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+KIS+I+PGQDVTV TDTGK FTCTARFDTEVEL YFNHG
Sbjct  907  GEDADTLGLTGHERYTIDLPNKISEIKPGQDVTVTTDTGKSFTCTARFDTEVELEYFNHG  966

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L ++
Sbjct  967  GILPYVIRNLIKK  979



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   365 bits (938),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  802  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  862  SAGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+IRPGQDV+V TD GK F CT RFDTEVELAYFNHG
Sbjct  922  GEDADTLGLTGHERYTIHLPTDISEIRPGQDVSVTTDNGKSFNCTVRFDTEVELAYFNHG  981

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  982  GILPYVIRNLSKQ  994



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   365 bits (938),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAA RY 
Sbjct  804  DRQDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAASRYM  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  864  AAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGL+GHERYTIDLPS IS+I+PGQDVTV TD GK FTCTARFDTEVEL YFNHG
Sbjct  924  GQDADTLGLSGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHG  983

Query  367  GILPYVIRQLTQ  332
            GILPYVIR L +
Sbjct  984  GILPYVIRNLMK  995



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+H+PTGEKL VFDAAMRYK
Sbjct  603  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  663  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  RFDTEVELAYFNHG
Sbjct  723  GEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHG  782

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  783  GILPYVIRNL  792



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   365 bits (937),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNK LNGEVGPKT+H+PTGEKLYVFDAAMRYK
Sbjct  802  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLYVFDAAMRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  862  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  922  GEDADSLGLTGHERYSIDLPANLSEIRPGQDVTVITDNGKSFTCTLRFDTEVELAYFNHG  981

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  982  GILPYVIRNL  991



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   365 bits (937),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  901   KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
             KDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYVFDAAMRYK+ 
Sbjct  819   KDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKAD  878

Query  721   GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
             G DT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE
Sbjct  879   GHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  938

Query  541   DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
             DADTLGLTGHERY IDLPSKIS+IRPGQDVTV TD GK FTCT RFDTEVEL YFNHGGI
Sbjct  939   DADTLGLTGHERYNIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGI  998

Query  361   LPYVIRQLTQQ  329
             LPY IR L  Q
Sbjct  999   LPYAIRNLINQ  1009



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  371  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  430

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  431  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  490

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  491  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  550

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  551  GILQYVIRNL  560



>ref|XP_011620315.1| PREDICTED: aconitate hydratase, cytoplasmic [Amborella trichopoda]
Length=997

 Score =   364 bits (935),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+H+PTGE+LYVFDAAMRYK
Sbjct  802  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHVPTGEELYVFDAAMRYK  861

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  862  EDGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  921

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI+LPS IS+IRPGQD++V TD+GK FTCTARFDTEVELAYFNHG
Sbjct  922  GEDADTLGLTGHERYTINLPSNISEIRPGQDISVVTDSGKSFTCTARFDTEVELAYFNHG  981

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  982  GILPFVIRNL  991



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   362 bits (930),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  TAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   365 bits (936),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYV+DAAMRYK
Sbjct  819   DRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYK  878

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             SAG DT++LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  879   SAGHDTIVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  938

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTG ERYTIDLP+K SDIRPGQD+TV TD GK FTCT RFDTEVELAYF+HG
Sbjct  939   GEDADTLGLTGQERYTIDLPTKKSDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHG  998

Query  367   GILPYVIRQLTQQ  329
             GIL YVIR L++Q
Sbjct  999   GILQYVIRNLSKQ  1011



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   364 bits (935),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D+KDFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+ +PTGEKLYV+DAAMRYK
Sbjct  801  DKKDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTILVPTGEKLYVYDAAMRYK  860

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  861  AAGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  920

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+KIS+IRPGQDVTV TDTGK FTCT RFDTEVELAYF+HG
Sbjct  921  GEDADSLGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHG  980

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L ++
Sbjct  981  GILPFVIRNLNRE  993



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   364 bits (934),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  796  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYK  855

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  856  SSGVDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  915

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+TI LP+ IS+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  916  GEDADTLGLTGHERFTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  975

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  976  GILPYVIRNLSKQ  988



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   363 bits (933),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL VFDAAM+YK
Sbjct  789  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYK  848

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  849  AAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  908

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT RFDTEVELAYFNHG
Sbjct  909  GEDADSLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHG  968

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  969  GILPYVIRNLSKQ  981



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   362 bits (930),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK
Sbjct  735  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYK  794

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  795  TAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKS  854

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +S+IRPGQDVTV TD+G+ FTCT RFDTEVELAYFNHG
Sbjct  855  GEDADTLGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHG  914

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  915  GILQYVIRNL  924



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   362 bits (928),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEK+ VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKISVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERY+I+LPS +S+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGHERYSINLPSNVSEIRPGQDVTVVTDSGKSFTCTVRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  886  GILPYVIRNL  895



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   363 bits (932),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKTVH+PTGEKL VFDAAM+YK
Sbjct  804  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAG  T+ILAGAEYGSGSSRDWAAKGPMLL +KAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  864  SAGHGTIILAGAEYGSGSSRDWAAKGPMLLVIKAVIAKSFERIHRSNLVGMGIIPLCFKA  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER++IDLPSKIS+IRPGQDVTV TD+GK FTCT RFDTEVELAYF+HG
Sbjct  924  GEDADSLGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHG  983

Query  367  GILPYVIRQLTQQ  329
            GILP+VIR L +Q
Sbjct  984  GILPFVIRNLIKQ  996



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   363 bits (932),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNKL+NGEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  803  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S+G+DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  863  SSGEDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ IS+I P QDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  923  GEDADTLGLTGHERYTIHLPTDISEISPCQDVTVTTDNGKSFTCTVRFDTEVELAYFNHG  982

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  983  GILPYVIRNLSKQ  995



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   363 bits (932),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFD AMRYK
Sbjct  816   DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDVAMRYK  875

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG+IPLCFK 
Sbjct  876   ADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKP  935

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             G+DAD+LGLTGHERYTIDLPS I++IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  936   GQDADSLGLTGHERYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHG  995

Query  367   GILPYVIRQL  338
             GILPYVIR L
Sbjct  996   GILPYVIRNL  1005



>ref|XP_012070836.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X2 [Jatropha 
curcas]
Length=798

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
             KDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYVFDAAMRYK 
Sbjct  604  HKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKE  663

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIIPLCFK G
Sbjct  664  AGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFETIHRSNLVGMGIIPLCFKPG  723

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTG+ERYTIDLP KIS+IRPGQDVTV TD G  FTC ARFDT+VELAYF+HGG
Sbjct  724  EDADTLGLTGNERYTIDLPDKISEIRPGQDVTVTTDNGNSFTCIARFDTQVELAYFDHGG  783

Query  364  ILPYVIRQLTQQ  329
            IL YVIR L ++
Sbjct  784  ILQYVIRNLIKE  795



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   362 bits (930),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + + FNSYGSRRGNDEIMARGTFANIR++NKLLNGEVGPKT+HIP+GEKL VFDAAM+YK
Sbjct  804  NSRQFNSYGSRRGNDEIMARGTFANIRILNKLLNGEVGPKTIHIPSGEKLTVFDAAMKYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            SAGQDT+ILAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK+
Sbjct  864  SAGQDTIILAGDEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKS  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +SDIRPGQD+TV+TDTGK FTCT RFDTEVELAYFNHG
Sbjct  924  GEDADTLGLTGHERYTIDLPSSVSDIRPGQDITVKTDTGKQFTCTVRFDTEVELAYFNHG  983

Query  367  GILPYVIRQLTQQ  329
            GIL YVIRQL  +
Sbjct  984  GILQYVIRQLAAK  996



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKL VFDAAM+YK
Sbjct  788  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYK  847

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG+ T+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNLVGMGIIPLCFK+
Sbjct  848  AAGEATIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKS  907

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTG ERYTI LP+ IS+IRPGQDVTV TDTGK FTCT RFDTEVELAYFNHG
Sbjct  908  GEDAESLGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHG  967

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L++Q
Sbjct  968  GILPYVIRNLSRQ  980



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   362 bits (930),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DRKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFDAAMRYK
Sbjct  815   DRKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDAAMRYK  874

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  875   ADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  934

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             G+DAD+LGLTGHE YTIDLPS I++IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  935   GQDADSLGLTGHELYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHG  994

Query  367   GILPYVIRQL  338
             GILPYVIR L
Sbjct  995   GILPYVIRSL  1004



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   361 bits (927),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+M+RGTFANIRLVNKLLNGEVG KTVH+PTGEKLYVFDAA RYK
Sbjct  793  ERKDFNSYGSRRGNDEVMSRGTFANIRLVNKLLNGEVGAKTVHVPTGEKLYVFDAAERYK  852

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AG DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  853  AAGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  912

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLP KIS+I+PGQDVTV TDTGK FTC ARFDTEVEL YFNHG
Sbjct  913  GEDADTLGLTGRERYTIDLPDKISEIKPGQDVTVTTDTGKSFTCKARFDTEVELEYFNHG  972

Query  367  GILPYVIRQLTQ  332
            GILPYVIR L +
Sbjct  973  GILPYVIRNLAK  984



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   361 bits (926),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+H+PTGEKL VFDAAMRYK
Sbjct  793  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYK  852

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  853  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  912

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERY+IDLP+ +S+IRPGQDVTV TD GK FTC  RFDTEVELAYFNHG
Sbjct  913  GEDADSLGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHG  972

Query  367  GILPYVIRQL  338
            GILPYVIR L
Sbjct  973  GILPYVIRNL  982



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   362 bits (930),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  904   RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
             RKDFNSYGSRRGND++MARGTFANIR++NKLLNGEV PKT+HIPTGEKLYV+DAAMRYKS
Sbjct  873   RKDFNSYGSRRGNDQVMARGTFANIRIINKLLNGEVSPKTIHIPTGEKLYVYDAAMRYKS  932

Query  724   AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
             AG DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK G
Sbjct  933   AGHDTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPG  992

Query  544   EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
             EDA+ LGLTGHERYTIDLP +ISDIRPGQD+TV TD+GK FTCT RFDTEVELAYF+HGG
Sbjct  993   EDAEALGLTGHERYTIDLPQRISDIRPGQDLTVTTDSGKSFTCTLRFDTEVELAYFDHGG  1052

Query  364   ILPYVIRQLTQ  332
             ILPYVIR L++
Sbjct  1053  ILPYVIRNLSK  1063



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   354 bits (908),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  508  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  567

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  568  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  627

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  628  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  687

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  688  GILQYVIRNL  697



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   359 bits (921),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIPTGEKL V+D AMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPTGEKLSVYDVAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAG EYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  AAGQDTIILAGVEYGSGSSRDWAAKGPVLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP+ +S+IRPGQDVTV TD GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDADTLGLTGHERYTIDLPNTVSEIRPGQDVTVATDCGKSFTCTVRFDTEVELAYFNHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   358 bits (918),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKTVHIP+GEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLGGEVGPKTVHIPSGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERY IDLPS +++IRPGQDVTV TD GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETFGLTGHERYNIDLPSSVAEIRPGQDVTVTTDNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQ  332
            GILP+VIR L Q
Sbjct  886  GILPFVIRNLIQ  897



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   360 bits (923),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + KDFNSYGSRRGNDE+MARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL+VFDAAMRYK
Sbjct  798  EPKDFNSYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLHVFDAAMRYK  857

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             AG++T++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHR NLVGMGIIPLCFK 
Sbjct  858  EAGENTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRGNLVGMGIIPLCFKP  917

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLP KIS+IRPGQ+V V+TDTGK F C  RFDTEVELAYF+HG
Sbjct  918  GEDADTLGLTGHERYTIDLPDKISEIRPGQEVGVKTDTGKSFACRVRFDTEVELAYFDHG  977

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L+++
Sbjct  978  GILPYVIRNLSKE  990



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   360 bits (923),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  904   RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
             RKDFNSYGSRRGNDE+MARGTFANIR++NKLLNGEVGPKT+HIP+GEKLYV+DAAMRYKS
Sbjct  826   RKDFNSYGSRRGNDEVMARGTFANIRIINKLLNGEVGPKTIHIPSGEKLYVYDAAMRYKS  885

Query  724   AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
             AG  T+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK G
Sbjct  886   AGHGTIVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPG  945

Query  544   EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
             ED +TLGLTGHERYTIDLP  ISDIRPGQD+TV TD G+ FTC  RFDTEVELAYF+HGG
Sbjct  946   EDTETLGLTGHERYTIDLPHSISDIRPGQDITVTTDNGRSFTCILRFDTEVELAYFDHGG  1005

Query  364   ILPYVIRQLTQQ  329
             ILPYVIR L++Q
Sbjct  1006  ILPYVIRNLSKQ  1017



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  603  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  663  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  723  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  782

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  783  GILQYVIRNL  792



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   351 bits (900),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK
Sbjct  493  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYK  552

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFKA
Sbjct  553  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKA  612

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY++HG
Sbjct  613  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHG  672

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  673  GILPYVIRKIAEQ  685



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   354 bits (909),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRY 
Sbjct  619  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLEGEVGPKTIHIPTGEKLSVYDAAMRYN  678

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPM+LG+KAVIAKSFE+IHRSNLVGMGIIPLCFK 
Sbjct  679  TAGQDTIILAGAEYGSGSSRDWAAKGPMMLGIKAVIAKSFEQIHRSNLVGMGIIPLCFKP  738

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DADTLGLTGHERYTI+LP+ +S+IRPGQDVTV TDT K F+CT RFDTEVELAYFNHG
Sbjct  739  GDDADTLGLTGHERYTINLPNSVSEIRPGQDVTVATDTSKSFSCTVRFDTEVELAYFNHG  798

Query  367  GILPYVIRQLT  335
            GIL YVIR L 
Sbjct  799  GILQYVIRNLV  809



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   358 bits (920),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKTVHIPTG+KLYVF+ AMRYK
Sbjct  809  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTVHIPTGDKLYVFEVAMRYK  868

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  869  ADGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  928

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTIDLPS I+DIRPGQD+TV  D GK FTCT RFDTEVELAYFNHG
Sbjct  929  GEDAETLGLTGHERYTIDLPSSITDIRPGQDITVVVDNGKSFTCTLRFDTEVELAYFNHG  988

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  989  GILPFVIRNL  998



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   358 bits (918),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            ++DFNSYGSRRGNDE+MARGTFANIR+VNKL++GEVGPKTVHIPTGEKL VFDAA RYK+
Sbjct  808  QEDFNSYGSRRGNDEVMARGTFANIRIVNKLVDGEVGPKTVHIPTGEKLSVFDAASRYKT  867

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAG
Sbjct  868  AGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAG  927

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT RFDTEVELAY++HGG
Sbjct  928  EDADTLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGG  987

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR L+ +
Sbjct  988  ILPYVIRSLSTK  999



>ref|XP_012070835.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Jatropha 
curcas]
 gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   358 bits (918),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
             KDFNSYGSRRGNDE+MARGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYVFDAAMRYK 
Sbjct  808  HKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKE  867

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIIPLCFK G
Sbjct  868  AGQDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFETIHRSNLVGMGIIPLCFKPG  927

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTG+ERYTIDLP KIS+IRPGQDVTV TD G  FTC ARFDT+VELAYF+HGG
Sbjct  928  EDADTLGLTGNERYTIDLPDKISEIRPGQDVTVTTDNGNSFTCIARFDTQVELAYFDHGG  987

Query  364  ILPYVIRQLTQQ  329
            IL YVIR L ++
Sbjct  988  ILQYVIRNLIKE  999



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            K+FNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+A
Sbjct  605  KNFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTA  664

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            GQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  665  GQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  724

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  725  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  784

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  785  LPYVIRSLSTK  795



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   349 bits (895),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK
Sbjct  493  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYK  552

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLC+KA
Sbjct  553  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKA  612

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY++HG
Sbjct  613  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHG  672

Query  367  GILPYVIRQLTQQ  329
            GILPYV R++ +Q
Sbjct  673  GILPYVARKIAEQ  685



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+H+P+GEKL VFDAA +YK
Sbjct  603  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  663  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +++IRPGQD+TV TD GK F+CT RFDTEVELAYFNHG
Sbjct  723  GEDADTLGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHG  782

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  783  GILQYAIRNL  792



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   354 bits (909),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  826  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   354 bits (909),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L   
Sbjct  886  GILQYVIRNLIHS  898



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   354 bits (909),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  704  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  763

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  764  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  823

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  824  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  883

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  884  GILQYVIRNL  893



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   354 bits (908),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  687  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  746

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  747  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  806

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  807  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  866

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  867  GILQYVIRNL  876



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   354 bits (908),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  695  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  754

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  755  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  814

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  815  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  874

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  875  GILQYVIRNL  884



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   354 bits (909),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  826  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   354 bits (908),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLPS +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  826  GEDAETHGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   353 bits (906),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  687  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYK  746

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  747  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  806

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  RFDTEVELAYF+HG
Sbjct  807  GEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHG  866

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L   
Sbjct  867  GILQYVIRNLIHS  879



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   354 bits (908),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DA+TLGLTGHERYTIDLPS +S+I+PGQD+TV TD GK FTCT RFDTEVELAYF+HG
Sbjct  826  GQDAETLGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  886  GILQYAIRNL  895



>ref|XP_004134842.1| PREDICTED: aconitate hydratase [Cucumis sativus]
Length=900

 Score =   353 bits (907),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  766  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER+TIDLPS + +IRPGQDV V TDTGK F+C  RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L   
Sbjct  886  GILQYVIRNLIHS  898



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   353 bits (907),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYK
Sbjct  724  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYK  783

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  784  SEGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  843

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DA+TLGLTGHERYTIDLPS +S+I+PGQD+TV TD GK FTCT RFDTEVELAYF+HG
Sbjct  844  GQDAETLGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHG  903

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  904  GILQYAIRNL  913



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   355 bits (911),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAA+RYK
Sbjct  798  ERRDFNSYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAALRYK  857

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  858  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  917

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LPS +SDI+PGQDVTV TD GK FTC  RFDTEVELAY+NHG
Sbjct  918  GEDAETLGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHG  977

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  978  GILPFVIRNL  987



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   355 bits (910),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTG+KLYVF+AAMRYK
Sbjct  799  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGDKLYVFEAAMRYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  859  ADGYDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG+E YTIDLPS ISDIRPGQD+TV TD+GK FTCT RFDTEVELAYFNHG
Sbjct  919  GEDAETLGLTGYESYTIDLPSCISDIRPGQDITVVTDSGKSFTCTLRFDTEVELAYFNHG  978

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  979  GILPFVIRNL  988



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   350 bits (897),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  587  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  646

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  647  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  706

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  707  GEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  766

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  767  GILQYVIRNLIKS  779



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   353 bits (905),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+T GLTGHERYTIDLP+ +S+IRPGQDV V TD+GK FTC  RFDTEVELAYF+HG
Sbjct  826  GEDAETHGLTGHERYTIDLPNSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  603  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  663  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  723  GEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  782

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  783  GILQYVIRNLIKS  795



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   354 bits (909),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+HIPTGEKL VFDAA+RYK
Sbjct  803  ERKDFNSYGSRRGNDEVMARGTFANIRIVNKFLKGEVGPKTIHIPTGEKLSVFDAAVRYK  862

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  863  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  922

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LPS +SDI+PGQDVTV TD GK FTC  RFDTEVELAY+NHG
Sbjct  923  GEDAETLGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHG  982

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  983  GILPFVIRNL  992



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  603  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  663  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  723  GEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  782

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  783  GILQYVIRNLIKS  795



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   354 bits (909),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            + DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY +
Sbjct  804  QTDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMN  863

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAG
Sbjct  864  AGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAG  923

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT RFDTEVELAY++HGG
Sbjct  924  EDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGG  983

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR L+ +
Sbjct  984  ILPYVIRSLSAK  995



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   354 bits (909),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            + DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY +
Sbjct  804  QTDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMN  863

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAG
Sbjct  864  AGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAG  923

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT RFDTEVELAY++HGG
Sbjct  924  EDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGG  983

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR L+ +
Sbjct  984  ILPYVIRSLSAK  995



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   354 bits (908),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            R+DFNSYGSRRGNDE+M RGTFANIR+VNKLLNGEVGPKT+HIPTGEKLYV+DAAMRYKS
Sbjct  789  RRDFNSYGSRRGNDEVMTRGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKS  848

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
             G DT+++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG+IPL FK G
Sbjct  849  EGHDTIVVAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGLIPLSFKHG  908

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDA+TLGLTGHE YTIDLP KISDIRPGQDV V TD+GK F CT RFDTEVEL YF HGG
Sbjct  909  EDAETLGLTGHECYTIDLPQKISDIRPGQDVAVTTDSGKSFICTLRFDTEVELTYFEHGG  968

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR LT+Q
Sbjct  969  ILPYVIRNLTKQ  980



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFICTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  886  GILQYVIRNLIK  897



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+H+P+GEKL VFDAA +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  767  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTIDLPS +++IRPGQD+TV TD GK F+CT RFDTEVELAYFNHG
Sbjct  827  GEDADTLGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  887  GILQYAIRNL  896



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   354 bits (908),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYK
Sbjct  801  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEAGPKTIHIPSGEKLSVFDAAMRYK  860

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S   DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  861  SEEHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  920

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP  +SDI+PGQDVTV TD GK FTCT RFDTEVELAY+NHG
Sbjct  921  GEDAETLGLTGHERYTINLPDNVSDIKPGQDVTVVTDNGKSFTCTVRFDTEVELAYYNHG  980

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  981  GILPFVIRNL  990



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   353 bits (907),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK
Sbjct  794  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYK  853

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFKA
Sbjct  854  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKA  913

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ +S+I+PGQDVTV TDTGK FTCT RFDTEVELAY++HG
Sbjct  914  GEDADTLGLTGHERYTIHLPTNVSEIKPGQDVTVTTDTGKSFTCTLRFDTEVELAYYDHG  973

Query  367  GILPYVIRQLTQQ  329
            GILPYV R++ +Q
Sbjct  974  GILPYVTRKIAEQ  986



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   351 bits (901),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI+LPS +S+IRPGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  886  GILQYVIRNLIKS  898



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   353 bits (905),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D KDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIP+GEKL VFD AMRYK
Sbjct  783  DPKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPSGEKLSVFDTAMRYK  842

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGI+PLCFK 
Sbjct  843  DEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKP  902

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI+LPS +SDI+PGQDVTV TDTGK FTCT RFDTEVELAY+ HG
Sbjct  903  GEDADTLGLTGHERYTINLPSNVSDIKPGQDVTVTTDTGKLFTCTVRFDTEVELAYYGHG  962

Query  367  GILPYVIRQL  338
            GILPYV+R L
Sbjct  963  GILPYVVRSL  972



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   353 bits (906),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            + DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY +
Sbjct  804  QTDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMN  863

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRSNL GMGIIPLCFKAG
Sbjct  864  AGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAG  923

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTGHERYT+ LP+K+SDI+PGQDVTV TDTGK F CT RFDTEVELAY++HGG
Sbjct  924  EDADTLGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGG  983

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR L+ +
Sbjct  984  ILPYVIRSLSAK  995



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   350 bits (899),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYK
Sbjct  706  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  886  GILQYVIRNLIKS  898



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   353 bits (905),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D ++FNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA RY 
Sbjct  807  DSENFNSYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASRYM  866

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFERIHRSNL GMGIIPLCFKA
Sbjct  867  NAGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKA  926

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYT+ LP+K+S+IRPGQDVTV TDTGK F CT RFDTEVELAY++HG
Sbjct  927  GEDAETLGLTGHERYTVHLPTKVSEIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHG  986

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L+ +
Sbjct  987  GILPYVIRSLSTK  999



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   350 bits (899),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYK
Sbjct  706  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTIDLPS +S+IRPGQD+TV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADSLGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  886  GILQYVIRNLIKS  898



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   352 bits (902),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            ++DFNSYGSRRGNDE+MARGTFA+IR+VNKL +GEVGPKTVHIPTGEKL VFDAA RYK+
Sbjct  771  QEDFNSYGSRRGNDEVMARGTFASIRIVNKLADGEVGPKTVHIPTGEKLTVFDAASRYKT  830

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
            AGQDTVILAGAEYGSGSSRDWAAKGP+LLGVKAV AKSFERIHRSNL GMGIIPLCFKAG
Sbjct  831  AGQDTVILAGAEYGSGSSRDWAAKGPLLLGVKAVTAKSFERIHRSNLAGMGIIPLCFKAG  890

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDADTLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT RFDTEVELAY++HGG
Sbjct  891  EDADTLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGG  950

Query  364  ILPYVIRQLTQQ  329
            ILPYVIR L+ +
Sbjct  951  ILPYVIRSLSTK  962



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   349 bits (896),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YK
Sbjct  664  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYK  723

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  724  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  783

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTI+LP+ +S+IRPGQDVT+ TD  K FTC  RFDTEVELAY+NHG
Sbjct  784  GEDADSLGLTGHERYTINLPTDVSEIRPGQDVTISTDNDKSFTCILRFDTEVELAYYNHG  843

Query  367  GILPYVIRQL  338
            GILPYVIR +
Sbjct  844  GILPYVIRNM  853



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   352 bits (904),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            ++FNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+A
Sbjct  808  ENFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTA  867

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            GQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  868  GQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  927

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  928  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  987

Query  361  LPYVIRQLT  335
            LPYVIR L+
Sbjct  988  LPYVIRSLS  996



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   351 bits (901),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            +DFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+A
Sbjct  805  EDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTA  864

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
             QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFK+GE
Sbjct  865  EQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGE  924

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TDTGK F CT RFDTEVELAY++HGGI
Sbjct  925  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGI  984

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  985  LPYVIRSLSAK  995



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   351 bits (900),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK
Sbjct  797  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYK  856

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFKA
Sbjct  857  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKA  916

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY++HG
Sbjct  917  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHG  976

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  977  GILPYVIRKIAEQ  989



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   351 bits (900),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDA MRYK
Sbjct  804  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDATMRYK  863

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGIIPLCFK 
Sbjct  864  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKP  923

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP+ +SDI+PGQDVTV TD GK F CT RFDTEVELAY+NHG
Sbjct  924  GEDAETLGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHG  983

Query  367  GILPYVIRQL  338
            GILP+VIR L
Sbjct  984  GILPFVIRNL  993



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   348 bits (894),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  710  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  769

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  770  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  829

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  830  GEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  889

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  890  GILQYVIRNLIK  901



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   350 bits (899),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAA RYK
Sbjct  793  DRKDFNSYGSRRGNDEIMARGTFANIRIVNKFLGGEVGPKTIHVPSGEKLSVFDAATRYK  852

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLC+K 
Sbjct  853  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCYKT  912

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHER+TI+LP+ +S IRPGQDVT+ TD GK F+CT RFDTEVELAY+NHG
Sbjct  913  GEDADSLGLTGHERFTINLPTDVSKIRPGQDVTITTDNGKSFSCTLRFDTEVELAYYNHG  972

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L  Q
Sbjct  973  GILPYVIRSLAGQ  985



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   350 bits (899),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK
Sbjct  799  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYK  858

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFKA
Sbjct  859  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKA  918

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY++HG
Sbjct  919  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHG  978

Query  367  GILPYVIRQLTQQ  329
            GILPYV R++ +Q
Sbjct  979  GILPYVTRKIAEQ  991



>ref|XP_012088458.1| PREDICTED: aconitate hydratase 1 [Jatropha curcas]
 gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   348 bits (894),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +R+DFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFD AM+YK
Sbjct  706  NRRDFNSYGSRRGNDEVMARGTFANIRIVNKLLGGEVGPKTIHIPSGEKLSVFDVAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERY+IDLP+ +S+IRPGQDV V TD GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLTGHERYSIDLPNSVSEIRPGQDVKVLTDNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L  
Sbjct  886  GILQYVIRNLIH  897



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   348 bits (893),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  886  GILQYVIRNLIK  897



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   348 bits (893),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            +DFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+A
Sbjct  717  EDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTA  776

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
             QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  777  EQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  836

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  837  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  896

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  897  LPYVIRSLSAK  907



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   345 bits (886),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYK
Sbjct  603  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYK  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  663  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT RFDTEVELAYF+HG
Sbjct  723  GEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHG  782

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  783  GILQYAIRNL  792



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   349 bits (895),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YK
Sbjct  743  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYK  802

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  803  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  862

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTI+LP+ +S+IRPGQDVT+ TD  K FTC  RFDTEVELAY+NHG
Sbjct  863  GEDADSLGLTGHERYTINLPTDVSEIRPGQDVTITTDNDKSFTCILRFDTEVELAYYNHG  922

Query  367  GILPYVIRQL  338
            GILPYVIR +
Sbjct  923  GILPYVIRNM  932



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y+
Sbjct  603  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYR  662

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  663  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  722

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  723  GEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHG  782

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  783  GILQYVIRNLIKQ  795



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   349 bits (896),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            ++FNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ 
Sbjct  807  ENFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTD  866

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            GQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  867  GQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  926

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  927  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  986

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  987  LPYVIRSLSTK  997



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   349 bits (896),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            ++FNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+A
Sbjct  805  ENFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTA  864

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            GQDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  865  GQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  924

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA++LGLTGHERYT+ LP+K+S+IRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  925  DAESLGLTGHERYTVHLPTKVSEIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  984

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  985  LPYVIRSLSTK  995



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   349 bits (896),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK
Sbjct  801  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYK  860

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFKA
Sbjct  861  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKA  920

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+TI LP+ +SDI+PGQDVTV TD GK FTCT RFDTEVELAY+ +G
Sbjct  921  GEDADTLGLTGHERFTIQLPTNVSDIKPGQDVTVTTDAGKSFTCTLRFDTEVELAYYTNG  980

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++  +
Sbjct  981  GILPYVIRKIAAE  993



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK
Sbjct  667  ERKDFNSYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYK  726

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKA
Sbjct  727  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKA  786

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT RFDTEVELAY+ HG
Sbjct  787  GEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHG  846

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++  +
Sbjct  847  GILPYVIRKIAAE  859



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRY+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTG ERYTIDLPS + +I+PGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDADTLGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  886  GILQYVIRNLIK  897



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   348 bits (894),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DRKDFNSYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA++YK
Sbjct  790  DRKDFNSYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAALKYK  849

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIP+CFKA
Sbjct  850  SEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPMCFKA  909

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTI+LP+ +  IRPGQDVT+ T+ GK FTC  RFDTEVELAY+NHG
Sbjct  910  GEDADSLGLTGHERYTINLPTDVGQIRPGQDVTITTEDGKSFTCILRFDTEVELAYYNHG  969

Query  367  GILPYVIRQL  338
            GILPYVIR +
Sbjct  970  GILPYVIRNM  979



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   348 bits (894),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            KDFNSYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+H+P+GEKL  FDAA RYKS 
Sbjct  794  KDFNSYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLSAFDAATRYKSE  853

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            G DT++LAG EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK+GE
Sbjct  854  GHDTIVLAGEEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGE  913

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYTI LPS +SDI+PGQDVTV TDTGK FTCT RFDTEVELAY+NHGGI
Sbjct  914  DAETLGLTGHERYTIHLPSNVSDIKPGQDVTVTTDTGKSFTCTVRFDTEVELAYYNHGGI  973

Query  361  LPYVIRQLTQ  332
            LPYVIR L +
Sbjct  974  LPYVIRSLIK  983



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   348 bits (894),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            +DFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+A
Sbjct  805  EDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTA  864

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
             QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFERIHRSNL GMGIIPLCFKAGE
Sbjct  865  EQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGE  924

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  925  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  984

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  985  LPYVIRSLSAK  995



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   345 bits (886),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  766  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  886  GILQYAIRNL  895



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   345 bits (886),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFD AMRYK
Sbjct  705  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDVAMRYK  764

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  765  SEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  824

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHE Y+IDLPS +S+IRPGQDVTV TD GK F CT RFDTEVELAYF+HG
Sbjct  825  GEDAETLGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFACTLRFDTEVELAYFDHG  884

Query  367  GILPYVIRQLTQ  332
            GIL Y IR L  
Sbjct  885  GILQYAIRNLIH  896



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   345 bits (886),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYK
Sbjct  704  DRRDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYK  763

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G  T+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  764  SEGHATIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  823

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERYTI+LP+ +S+IRPGQD+TV+TD GK F CT RFDTEVELAYF+HG
Sbjct  824  GEDAETLGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHG  883

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  884  GILQYAIRNL  893



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  767  NEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTGHERYTIDLPS +++IRPGQDVTV TDTGK F  T RFDTEVELAYFNHG
Sbjct  827  GEDADSLGLTGHERYTIDLPSDVNEIRPGQDVTVVTDTGKTFVSTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  887  GILQYAIRNL  896



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  714  EKKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYK  773

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFK+
Sbjct  774  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKS  833

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+T+ LP+ +SDI+PGQDVTV TD GK FTCT RFDTEVELAY+++G
Sbjct  834  GEDADTLGLTGHERFTVHLPANVSDIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNG  893

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  894  GILPYVIRKIAEQ  906



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   345 bits (885),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFDAAMR K
Sbjct  705  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDAAMRCK  764

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  765  SEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  824

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHE Y+IDLPS +S+IRPGQDVTV TD GK FTCT RFDTEVELAYF+HG
Sbjct  825  GEDAETLGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFTCTLRFDTEVELAYFDHG  884

Query  367  GILPYVIRQLTQ  332
            GIL Y IR L  
Sbjct  885  GILQYAIRNLIH  896



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTIDLP+ +S+I+PGQD+TV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDAETLGLTGQELYTIDLPNNVSEIKPGQDITVVTNNGKSFTCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  715  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYK  774

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFK+
Sbjct  775  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKS  834

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY+++G
Sbjct  835  GEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNG  894

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  895  GILPYVIRKIAEQ  907



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   345 bits (886),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 179/210 (85%), Gaps = 17/210 (8%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAM---  737
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL VFD AM   
Sbjct  766  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVFDTAMVDC  825

Query  736  --------------RYKSAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERI  599
                          RYKS G DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERI
Sbjct  826  ISIDCLKLYVWLLQRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERI  885

Query  598  HRSNLVGMGIIPLCFKAGEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFT  419
            HRSNLVGMG+IPLCFK GEDA+TLGLTGHERYTIDLPS +S+I+PGQDVT+ TD GK FT
Sbjct  886  HRSNLVGMGVIPLCFKPGEDAETLGLTGHERYTIDLPSSVSEIKPGQDVTMVTDDGKSFT  945

Query  418  CTARFDTEVELAYFNHGGILPYVIRQLTQQ  329
            CT RFDTEVELAYF+HGGILPYVIR L + 
Sbjct  946  CTLRFDTEVELAYFDHGGILPYVIRNLIKS  975



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   344 bits (882),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   344 bits (882),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  767  SEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DAD+LGLTGHERYTIDLPS +++IRPGQDVTV TD GK F  T RFDTEVELAYFNHG
Sbjct  827  GDDADSLGLTGHERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQLTQ  332
            GIL YVIR +  
Sbjct  887  GILQYVIRNMVN  898



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   343 bits (881),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+K+S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  709  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  768

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  769  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  828

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  829  GEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHG  888

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  889  GILQYVIRNLIKQ  901



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   343 bits (881),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+HIP+GEKL VFD A +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  767  SEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTIDLPS +++IRPGQDVTV TDTGK F  T RFDTEVELAYFNHG
Sbjct  827  GEDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  887  GILQYVIRNL  896



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   345 bits (886),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            +DFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+A
Sbjct  805  EDFNSYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTA  864

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
             QDT+ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSF RIHRSNL GMGIIPLCFKAGE
Sbjct  865  EQDTIILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFGRIHRSNLAGMGIIPLCFKAGE  924

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DA+TLGLTGHERYT+ LP+K+SDIRPGQDVTV TD+GK F CT RFDTEVELAY++HGGI
Sbjct  925  DAETLGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGI  984

Query  361  LPYVIRQLTQQ  329
            LPYVIR L+ +
Sbjct  985  LPYVIRSLSAK  995



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   343 bits (880),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAA++Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAALKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   345 bits (885),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  794  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYK  853

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFK+
Sbjct  854  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKS  913

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY+++G
Sbjct  914  GEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNG  973

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  974  GILPYVIRKIAEQ  986



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   345 bits (884),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  794  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYK  853

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLCFK+
Sbjct  854  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKS  913

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHER+T+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEVELAY+++G
Sbjct  914  GEDADTLGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNG  973

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++ +Q
Sbjct  974  GILPYVIRKIAEQ  986



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   343 bits (879),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGND++MARGTFANIR+VNKLL GEVGPKT+H PT EKL VFD AMRYK
Sbjct  705  DRRDFNSYGSRRGNDDVMARGTFANIRIVNKLLGGEVGPKTIHFPTREKLSVFDVAMRYK  764

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DTVILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFERIHRSNLVGMGIIPLCFK+
Sbjct  765  SEGHDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVMAKSFERIHRSNLVGMGIIPLCFKS  824

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHERY++DLPS +S+IRPGQDVTV TD GK FTCT R+DTEVELAYF+HG
Sbjct  825  GEDAETLGLTGHERYSLDLPSNVSEIRPGQDVTVVTDNGKQFTCTLRYDTEVELAYFDHG  884

Query  367  GILPYVIRQLTQ  332
            GIL Y IR L  
Sbjct  885  GILQYAIRNLIH  896



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   345 bits (885),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 1/192 (1%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             DR+DFNSYGSRRGNDE+MARGTFANIRL+NK LN +  PKT+HIPTGE+LYV+DAAMRYK
Sbjct  819   DRRDFNSYGSRRGNDEVMARGTFANIRLLNKFLNKQ-APKTIHIPTGEELYVYDAAMRYK  877

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             SAGQDT+ILAG EYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  878   SAGQDTIILAGTEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  937

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTG+ERY+IDLP K+SD+RPGQD+TV TD GK FTC  RFDT+VEL YF+HG
Sbjct  938   GEDADTLGLTGYERYSIDLPKKVSDVRPGQDITVTTDDGKSFTCVVRFDTQVELTYFDHG  997

Query  367   GILPYVIRQLTQ  332
             GILPYVIR L +
Sbjct  998   GILPYVIRNLAK  1009



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   345 bits (884),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAAM+YK
Sbjct  806  ERKDFNSYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYK  865

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFERIHRSNL GMGI+PLCFKA
Sbjct  866  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIVPLCFKA  925

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT RFDTEVE+AY+ HG
Sbjct  926  GEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVEIAYYTHG  985

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR++  +
Sbjct  986  GILPYVIRKIAAE  998



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   342 bits (878),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TL LTG E YTI+LPS +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  826  GEDAETLRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   342 bits (878),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DTVILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  766  NEGRDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVEL YFNHG
Sbjct  826  GEDAETLGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELEYFNHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  886  GILQYVIRNLIKQ  898



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -3

Query  871  GNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGQDTVILAGA  692
            GNDE+MARGTFANIR+VNK LNGEVGPKT+H+PTGEKL VFDAAMRYKS G  T+ILAGA
Sbjct  435  GNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGA  494

Query  691  EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLGLTGH  512
            EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDAD+LGLTGH
Sbjct  495  EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGH  554

Query  511  ERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGILPYVIRQL  338
            ERY+IDLP+ +S+IRPGQDVTV TD GK FTC  RFDTEVELAYFNHGGILPYVIR L
Sbjct  555  ERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNL  612



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   341 bits (875),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MA+G FA+IR+VNK+L GEVGPKT+HIPTG+KL V+DAA RYK
Sbjct  691  DRRDFNSYGSRRGNDEVMAKGAFADIRIVNKILKGEVGPKTIHIPTGDKLNVYDAATRYK  750

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT+ILAG +YGSGSSRDWAAKG MLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  751  ATGQDTIILAGEDYGSGSSRDWAAKGSMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  810

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD LGLTGHERYTIDLPSKI +IRPGQDVT+ TDTGK FTCTA FDT+VEL YF+HG
Sbjct  811  GEDADFLGLTGHERYTIDLPSKIKEIRPGQDVTITTDTGKSFTCTAWFDTKVELEYFDHG  870

Query  367  GILPYVIRQLTQ  332
            GILPYVIR L +
Sbjct  871  GILPYVIRNLNK  882



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   342 bits (877),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK
Sbjct  730  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYK  789

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  790  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  849

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TL LTG E YTI+LPS +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYFNHG
Sbjct  850  GEDAETLRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHG  909

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  910  GILQYVIRNLIKQ  922



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   342 bits (876),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+HIP+GEKL VFD A +YK
Sbjct  714  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYK  773

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAK FERIHRSNLVGMGIIPLCFK 
Sbjct  774  SEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKGFERIHRSNLVGMGIIPLCFKP  833

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTIDLPS +++IRPGQDVTV TDTGK F  T RFDTEVELAYFNHG
Sbjct  834  GEDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHG  893

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  894  GILQYVIRNL  903



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK LNGEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G D +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  767  SEGHDMIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DAD+LGLTG ERYTIDLPS +++IRPGQDVTV TD GK F  T RFDTEVELAYFNHG
Sbjct  827  GDDADSLGLTGQERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQLTQ  332
            GIL YVIR +  
Sbjct  887  GILQYVIRNMVN  898



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   342 bits (876),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  733  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  792

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  793  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  852

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FTCT RFDTEVELAYF+HG
Sbjct  853  GEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHG  912

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  913  GILQYVIRNLIKQ  925



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   340 bits (872),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+H+P+GE L VFD AM+Y 
Sbjct  706  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKLLGGEVGPKTIHVPSGETLSVFDVAMKYN  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S GQDTVILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGI+PLCFKA
Sbjct  766  SDGQDTVILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHE+Y I+LPS + +I+PGQDVTV T+ GK F+CT RFDTEVELAYFNHG
Sbjct  826  GEDAETLGLTGHEQYNIELPSNVGEIKPGQDVTVVTNNGKSFSCTLRFDTEVELAYFNHG  885

Query  367  GILPYVIRQL  338
            GIL YVIR L
Sbjct  886  GILQYVIRNL  895



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y+
Sbjct  713  DRRDFNSYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYR  772

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G+DT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  773  NEGRDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKT  832

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG E YTI+LP+ +S+I+PGQDVTV T+ GK FT T RFDTEVELAYFNHG
Sbjct  833  GEDAETLGLTGEELYTIELPNNVSEIKPGQDVTVITNNGKSFTSTLRFDTEVELAYFNHG  892

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L +Q
Sbjct  893  GILQYVIRNLIKQ  905



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   339 bits (869),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR++FNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H PTG+K+ VFDAAM+YK
Sbjct  706  DRRNFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHHPTGDKVSVFDAAMKYK  765

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G DT+ILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  766  SEGHDTIILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  825

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTG ERYTIDLPS +S+I+PGQD+TV T  GK F CT RFDTEVELAYF+HG
Sbjct  826  GEDAETLGLTGEERYTIDLPSTVSEIKPGQDITVVTSNGKSFVCTLRFDTEVELAYFDHG  885

Query  367  GILPYVIRQLTQQ  329
            GIL YVIR L + 
Sbjct  886  GILQYVIRNLIKS  898



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   338 bits (866),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIR+VNK +NGEVGPKT+HIP+GEKL VFDAA +YK
Sbjct  707  DRRDFNSYGSRRGNDEVMARGTFANIRIVNKFMNGEVGPKTIHIPSGEKLSVFDAATKYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G D +ILAGAEYGSGSSRDWAAKGP LLGVKAVI+KSFERIHRSNLVGMGIIPLCFK 
Sbjct  767  TEGHDMIILAGAEYGSGSSRDWAAKGPKLLGVKAVISKSFERIHRSNLVGMGIIPLCFKD  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGLTGHER+TIDLPS +++IRPGQD+ V TD GK F CT RFDTEVELAYFNHG
Sbjct  827  GEDAETLGLTGHERFTIDLPSNVNEIRPGQDIAVVTDNGKTFLCTLRFDTEVELAYFNHG  886

Query  367  GILPYVIRQL  338
            GIL Y IR L
Sbjct  887  GILQYAIRNL  896



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -3

Query  883  GSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGQDTVI  704
            GSRRGNDEIMARGTFANIRLVNKLLNGEVGPKT+HIPTGEKL VFDAAMRYKS G +T+I
Sbjct  1    GSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHNTII  60

Query  703  LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADTLG  524
            LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGI+PLCFK GEDA+TL 
Sbjct  61   LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDAETLS  120

Query  523  LTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELA  383
            LTGHERYTIDLPS +S+IRPGQDV+V TD GK FTCT RFDTEVELA
Sbjct  121  LTGHERYTIDLPSSVSEIRPGQDVSVVTDNGKSFTCTVRFDTEVELA  167



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   347 bits (889),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -3

Query  907   DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
             +RKDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK
Sbjct  1774  ERKDFNSYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYK  1833

Query  727   SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGI+PLCFKA
Sbjct  1834  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKA  1893

Query  547   GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
             GEDADTLGLTGHERYTI LP+ +++I+PGQDVTV TD GK FTCT RFDTEVELAY+ HG
Sbjct  1894  GEDADTLGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHG  1953

Query  367   GILPYVIRQLTQQ  329
             GILPYVIR++  +
Sbjct  1954  GILPYVIRKIAAE  1966



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   336 bits (861),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + KDFNSYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIPTG+KL+V+DAAMRYK
Sbjct  777  NHKDFNSYGSRRGNDEVMARGTFANIRIVNKLLQGEVGPKTIHIPTGDKLHVYDAAMRYK  836

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFK 
Sbjct  837  TAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKP  896

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELA  383
            GEDADTLGL+GHERY+IDLPSKIS+IRPGQDVTV TDTGK FTCT RFDTEVELA
Sbjct  897  GEDADTLGLSGHERYSIDLPSKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELA  951



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   332 bits (850),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  904  RKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKS  725
            R+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGP+T+HIPTG+KL VFDAA +YKS
Sbjct  709  RRDFNSYGSRRGNDEVMARGTFANIRLVNKLLRGEVGPETIHIPTGQKLSVFDAATKYKS  768

Query  724  AGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAG  545
             GQDT+ILAG+EYGSGSSRDWAAKGP LLGVKAVIAKSFERIHRSNLVGMGI+PLCFK G
Sbjct  769  EGQDTIILAGSEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKVG  828

Query  544  EDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGG  365
            EDA+TLGLTG E+Y ++LP++I++I+PGQDV V TD GK F CT RFDTEVELAYFNHGG
Sbjct  829  EDAETLGLTGFEQYNVELPNEINEIKPGQDVKVITDDGKSFVCTLRFDTEVELAYFNHGG  888

Query  364  ILPYVIRQL  338
            IL YVIR L
Sbjct  889  ILQYVIRNL  897



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+
Sbjct  714  EKKDFNSYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQ  773

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              G DT+ILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  774  DEGHDTIILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  833

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTG+ER+TID+PS I DI+PGQDV V+TD GK FTCT RFDT+VEL YF +G
Sbjct  834  GEDAESLGLTGYERFTIDIPSDIKDIKPGQDVVVKTDKGKSFTCTLRFDTQVELTYFENG  893

Query  367  GILPYVIRQLTQ  332
            GIL YVIRQL Q
Sbjct  894  GILHYVIRQLLQ  905



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            KDFNSYGSRRGNDE+MARGTFANIR+VN+LLNGEVGPKT+H+PT +KL+VFDAAMRYK+ 
Sbjct  785  KDFNSYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTSDKLFVFDAAMRYKAD  844

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GE
Sbjct  845  GHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGE  904

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DAD+LGLTGHERYTI LP+ +S+I+PGQDV V TDTGK FTC  R DT VELAYF+HGGI
Sbjct  905  DADSLGLTGHERYTIRLPTNVSEIQPGQDVQVVTDTGKSFTCKLRIDTLVELAYFDHGGI  964

Query  361  LPYVIRQLTQQ  329
            L YV+R L +Q
Sbjct  965  LHYVLRNLVKQ  975



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            KDFNSYGSRRGNDE+MARGTFANIR+VN+LLNGEVGPKT+H+PT EKL+VFDAAMRYK+ 
Sbjct  787  KDFNSYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKAD  846

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GE
Sbjct  847  GHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGE  906

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DAD+LGLTGHERYTI LP+ +S+I+PGQDV V +DTGK FTC  R DT VELAYF+HGGI
Sbjct  907  DADSLGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGI  966

Query  361  LPYVIRQLTQQ  329
            L YV+R L +Q
Sbjct  967  LHYVLRNLVRQ  977



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   333 bits (853),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  901  KDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSA  722
            KDFNSYGSRRGNDE+MARGTFANIR+VN+LLNGEVGPKT+H+PT EKL+VFDAAMRYK+ 
Sbjct  789  KDFNSYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKAD  848

Query  721  GQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGE  542
            G  T++LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMG++PLCFK GE
Sbjct  849  GHHTIVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGE  908

Query  541  DADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHGGI  362
            DAD+LGLTGHERYTI LP+ +S+I+PGQDV V +DTGK FTC  R DT VELAYF+HGGI
Sbjct  909  DADSLGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGI  968

Query  361  LPYVIRQLTQQ  329
            L YV+R L +Q
Sbjct  969  LHYVLRNLVRQ  979



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            ++KDFNSYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+
Sbjct  714  EKKDFNSYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQ  773

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              G DT+ILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFERIHRSNLVGMGIIPLCFK+
Sbjct  774  DEGHDTIILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKS  833

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA++LGLTG+ER+TID+PS I DI+PGQDV V+TD GK FTCT RFDT+VEL YF +G
Sbjct  834  GEDAESLGLTGYERFTIDIPSDIKDIKPGQDVLVKTDKGKSFTCTLRFDTQVELTYFENG  893

Query  367  GILPYVIRQLTQ  332
            GIL YVIRQL Q
Sbjct  894  GILHYVIRQLLQ  905



>gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+H+PTGE+LYVFDAAMRYK
Sbjct  684  ERKDFNSYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHVPTGEELYVFDAAMRYK  743

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
              G DT++LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA
Sbjct  744  EDGHDTIVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  803

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTE  395
            GEDADTLGLTGHERYTI+LPS IS+IRPGQD++V TD+GK FTCTARFDTE
Sbjct  804  GEDADTLGLTGHERYTINLPSNISEIRPGQDISVVTDSGKSFTCTARFDTE  854



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK
Sbjct  707  DRRDFNSYGSRRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYK  766

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT++LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRSNLVGMGIIPLCFK 
Sbjct  767  NEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKP  826

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGL GHERYTIDLP+K+S+++P QDV V TD GK F CT RFDTEVELAYF+HG
Sbjct  827  GEDAETLGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHG  886

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  887  GILQYVIRTLVE  898



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   327 bits (837),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK
Sbjct  734  DRRDFNSYGSRRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYK  793

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + GQDT++LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE+IHRSNLVGMGIIPLCFK 
Sbjct  794  NEGQDTIVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKP  853

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDA+TLGL GHERYTIDLP+K+S+++P QDV V TD GK F CT RFDTEVELAYF+HG
Sbjct  854  GEDAETLGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHG  913

Query  367  GILPYVIRQLTQ  332
            GIL YVIR L +
Sbjct  914  GILQYVIRTLVE  925



>gb|AES61065.2| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=895

 Score =   322 bits (825),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D KDFNSYGSRRGN E+M RGTFANIRLVNKLLNGEVGPKTVHIPTGEK+ V+DAAMRYK
Sbjct  703  DHKDFNSYGSRRGNHEVMVRGTFANIRLVNKLLNGEVGPKTVHIPTGEKMTVYDAAMRYK  762

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             A QD +ILAGA+YG+GSSRDWAAKGP+LLGVKAVIAKSFERIHRSNLVGMGIIPL FK+
Sbjct  763  EADQDAIILAGADYGTGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLVGMGIIPLRFKS  822

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DA+TL LTG ER+T+DLP +++DI PGQDV V TD+GK FTC    DT VELAY +HG
Sbjct  823  GDDAETLQLTGLERFTVDLPERVNDIEPGQDVNVTTDSGKSFTCKLCLDTRVELAYIDHG  882

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  883  GILPYVIRILIKQ  895



>ref|XP_003590814.1| Aconitate hydratase [Medicago truncatula]
Length=924

 Score =   322 bits (826),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            D KDFNSYGSRRGN E+M RGTFANIRLVNKLLNGEVGPKTVHIPTGEK+ V+DAAMRYK
Sbjct  732  DHKDFNSYGSRRGNHEVMVRGTFANIRLVNKLLNGEVGPKTVHIPTGEKMTVYDAAMRYK  791

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
             A QD +ILAGA+YG+GSSRDWAAKGP+LLGVKAVIAKSFERIHRSNLVGMGIIPL FK+
Sbjct  792  EADQDAIILAGADYGTGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLVGMGIIPLRFKS  851

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            G+DA+TL LTG ER+T+DLP +++DI PGQDV V TD+GK FTC    DT VELAY +HG
Sbjct  852  GDDAETLQLTGLERFTVDLPERVNDIEPGQDVNVTTDSGKSFTCKLCLDTRVELAYIDHG  911

Query  367  GILPYVIRQLTQQ  329
            GILPYVIR L +Q
Sbjct  912  GILPYVIRILIKQ  924



>ref|XP_009361096.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase, cytoplasmic 
[Pyrus x bretschneideri]
Length=634

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + KDFNSYGSRRGNDE+M RGTFANIR+VNK L GEVGPKT+HIPTGEKL+V+DAAM+YK
Sbjct  443  ELKDFNSYGSRRGNDEVMTRGTFANIRIVNKFLIGEVGPKTIHIPTGEKLHVYDAAMKYK  502

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +A Q T++ AGA+YGSGS+RDWAAKGPML GVKAVIAKSFERIHRSNLVGMGIIPL FK 
Sbjct  503  AAEQSTIVSAGADYGSGSARDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLSFKP  562

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDADTLGLTGH+R TI+LP  IS+I+PGQDV V TD  K FT T  FDT+VELAYF+HG
Sbjct  563  GEDADTLGLTGHKRCTIELPRDISEIKPGQDVKVTTDNAKSFTRTLCFDTKVELAYFDHG  622

Query  367  GILPYVIRQLTQ  332
            GILPYVIR + +
Sbjct  623  GILPYVIRNMIK  634



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   315 bits (807),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            +RKDFNSYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK
Sbjct  493  ERKDFNSYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYK  552

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            + G DT+ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFERIHRSNL GMGIIPLC+KA
Sbjct  553  NEGHDTIILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKA  612

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEV  392
            GEDADTLGLTGHERYT+ LP+ +S+I+PGQDVTV TD GK FTCT RFDTEV
Sbjct  613  GEDADTLGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEV  664



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 168/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            + K+F+SYG RRGN+E++ RG FAN+R+VNKLLNGE GP T+H+PTGEKLYV+DAAM+YK
Sbjct  371  EPKNFSSYGGRRGNNEVVMRGAFANMRIVNKLLNGEAGPWTIHVPTGEKLYVYDAAMKYK  430

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            S G D VI+AG+EYGSGSSRD AAKGPMLLGVK+VIAKSFERIHRSNLVGMGIIPLCF+A
Sbjct  431  SEGHDMVIIAGSEYGSGSSRDSAAKGPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQA  490

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEVELAYFNHG  368
            GEDAD+LGLTG ERYTI LP+  ++I PGQDVTV T  G+ FTCT R DT++E+ YFNHG
Sbjct  491  GEDADSLGLTGRERYTIHLPTSTAEISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHG  550

Query  367  GILPYVIRQLTQQ  329
            GILPY++R L  Q
Sbjct  551  GILPYMVRNLAAQ  563



>gb|KJB17578.1| hypothetical protein B456_003G006000 [Gossypium raimondii]
Length=896

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  907  DRKDFNSYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYK  728
            DR+DFNSYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPT EKL V+DAAMRY 
Sbjct  710  DRRDFNSYGSRRGNDEVMARGTFANIRLVNKLLEGEVGPKTIHIPTREKLSVYDAAMRYN  769

Query  727  SAGQDTVILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKA  548
            +AGQDT+ILAGAEYGSGSSRDWAAKGPM+LG+KAVIAKSFE+IHRSNLVGMGIIPLCFK 
Sbjct  770  TAGQDTIILAGAEYGSGSSRDWAAKGPMMLGIKAVIAKSFEQIHRSNLVGMGIIPLCFKP  829

Query  547  GEDADTLGLTGHERYTIDLPSKISDIRPGQDVTVQTDTGKCFTCTARFDTEV  392
            G+DADTLGLTGHERYTI+LP+ +S+IRPGQDVTV TDT K F+CT RFDTEV
Sbjct  830  GDDADTLGLTGHERYTINLPNSVSEIRPGQDVTVATDTSKSFSCTVRFDTEV  881



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2104600723148