BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6902

Length=929
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB30571.1|  hypothetical protein B456_005G149900                    191   1e-55   Gossypium raimondii
gb|KJB30572.1|  hypothetical protein B456_005G149900                    190   2e-55   Gossypium raimondii
emb|CDP11780.1|  unnamed protein product                                186   7e-55   Coffea canephora [robusta coffee]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              187   1e-54   Gossypium arboreum [tree cotton]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               186   2e-54   
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   1e-53   Solanum lycopersicum
ref|XP_007026054.1|  MATE efflux family protein isoform 1               185   2e-53   
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            185   2e-53   Solanum lycopersicum
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            184   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             184   6e-53   Citrus clementina [clementine]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   7e-53   Eucalyptus grandis [rose gum]
gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  182   8e-53   Citrus sinensis [apfelsine]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   1e-52   Vitis vinifera
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   1e-52   Vitis vinifera
emb|CBI28938.3|  unnamed protein product                                181   1e-52   Vitis vinifera
emb|CBI28937.3|  unnamed protein product                                180   2e-52   Vitis vinifera
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   2e-52   Solanum tuberosum [potatoes]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    186   4e-52   
ref|XP_012091356.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   4e-52   Jatropha curcas
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            183   4e-52   Glycine max [soybeans]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   5e-52   Sesamum indicum [beniseed]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   8e-52   Cicer arietinum [garbanzo]
emb|CDP11781.1|  unnamed protein product                                179   1e-51   Coffea canephora [robusta coffee]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    182   1e-51   Gossypium raimondii
ref|XP_012091355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-51   Jatropha curcas
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             179   1e-51   Phaseolus vulgaris [French bean]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                181   1e-51   Erythranthe guttata [common monkey flower]
emb|CDM86696.1|  unnamed protein product                                179   1e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   1e-51   Populus euphratica
ref|XP_002883313.1|  mate efflux family protein                         180   1e-51   
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    182   1e-51   Vitis vinifera
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   1e-51   Nicotiana sylvestris
ref|XP_003596992.1|  Transparent testa 12 protein                       180   1e-51   Medicago truncatula
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    179   1e-51   Nelumbo nucifera [Indian lotus]
ref|NP_188806.1|  MATE efflux family protein                            179   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             179   2e-51   
ref|XP_007026056.1|  MATE efflux family protein                         175   2e-51   
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-51   Populus euphratica
gb|AAM20595.1|  integral membrane protein, putative                     179   2e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDM86687.1|  unnamed protein product                                177   3e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-51   Nicotiana tomentosiformis
dbj|BAJ34540.1|  unnamed protein product                                179   3e-51   Eutrema halophilum
emb|CAN73203.1|  hypothetical protein VITISV_008169                     178   3e-51   Vitis vinifera
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            177   4e-51   
gb|AHI48506.1|  multidrug and toxic extrusion transporter               177   4e-51   Vaccinium corymbosum [American blueberry]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             178   5e-51   
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   6e-51   Cicer arietinum [garbanzo]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            178   7e-51   Glycine soja [wild soybean]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   7e-51   Glycine max [soybeans]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   8e-51   Cicer arietinum [garbanzo]
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     175   9e-51   Eucalyptus grandis [rose gum]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            176   1e-50   
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   1e-50   Oryza brachyantha
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            177   1e-50   Glycine soja [wild soybean]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   1e-50   Populus euphratica
ref|XP_002518492.1|  multidrug resistance pump, putative                172   1e-50   Ricinus communis
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   1e-50   Elaeis guineensis
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            175   2e-50   Triticum urartu
ref|XP_011628469.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-50   Amborella trichopoda
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-50   Solanum lycopersicum
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             176   2e-50   Capsella rubella
gb|ERN19666.1|  hypothetical protein AMTR_s00062p00172410               177   2e-50   Amborella trichopoda
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   2e-50   
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   2e-50   
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            176   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            174   3e-50   Vitis vinifera
emb|CBI23254.3|  unnamed protein product                                174   4e-50   Vitis vinifera
emb|CDP17486.1|  unnamed protein product                                173   4e-50   Coffea canephora [robusta coffee]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            172   5e-50   Phoenix dactylifera
emb|CDM86692.1|  unnamed protein product                                173   5e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   6e-50   Populus euphratica
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   6e-50   Populus euphratica
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   6e-50   Solanum lycopersicum
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             169   6e-50   Populus trichocarpa [western balsam poplar]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    174   6e-50   Gossypium raimondii
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             170   7e-50   
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   9e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   9e-50   Populus euphratica
emb|CDM86680.1|  unnamed protein product                                172   1e-49   Triticum aestivum [Canadian hard winter wheat]
emb|CAN82750.1|  hypothetical protein VITISV_014577                     172   1e-49   Vitis vinifera
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             168   1e-49   
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             173   1e-49   Eutrema salsugineum [saltwater cress]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              173   1e-49   Gossypium arboreum [tree cotton]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   1e-49   Elaeis guineensis
emb|CDM86677.1|  unnamed protein product                                172   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-49   Solanum tuberosum [potatoes]
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            172   2e-49   Triticum urartu
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            172   2e-49   
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             173   2e-49   Phaseolus vulgaris [French bean]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-49   
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   2e-49   Nicotiana sylvestris
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   2e-49   Setaria italica
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             167   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   3e-49   Cucumis melo [Oriental melon]
emb|CDP04390.1|  unnamed protein product                                173   3e-49   Coffea canephora [robusta coffee]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-49   Vitis vinifera
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   4e-49   Brachypodium distachyon [annual false brome]
ref|XP_012091357.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   4e-49   Jatropha curcas
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    173   4e-49   
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          167   5e-49   Sorghum bicolor [broomcorn]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   5e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   7e-49   Elaeis guineensis
gb|ACL53378.1|  unknown                                                 172   7e-49   Zea mays [maize]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   7e-49   
ref|XP_002518495.1|  multidrug resistance pump, putative                169   8e-49   Ricinus communis
emb|CBI23253.3|  unnamed protein product                                170   8e-49   Vitis vinifera
gb|ABF97209.1|  MATE efflux family protein, expressed                   168   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-48   Nicotiana sylvestris
ref|XP_006389638.1|  MATE efflux family protein                         172   1e-48   
gb|EEC75606.1|  hypothetical protein OsI_12318                          167   1e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-48   Cucumis melo [Oriental melon]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            166   2e-48   Vitis vinifera
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-48   Setaria italica
ref|XP_012091359.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   2e-48   Jatropha curcas
gb|ACZ55931.1|  MATE transporter 2                                      170   2e-48   Zea mays [maize]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   2e-48   Solanum tuberosum [potatoes]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    169   2e-48   Arabis alpina [alpine rockcress]
gb|ACZ55932.1|  MATE transporter 2                                      170   2e-48   Zea mays [maize]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            167   2e-48   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   2e-48   Elaeis guineensis
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   2e-48   Solanum tuberosum [potatoes]
emb|CBI23251.3|  unnamed protein product                                165   2e-48   Vitis vinifera
gb|KEH36840.1|  MATE efflux family protein                              176   3e-48   Medicago truncatula
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   3e-48   Zea mays [maize]
ref|XP_012091362.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   3e-48   Jatropha curcas
ref|XP_003605914.1|  Transparent testa 12 protein                       171   4e-48   Medicago truncatula
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   4e-48   Brassica rapa
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-48   Sesamum indicum [beniseed]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           171   4e-48   Nicotiana tabacum [American tobacco]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            167   5e-48   
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   5e-48   Zea mays [maize]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   5e-48   Nicotiana tomentosiformis
ref|NP_001142368.1|  uncharacterized protein LOC100274540               165   6e-48   Zea mays [maize]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   6e-48   Populus euphratica
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   7e-48   Cicer arietinum [garbanzo]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    167   7e-48   Arabis alpina [alpine rockcress]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    170   8e-48   Nicotiana sylvestris
ref|NP_001050524.1|  Os03g0572900                                       167   1e-47   
gb|EEC75610.1|  hypothetical protein OsI_12322                          167   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   1e-47   Elaeis guineensis
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-47   
gb|EEC75604.1|  hypothetical protein OsI_12313                          170   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            164   2e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|AAR00628.1|  putative MATE family protein                            170   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            165   2e-47   Triticum urartu
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    168   2e-47   Nicotiana alata [flowering tobacco]
ref|NP_001148084.1|  transparent testa 12 protein                       167   2e-47   Zea mays [maize]
ref|NP_001050520.1|  Os03g0570800                                       170   2e-47   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   2e-47   Malus domestica [apple tree]
ref|NP_564787.1|  MATE efflux family protein                            167   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-47   Brassica rapa
emb|CDY47166.1|  BnaA01g22920D                                          167   2e-47   Brassica napus [oilseed rape]
emb|CDY25329.1|  BnaC01g29980D                                          167   3e-47   Brassica napus [oilseed rape]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   165   3e-47   Citrus sinensis [apfelsine]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   3e-47   Citrus sinensis [apfelsine]
emb|CDY34833.1|  BnaA09g47590D                                          163   3e-47   Brassica napus [oilseed rape]
gb|AAK82541.1|  At1g61890/F8K4_9                                        166   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            162   4e-47   Brassica rapa
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   4e-47   Brassica rapa
ref|NP_001147791.1|  transparent testa 12 protein                       167   5e-47   Zea mays [maize]
gb|ACF85423.1|  unknown                                                 165   6e-47   Zea mays [maize]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   6e-47   Prunus mume [ume]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             166   7e-47   Eutrema salsugineum [saltwater cress]
dbj|BAH20308.1|  AT1G61890                                              166   7e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   8e-47   Fragaria vesca subsp. vesca
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   8e-47   Brassica rapa
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   8e-47   Prunus mume [ume]
ref|XP_002886501.1|  mate efflux family protein                         165   8e-47   
gb|AFW68307.1|  putative MATE efflux family protein                     164   8e-47   
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   9e-47   Prunus mume [ume]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             165   9e-47   Prunus persica
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   9e-47   Prunus mume [ume]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   1e-46   Prunus mume [ume]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-46   Brachypodium distachyon [annual false brome]
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          164   1e-46   Sorghum bicolor [broomcorn]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    164   1e-46   Nicotiana tomentosiformis
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   1e-46   Brassica rapa
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-46   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             166   1e-46   Citrus clementina [clementine]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-46   Populus euphratica
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-46   Cucumis melo [Oriental melon]
ref|XP_007026057.1|  MATE efflux family protein                         161   2e-46   
ref|NP_001149176.1|  transparent testa 12 protein                       161   2e-46   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               160   2e-46   
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-46   Fragaria vesca subsp. vesca
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   3e-46   Glycine max [soybeans]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            168   3e-46   Glycine soja [wild soybean]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   3e-46   Nicotiana tomentosiformis
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   3e-46   Nicotiana tomentosiformis
emb|CDY34637.1|  BnaC08g41960D                                          159   3e-46   Brassica napus [oilseed rape]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    163   3e-46   Arabis alpina [alpine rockcress]
gb|AGT17221.1|  transparent testa 12 protein                            160   3e-46   Saccharum hybrid cultivar R570
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   3e-46   
gb|KJB57730.1|  hypothetical protein B456_009G178100                    174   4e-46   Gossypium raimondii
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   4e-46   Brassica rapa
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             161   7e-46   Eutrema salsugineum [saltwater cress]
gb|ACF85024.1|  unknown                                                 159   9e-46   Zea mays [maize]
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             162   1e-45   Capsella rubella
emb|CDY19507.1|  BnaC09g13960D                                          161   1e-45   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-45   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                          160   1e-45   Brassica napus [oilseed rape]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             161   1e-45   Populus trichocarpa [western balsam poplar]
emb|CDY12916.1|  BnaA09g13580D                                          161   1e-45   Brassica napus [oilseed rape]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   1e-45   Populus euphratica
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    161   2e-45   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   2e-45   Populus euphratica
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-45   Eucalyptus grandis [rose gum]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   2e-45   Populus euphratica
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             158   2e-45   
emb|CDY39494.1|  BnaA01g24940D                                          158   3e-45   Brassica napus [oilseed rape]
ref|XP_011652908.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   3e-45   Cucumis sativus [cucumbers]
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   4e-45   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   4e-45   
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   4e-45   Cucumis sativus [cucumbers]
emb|CDY19294.1|  BnaC01g31860D                                          157   4e-45   Brassica napus [oilseed rape]
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   7e-45   Brassica rapa
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             158   8e-45   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    158   8e-45   Arabis alpina [alpine rockcress]
emb|CDY07257.1|  BnaC04g19140D                                          158   8e-45   
emb|CDX76391.1|  BnaA08g10090D                                          160   9e-45   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             157   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             157   1e-44   Citrus clementina [clementine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   2e-44   Citrus sinensis [apfelsine]
dbj|BAD95082.1|  hypothetical protein                                   156   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-44   Brassica rapa
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   2e-44   Brassica rapa
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             157   2e-44   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002867813.1|  mate efflux family protein                         158   2e-44   Arabidopsis lyrata subsp. lyrata
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                157   3e-44   Erythranthe guttata [common monkey flower]
emb|CDX94063.1|  BnaC07g36970D                                          156   3e-44   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          157   3e-44   Sorghum bicolor [broomcorn]
emb|CDY64933.1|  BnaCnng45550D                                          155   3e-44   Brassica napus [oilseed rape]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   3e-44   Pyrus x bretschneideri [bai li]
emb|CDX94061.1|  BnaC07g36950D                                          157   3e-44   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-44   Nicotiana sylvestris
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   3e-44   Fragaria vesca subsp. vesca
emb|CDY27431.1|  BnaC03g64710D                                          156   3e-44   Brassica napus [oilseed rape]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   4e-44   Brassica rapa
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             155   4e-44   
ref|NP_567640.1|  MATE efflux family protein                            157   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62936.1|  unknown                                                 157   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             156   5e-44   Capsella rubella
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             155   5e-44   Capsella rubella
ref|XP_002518493.1|  multidrug resistance pump, putative                153   5e-44   Ricinus communis
dbj|BAH19969.1|  AT4G21910                                              157   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            157   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   5e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   5e-44   Oryza brachyantha
gb|AGT17223.1|  MATE efflux family protein                              155   5e-44   Saccharum hybrid cultivar R570
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   155   6e-44   Citrus sinensis [apfelsine]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   6e-44   Pyrus x bretschneideri [bai li]
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         148   6e-44   Jatropha curcas
ref|XP_004144588.2|  PREDICTED: protein TRANSPARENT TESTA 12            162   6e-44   Cucumis sativus [cucumbers]
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            155   6e-44   
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   155   6e-44   Citrus sinensis [apfelsine]
ref|NP_172632.1|  MATE efflux family protein                            154   6e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60226.1|  hypothetical protein VITISV_039920                     150   7e-44   Vitis vinifera
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   7e-44   Nicotiana tomentosiformis
emb|CDY38631.1|  BnaA05g19560D                                          154   7e-44   Brassica napus [oilseed rape]
emb|CDX98711.1|  BnaA03g44960D                                          158   8e-44   
emb|CDX79109.1|  BnaA01g11760D                                          154   1e-43   
emb|CDX98712.1|  BnaA03g44970D                                          154   1e-43   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   1e-43   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   1e-43   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   1e-43   
emb|CDY27434.1|  BnaC03g64740D                                          156   1e-43   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    152   1e-43   
ref|XP_002892653.1|  mate efflux family protein                         153   2e-43   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             153   2e-43   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   2e-43   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   2e-43   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-43   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   2e-43   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   2e-43   
ref|XP_012092374.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   3e-43   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   3e-43   
emb|CDY39493.1|  BnaA01g24950D                                          152   3e-43   
emb|CDX98713.1|  BnaA03g44980D                                          154   3e-43   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-43   
gb|AAM98160.1|  unknown protein                                         152   4e-43   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   4e-43   
emb|CDX92916.1|  BnaA03g36380D                                          151   5e-43   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             152   5e-43   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   5e-43   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   6e-43   
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   6e-43   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            152   8e-43   
ref|XP_011658700.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-42   
gb|AAS01962.1|  putative MATE efflux family protein                     148   1e-42   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    153   1e-42   
emb|CDY65669.1|  BnaCnng48120D                                          150   1e-42   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-42   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    148   2e-42   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-42   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   2e-42   
dbj|BAJ90668.1|  predicted protein                                      154   2e-42   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             145   2e-42   
emb|CDM85992.1|  unnamed protein product                                152   3e-42   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   4e-42   
ref|NP_001059785.1|  Os07g0516600                                       149   5e-42   
gb|EEC82143.1|  hypothetical protein OsI_26198                          149   5e-42   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      149   6e-42   
gb|EEE67272.1|  hypothetical protein OsJ_24453                          149   6e-42   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             146   6e-42   
emb|CDY24252.1|  BnaC03g42250D                                          151   7e-42   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       147   7e-42   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12            147   8e-42   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   9e-42   
ref|NP_001119025.1|  mate efflux domain-containing protein              149   1e-41   
emb|CDY33131.1|  BnaCnng07020D                                          147   1e-41   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             151   2e-41   
emb|CDP20703.1|  unnamed protein product                                142   3e-41   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                147   4e-41   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   4e-41   
ref|XP_002867814.1|  mate efflux family protein                         147   4e-41   
gb|ADE77677.1|  unknown                                                 144   6e-41   
emb|CDY71092.1|  BnaAnng36070D                                          150   6e-41   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            157   1e-40   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                143   1e-40   
gb|EPS67796.1|  hypothetical protein M569_06975                         140   2e-40   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          144   2e-40   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    157   3e-40   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                143   3e-40   
gb|ABF97208.1|  MATE efflux family protein, expressed                   143   3e-40   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   4e-40   
ref|NP_001050521.1|  Os03g0571700                                       143   4e-40   
gb|ABF97220.1|  MATE efflux family protein, expressed                   141   5e-40   
gb|ABK24492.1|  unknown                                                 141   9e-40   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          138   2e-39   
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       155   2e-39   
ref|XP_011659704.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   4e-39   
emb|CDX94064.1|  BnaC07g36980D                                          139   6e-39   
ref|XP_012091358.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   1e-38   
gb|AGT17222.1|  MATE efflux family protein                              135   1e-38   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            139   3e-38   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   3e-38   
ref|NP_001190793.1|  MATE efflux family protein                         137   5e-38   
gb|EPS59093.1|  hypothetical protein M569_15717                         136   1e-37   
emb|CAN69304.1|  hypothetical protein VITISV_021604                     151   3e-37   
ref|NP_001190792.1|  mate efflux domain-containing protein              131   2e-36   
emb|CAA17157.1|  putative protein                                       130   2e-36   
emb|CDY19296.1|  BnaC01g31840D                                          129   3e-36   
emb|CDP04391.1|  unnamed protein product                                146   5e-36   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   2e-35   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   2e-35   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               123   3e-34   
emb|CAN73356.1|  hypothetical protein VITISV_040100                     118   1e-33   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   2e-33   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            135   2e-32   
gb|EMT19998.1|  hypothetical protein F775_52364                       98.6    2e-31   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    127   2e-31   
emb|CDP11782.1|  unnamed protein product                                110   2e-31   
emb|CBI28940.3|  unnamed protein product                                123   4e-31   
gb|ABR16195.1|  unknown                                                 117   7e-31   
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             105   9e-31   
ref|NP_001065641.2|  Os11g0129000                                       124   2e-30   
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    110   3e-30   
gb|EEC68782.1|  hypothetical protein OsI_37323                          123   3e-30   
gb|EEC68785.1|  hypothetical protein OsI_37326                          125   6e-30   
ref|NP_001066047.1|  Os12g0126000                                       125   6e-30   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   8e-30   
gb|KEH39009.1|  MATE efflux family protein                              106   2e-29   
gb|EEC68781.1|  hypothetical protein OsI_37322                          123   2e-29   
ref|NP_001141051.1|  putative MATE efflux family protein                121   3e-29   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          122   4e-29   
ref|NP_001176328.1|  Os11g0128900                                       122   5e-29   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   5e-29   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            118   7e-29   
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   9e-29   
gb|ABA91295.1|  MATE efflux family protein, expressed                   121   9e-29   
ref|NP_001065623.1|  Os11g0126100                                       121   1e-28   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   1e-28   
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             103   1e-28   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            116   1e-28   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   1e-28   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            124   2e-28   
ref|XP_002530955.1|  multidrug resistance pump, putative                115   2e-28   
ref|NP_001176768.1|  Os12g0125800                                       121   2e-28   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   2e-28   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   2e-28   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          117   2e-28   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     115   2e-28   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   2e-28   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   2e-28   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   3e-28   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   3e-28   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-28   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   5e-28   
gb|KJB69294.1|  hypothetical protein B456_011G014800                    102   5e-28   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            117   6e-28   
emb|CDP13216.1|  unnamed protein product                                106   6e-28   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            119   6e-28   
gb|EEC73528.1|  hypothetical protein OsI_07920                          118   6e-28   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   6e-28   
gb|ERN17618.1|  hypothetical protein AMTR_s00059p00169290               108   6e-28   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    118   7e-28   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   7e-28   
ref|XP_011627768.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   7e-28   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   7e-28   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   8e-28   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   1e-27   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          117   1e-27   
emb|CBI31189.3|  unnamed protein product                                117   1e-27   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   1e-27   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     115   1e-27   
dbj|BAJ90744.1|  predicted protein                                      117   1e-27   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-27   
gb|ACG27773.1|  transparent testa 12 protein                            115   2e-27   
ref|XP_011026194.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-27   
ref|XP_007161849.1|  hypothetical protein PHAVU_001G103200g             112   2e-27   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    112   2e-27   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          112   2e-27   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   2e-27   
ref|XP_009605336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-27   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-27   
ref|XP_010542192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   3e-27   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   3e-27   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               110   3e-27   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   4e-27   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   4e-27   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          118   4e-27   
gb|ACF87410.1|  unknown                                                 114   4e-27   
emb|CBI31190.3|  unnamed protein product                                113   4e-27   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    111   5e-27   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              111   5e-27   
ref|NP_001130797.1|  putative MATE efflux family protein                114   5e-27   
ref|XP_003520899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   5e-27   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            110   5e-27   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            110   5e-27   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein              106   6e-27   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    111   6e-27   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     111   6e-27   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             113   6e-27   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          109   6e-27   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   7e-27   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             110   7e-27   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   7e-27   
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  92.8    7e-27   
ref|XP_006375947.1|  hypothetical protein POPTR_0013s06650g             110   7e-27   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     110   8e-27   
ref|XP_002319744.1|  MATE efflux family protein                         110   8e-27   
ref|XP_010528775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   9e-27   
gb|KJB31160.1|  hypothetical protein B456_005G179100                    105   9e-27   
ref|XP_007051759.1|  MATE efflux family protein                         109   1e-26   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-26   
ref|XP_007029906.1|  MATE efflux family protein                         109   1e-26   
ref|XP_004291916.1|  PREDICTED: protein TRANSPARENT TESTA 12            106   1e-26   
ref|XP_006604281.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   1e-26   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    110   1e-26   
ref|XP_011086627.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-26   
ref|XP_009353041.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    110   2e-26   
ref|XP_007153779.1|  hypothetical protein PHAVU_003G064300g             105   2e-26   
ref|XP_008377358.1|  PREDICTED: protein TRANSPARENT TESTA 12            109   2e-26   
ref|XP_006445000.1|  hypothetical protein CICLE_v10018703mg             108   2e-26   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-26   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   108   2e-26   
ref|XP_006852301.2|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    104   2e-26   
gb|KJB31143.1|  hypothetical protein B456_005G178900                    105   2e-26   
emb|CBI23362.3|  unnamed protein product                                101   2e-26   
ref|XP_006491465.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   2e-26   
ref|XP_008391733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   2e-26   
emb|CDP13215.1|  unnamed protein product                                107   3e-26   
gb|ERN13761.1|  hypothetical protein AMTR_s00049p00187420               104   3e-26   
ref|XP_006827534.2|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    104   3e-26   
ref|XP_002272214.2|  PREDICTED: protein TRANSPARENT TESTA 12-like...    101   3e-26   
ref|XP_002300856.1|  hypothetical protein POPTR_0002s05600g             109   3e-26   
ref|XP_011624761.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    104   3e-26   
ref|XP_007161850.1|  hypothetical protein PHAVU_001G103300g             108   3e-26   
gb|ERN13768.1|  hypothetical protein AMTR_s00049p00190450               103   3e-26   
ref|NP_174587.1|  MATE efflux family protein                            104   3e-26   
ref|XP_012070347.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   3e-26   
ref|XP_002891030.1|  mate efflux family protein                         104   4e-26   
gb|ERM94950.1|  hypothetical protein AMTR_s00009p00209720               104   4e-26   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.8    4e-26   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                    105   4e-26   
ref|XP_011086624.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   4e-26   
ref|XP_007042719.1|  MATE efflux family protein                       98.6    4e-26   
ref|XP_011626241.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   4e-26   
ref|XP_009365885.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   4e-26   
ref|XP_007044786.1|  MATE efflux family protein isoform 3               103   5e-26   
ref|XP_007044784.1|  MATE efflux family protein isoform 1               103   5e-26   
gb|AFK46935.1|  unknown                                                 106   5e-26   



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   191 bits (484),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCP LALTL+LNG
Sbjct  351  SAAFSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT
Sbjct  411  VQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  471  LVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  504


 Score = 54.3 bits (129),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  326  FMISVGFNAAASVRVGNELGAGHPKSAA  353



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   190 bits (482),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCP LALTL+LNG
Sbjct  242  SAAFSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPFLALTLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT
Sbjct  302  VQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  362  LVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  395


 Score = 54.3 bits (129),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  217  FMISVGFNAAASVRVGNELGAGHPKSAA  244



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   186 bits (472),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVVN+ISFI+SVIAAI+VLALR V+SY FT+GEVVADAVSDL PLLALTLVLNG
Sbjct  345  SAAFSVVVVNVISFIVSVIAAIIVLALRRVMSYAFTEGEVVADAVSDLAPLLALTLVLNG  404

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G++LGFYF LGAKG+W GM+GGT MQT
Sbjct  405  IQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQT  464

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IILLWVTIRTDW KEVEVA KRL++W D K+E LL
Sbjct  465  IILLWVTIRTDWNKEVEVALKRLDKWEDQKKEALL  499


 Score = 56.6 bits (135),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  320  FMISVGFNAAASVRVSNELGAGHPKSAA  347



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   187 bits (475),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V ++SFIISV AAI+++ LR VISY FT+GEVVA+AVSDLCPLLALTL+LNG
Sbjct  351  SAAFSVVIVTVLSFIISVAAAIIIMVLRDVISYAFTEGEVVAEAVSDLCPLLALTLILNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT
Sbjct  411  VQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  391
            ++L+WVT RTDW KEVE A+KR++ W  K+ EPLL
Sbjct  471  LVLIWVTFRTDWKKEVEEARKRMDAWQVKKEEPLL  505


 Score = 54.3 bits (129),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  326  FMISVGFNAAASVRVGNELGAGHPKSAA  353



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   186 bits (471),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVV+V + S IISV AAI+VLALRHV+SY FT GEVVA+AVSDLCPLLALTL+LNG
Sbjct  350  SASFSVVIVTVFSAIISVAAAIIVLALRHVLSYAFTGGEVVAEAVSDLCPLLALTLILNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++LGFYF LGAKGIW GMIGGT MQT
Sbjct  410  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  470  LILVWVTFRTDWKKEVEEARKRLVTWEDKKEPLL  503


 Score = 55.5 bits (132),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS S
Sbjct  325  FMISVGFNAAASVRVGNELGAGHPKSAS  352



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   181 bits (460),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV VV   SFI SVIAAI+VL  R V+SY FT GEVVA+AVSDLCPLLALTL LNG
Sbjct  348  SASFSVRVVTTCSFITSVIAAILVLTFRDVLSYAFTGGEVVAEAVSDLCPLLALTLALNG  407

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT
Sbjct  408  IQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQT  467

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL+W+TIRTDW KEVE A+ RLN+W  K+EP L +
Sbjct  468  VILIWITIRTDWNKEVEAAQGRLNKWGDKKEPELKE  503


 Score = 57.0 bits (136),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  323  FMISVGFNAAASVRVSNELGAGHPKSAS  350



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   185 bits (470),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            AF+V VV L+SFIISV+ A+VVLALRHVISY FTDGE VADAVSDLCP LA+TL+LNG+Q
Sbjct  362  AFTVAVVTLVSFIISVVEAVVVLALRHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQ  421

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+
Sbjct  422  PVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIV  481

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  482  LLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  513


 Score = 52.8 bits (125),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
             M+SVGFNAAASVRVSNELGAGHPKS
Sbjct  335  LMVSVGFNAAASVRVSNELGAGHPKS  360



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   185 bits (469),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV   SFI+SVIAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG
Sbjct  357  SAAFSVVVVTSWSFILSVIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNG  416

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVN+GCYY+VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT
Sbjct  417  IQPVLSGVAVGCGWQTFVAYVNIGCYYIVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  477  IILIWITARTDWNKEVEAAQSRLKKWDDKKESILEE  512


 Score = 52.8 bits (125),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA HPKS +
Sbjct  332  FMISVGFNAAASVRVSNELGARHPKSAA  359



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   184 bits (468),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V   SFII+VIAAI VL LRHVISY FT GE VA+AVSDLCPLL++TL+LNG
Sbjct  357  SAAFSVVIVTSSSFIIAVIAAITVLELRHVISYAFTSGEAVANAVSDLCPLLSITLILNG  416

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT
Sbjct  417  VQPVLSGVAVGCGWQAFVAYVNVGCYYILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RT+W KEVE A KRLN+W+ K EPLL
Sbjct  477  LILLWVTYRTNWNKEVEEATKRLNKWEDKPEPLL  510


 Score = 53.1 bits (126),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  332  FMVSVGFNAAASVRVSNELGAGNPKSAA  359



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   183 bits (465),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV ++SFI+SVIAAI++L LR  ISY FTDGEVVA AVSDLCPLLA TL+LNG
Sbjct  332  SAAFSVVVVTVMSFIVSVIAAIIILCLRDYISYAFTDGEVVARAVSDLCPLLATTLILNG  391

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY++GVP G++LGF F LGAKGIW GMIGGT MQT
Sbjct  392  IQPVLSGVAVGCGWQAFVAYVNVGCYYIIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQT  451

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  452  LILLWVTFRTDWNKEVEEAKKRLNKWEDKKEPLL  485


 Score = 53.1 bits (126),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  307  FMISVGFNAAASVRVSNELGAGNPKSAA  334



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   184 bits (466),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVV+V L+SF+ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG
Sbjct  366  SASFSVVMVTLVSFVISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT
Sbjct  426  IQPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  486  LILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  519


 Score = 52.4 bits (124),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  341  FMISVGFNAAASVRVSNELGAANPKSAS  368



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   182 bits (462),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+V+ A++V+ALRHVISYVFT+GE VA+AVS+LCP LA+TL+LNG
Sbjct  357  SAAFSVVIVNLVSFIIAVLEAVIVMALRHVISYVFTEGETVANAVSELCPYLAVTLILNG  416

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GM+GGT MQT
Sbjct  417  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEVE AK RL++W+ K++PLL
Sbjct  477  LILIWVTYRTDWNKEVEKAKGRLDKWEDKKKPLL  510


 Score = 53.5 bits (127),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAGHPKS +
Sbjct  332  FMVSVGFNAAASVRVGNELGAGHPKSAA  359



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+FSVV+V L+SF+ISV+AAI++LALR VISY FT GE VA AVSDLCPLLALTL+LNG+
Sbjct  15   ASFSVVMVTLVSFVISVMAAIIILALRDVISYAFTGGEAVAAAVSDLCPLLALTLILNGI  74

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+
Sbjct  75   QPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTL  134

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  135  ILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   181 bits (459),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF+ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG
Sbjct  352  SAAFSVVVVTLVSFLISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  412  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  472  LILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  505


 Score = 54.3 bits (129),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  327  FMISVGFNAAASVRVGNELGAGHPKSAA  354



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   181 bits (459),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF+ISV+AA VVL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG
Sbjct  352  SAAFSVVVVTLVSFLISVVAAAVVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  412  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  472  FILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  505


 Score = 54.3 bits (129),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  327  FMISVGFNAAASVRVGNELGAGHPKSAA  354



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   181 bits (458),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF+ISV+AA VVL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG
Sbjct  279  SAAFSVVVVTLVSFLISVVAAAVVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNG  338

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  339  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQT  398

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  399  FILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  432


 Score = 54.3 bits (129),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  254  FMISVGFNAAASVRVGNELGAGHPKSAA  281



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   180 bits (457),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF+ISV+AA +VL LRHVISY FT GE VA AVSDLCP+LA+TL+LNG
Sbjct  388  SAAFSVVVVTLVSFLISVVAAALVLVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNG  447

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  448  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQT  507

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  508  LILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  541


 Score = 54.3 bits (129),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS +
Sbjct  363  FMISVGFNAAASVRVGNELGAGHPKSAA  390



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   181 bits (460),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV   SFI+S+IAA++VLALR++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG
Sbjct  357  SAAFSVVVVTSWSFILSMIAAVIVLALRNLISYAFTEGEVVAEAVSDLCPLLALSLILNG  416

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGFYF LGAKGIW GM+GGTVMQT
Sbjct  417  IQPVLSGVAVGCGWQAFVAYVNIGCYYIVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+W+T RTDW KEVE A+ RL  WD K+E +L +
Sbjct  477  IILIWITARTDWNKEVESAQSRLKMWDDKKESILEE  512


 Score = 52.8 bits (125),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA HPKS +
Sbjct  332  FMISVGFNAAASVRVSNELGARHPKSAA  359



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   181 bits (458),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV ++SFIISVIAA++VL LR  ISY FT+GE VA AVSDLCPLLA+TL+LNG
Sbjct  366  SAAFSVIVVTMMSFIISVIAAVIVLCLRDYISYAFTEGETVARAVSDLCPLLAITLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G++LGF F LGAKGIW GMIGGT+MQT
Sbjct  426  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  391
            +IL+WVT RTDW KEVE AKKRLN+WD K+ EPLL
Sbjct  486  LILMWVTFRTDWNKEVEEAKKRLNKWDGKKEEPLL  520


 Score = 53.1 bits (126),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   186 bits (471),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            AF+V VV L+SFIISV+ A+VVLALRHVISY FTDGE VADAVSDLCP LA+TL+LNG+Q
Sbjct  363  AFTVAVVTLVSFIISVVEAVVVLALRHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQ  422

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+
Sbjct  423  PVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIV  482

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  483  LLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  514


 Score = 48.1 bits (113),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = -2

Query  928  FMISVGFNAAAS-VRVSNELGAGHPKS  851
             M+SVGFNAAAS VRVSNELGAGHPKS
Sbjct  335  LMVSVGFNAAASSVRVSNELGAGHPKS  361



>ref|XP_012091356.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Jatropha curcas]
Length=491

 Score =   177 bits (449),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+V+   SFII+ IAAI+VL  R VISY FT+GEVVA AVS+L P LA+TL+LNG
Sbjct  336  SAAFSVIVLTSSSFIIAAIAAIIVLVFRDVISYGFTEGEVVAKAVSELTPYLAITLILNG  395

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+GA+LGF F+LGAKGIW GMIGGT +QT
Sbjct  396  VQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGAILGFVFDLGAKGIWSGMIGGTFLQT  455

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IILLWVT RTDW KEVE+A+ RLN WD K+EPLL K
Sbjct  456  IILLWVTYRTDWDKEVEIARNRLNAWDEKKEPLLDK  491


 Score = 56.2 bits (134),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  311  FMISVGFNAAASVRVSNELGAGHPKSAA  338



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   183 bits (464),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
            +   A+FSVVVV +ISFIISVIAA+VVLALR VISY FT GE VA AVSDLCPLLAL+LV
Sbjct  347  SPKSASFSVVVVTVISFIISVIAALVVLALRDVISYAFTGGEEVAAAVSDLCPLLALSLV  406

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+GAVLGFYF  GAKGIW GM+GGTV
Sbjct  407  LNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTV  466

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            MQTIILLWVT RTDW KEVE A KRL +W+ K+EPLL
Sbjct  467  MQTIILLWVTFRTDWTKEVEEAAKRLTKWEDKKEPLL  503


 Score = 50.4 bits (119),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA  PKS S
Sbjct  325  FMISVGFNAAASVRVSNELGARSPKSAS  352



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   181 bits (459),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VNL+SF+++   A +VL+ RH+ISY+FT GE VA AV+DLCPLLA+TL+LNG
Sbjct  354  SAAFSVMMVNLVSFMVAAAEAGIVLSQRHIISYIFTGGETVAKAVADLCPLLAVTLLLNG  413

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ+FVA +NVGCYY+VG+P+G +LGF FNLG KGIW GMIGGT+MQT
Sbjct  414  VQPVLSGVAVGCGWQSFVACINVGCYYMVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQT  473

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +ILLWVT RTDW KEVE A+KRL++W+   EPLL +
Sbjct  474  LILLWVTFRTDWNKEVEKARKRLDKWEEITEPLLKE  509


 Score = 51.6 bits (122),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S+GFNAAASVRV NE+GAGHPKS +
Sbjct  329  FMVSIGFNAAASVRVGNEIGAGHPKSAA  356



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   181 bits (459),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV VV LISFIIS IAA++VLALR VISYVFT+GE VA AVSDLCPLL+L+++LNG
Sbjct  352  SASFSVKVVTLISFIISAIAALIVLALRDVISYVFTEGETVAAAVSDLCPLLSLSILLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT
Sbjct  412  IQPVLSGVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT RTDW KEVE + KRLN+WD K+EPLL
Sbjct  472  IILIWVTFRTDWNKEVEESAKRLNKWDDKKEPLL  505


 Score = 51.2 bits (121),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  327  FMISVGFNAAASVRVSNELGARNPKSAS  354



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   179 bits (453),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV VVN+ SFI SVIAA+++LALR V+SY FT+GEVVADAVSDL PLLA+T+VLNG
Sbjct  277  SAAFSVAVVNVASFITSVIAAVIILALRRVMSYAFTEGEVVADAVSDLSPLLAVTVVLNG  336

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G+VLGFYF LGAKG+W GM+GGT+MQT
Sbjct  337  IQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQT  396

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            IILLWVTIRTDW+KEVE A +RL++W+  ++
Sbjct  397  IILLWVTIRTDWIKEVEAALRRLDKWEVLKD  427


 Score = 53.1 bits (126),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            F IS+GFNAAASVRVSNELGAGHPKS +
Sbjct  252  FTISIGFNAAASVRVSNELGAGHPKSAA  279



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   182 bits (462),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAF+V +V L+S  I+V  A+VVLALRHVISYVFT+GE VA+AVS+LCP LA+TL+LNGV
Sbjct  368  AAFTVKIVTLVSLTIAVAEAVVVLALRHVISYVFTEGETVAEAVSELCPFLAVTLILNGV  427

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+
Sbjct  428  QPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTL  487

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVT RTDW KEVE AKKRL++W+ KRE LL
Sbjct  488  ILLWVTFRTDWNKEVETAKKRLDKWEDKRETLL  520


 Score = 50.1 bits (118),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             M+S+GFNAAASVRVSNELGAG+PKS +
Sbjct  342  MMVSIGFNAAASVRVSNELGAGNPKSAA  369



>ref|XP_012091355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Jatropha curcas]
Length=491

 Score =   176 bits (446),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+V+   SFII+ IAAI+VL  R VISY FT+GEVVA AVS+L P LA+TL+LNG
Sbjct  336  SAAFSVIVLTSSSFIIAAIAAIIVLVFRDVISYGFTEGEVVAKAVSELTPYLAITLILNG  395

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY +GVP+GA+LGF F+LGAKGIW GMIGGT +QT
Sbjct  396  VQPVLSGVAVGCGWQAFVAYVNVGCYYFIGVPLGAILGFVFDLGAKGIWSGMIGGTFLQT  455

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IILLWVT RTDW KEVE+AK RLN W+ K EPLL K
Sbjct  456  IILLWVTYRTDWDKEVEIAKNRLNAWEEKEEPLLDK  491


 Score = 56.2 bits (134),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  311  FMISVGFNAAASVRVSNELGAGHPKSAA  338



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   179 bits (454),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV  +SF+ISVIAA+ VL  R VISY FT+GEVVA AVSDLCPLLAL++VLNG
Sbjct  353  SASFSVVVVTAVSFMISVIAAVAVLVFRDVISYAFTEGEVVATAVSDLCPLLALSIVLNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G++LGFYF+ GAKGIW GM+GGT MQT
Sbjct  413  IQPVLSGVAVGCGWQAFVAYVNVGCYYGVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  473  VILIWVTFRTDWNKEVEEAAKRLSIWEDKKEPVL  506


 Score = 52.8 bits (125),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAG+PKS S
Sbjct  328  FMISVGFNAAASVRVGNELGAGNPKSAS  355



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   181 bits (459),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVVNL+SF ++V+ AIVVL+ RHVISY+FT GE VA+AVSDLCP LA+TL+LNG+
Sbjct  362  AAFSVVVVNLVSFTVAVVEAIVVLSQRHVISYIFTGGETVANAVSDLCPFLAVTLLLNGL  421

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ +VAYVN+GCYYVVG+P+G +LGF FNLG KGIW GMIGGT MQT+
Sbjct  422  QPVLSGVAVGCGWQAYVAYVNIGCYYVVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTL  481

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT*KRSIHETK  355
            ILLWVT RTDW KEVE A KRL  WD  +EPLL     + + E K
Sbjct  482  ILLWVTFRTDWNKEVEKAGKRLAMWDDIKEPLLKY--HKEVEEIK  524


 Score = 50.8 bits (120),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+++GFNAAASVRV NE+GAGHPKS +
Sbjct  336  FMVAIGFNAAASVRVGNEIGAGHPKSAA  363



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   179 bits (453),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S  IS I AIV+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G
Sbjct  338  SAFFSVWVVTGLSTTISTILAIVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGG  397

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT
Sbjct  398  IQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQT  457

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ILLWVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  458  AILLWVTMRTDWTKEVEEAQKRLNKWDEKKEPLL  491


 Score = 53.1 bits (126),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  313  FMISVGFNAAASVRVSNELGAGNPKSA  339



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   180 bits (457),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV VV  +S IISV+AA+ V+ALR VISY FTDGE VA AVSDLCPLLALTLVLNG
Sbjct  247  SAAFSVAVVTTMSLIISVMAALTVMALRDVISYAFTDGETVAQAVSDLCPLLALTLVLNG  306

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMIGG V++T
Sbjct  307  VQPVLSGVAVGCGWQGFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRT  366

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  367  VILLWVTCRTDWNKEVQEALKRLETWEGKKEPLV  400


 Score = 51.6 bits (122),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG G+PKS +
Sbjct  222  FMISVGFNAAASVRVSNELGGGNPKSAA  249



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   180 bits (457),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I SVI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITSVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  471  FILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506


 Score = 51.6 bits (122),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   182 bits (461),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF+ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LNG
Sbjct  352  SAAFSVVVVTLVSFLISVVAAAVVFVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  412  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             IL+WVT RT+W KEVE AK+RL +WD K++PLL
Sbjct  472  FILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  505


 Score = 50.1 bits (118),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            F+I VGFNAAASVRV NELGAGHPKS +
Sbjct  327  FVILVGFNAAASVRVGNELGAGHPKSAA  354



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   179 bits (453),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV   SFI+SVIAA++VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG
Sbjct  358  SAAFSVVVVTSWSFILSVIAAVIVLALRNLISYAFTGGEVVAQAVSDLCPLLAISLILNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+GA+LGF+F LGAKGIW GM+GGTVMQT
Sbjct  418  IQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  478  IILIWITARTDWNKEVESAQYRLKKWDDKKESILEE  513


 Score = 52.8 bits (125),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA HPKS +
Sbjct  333  FMISVGFNAAASVRVSNELGARHPKSAA  360



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   180 bits (457),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV VV +ISFIISVIAA++VLALR VISYVFT+GEVVA AVSDLCPLL+L+LVLNG
Sbjct  352  SASFSVKVVTVISFIISVIAALIVLALRDVISYVFTEGEVVAAAVSDLCPLLSLSLVLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+GAVLGFYFN GAKGIW GM+GGT MQT
Sbjct  412  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IIL+WVT RTDW KEV+ A KRLN+W + K+EPLL
Sbjct  472  IILMWVTFRTDWNKEVKEAAKRLNKWEEKKKEPLL  506


 Score = 51.2 bits (121),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  327  FMISVGFNAAASVRVSNELGARNPKSAS  354



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   179 bits (453),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV++V  +SFIISV+AAI+VL LRHVISY FTDGE VA+AVSDLCPLLA+TL+LNGV
Sbjct  359  AAFSVLIVTSLSFIISVVAAIIVLLLRHVISYAFTDGERVANAVSDLCPLLAITLILNGV  418

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVGVPVG +LGF F+LGAKGIW GMIGGT +QT+
Sbjct  419  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTL  478

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT RT+W KEVE A KRL  WD K+EPLL
Sbjct  479  ILIWVTYRTNWNKEVEEAMKRLETWDEKKEPLL  511


 Score = 52.8 bits (125),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PK+ +
Sbjct  333  FMISVGFNAAASVRVSNELGAGNPKAAA  360



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   179 bits (455),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  471  FILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506


 Score = 51.6 bits (122),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +S IISV+AA+ V+ALR VISY FT GE VA AVSDLCPLLALTLVLNG
Sbjct  40   SAAFSVVVVTTMSLIISVMAALAVMALRDVISYAFTGGETVAKAVSDLCPLLALTLVLNG  99

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G++ GFYFNLGAKGIW GMI G V+QT
Sbjct  100  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQT  159

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVTIRTDW KEV+ A KRL  W+ K EPL+
Sbjct  160  VILLWVTIRTDWNKEVQEALKRLETWEGKEEPLV  193


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG G+PKS +
Sbjct  15   FMISVGFNAAASVRVSNELGGGNPKSAA  42



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   175 bits (444),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AA++V VV L+SF+I+V+ A+VVLALR VISY FT+GE VA AVSDLCP LA+TL+LNGV
Sbjct  365  AAYTVFVVTLVSFVIAVVEAVVVLALRDVISYAFTEGETVAKAVSDLCPFLAVTLILNGV  424

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F LGAKGIW GMIGGT+MQT+
Sbjct  425  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTV  484

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVT  TDW KEVE AKKRL++W+ K+EPLL
Sbjct  485  ILLWVTFTTDWNKEVETAKKRLDRWEDKKEPLL  517


 Score = 55.5 bits (132),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAGHPKS +
Sbjct  339  FMVSVGFNAAASVRVSNELGAGHPKSAA  366



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   174 bits (440),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA TL+LNG
Sbjct  344  SASFSVVVVTSCSFIISVIAAIIVMIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY++GVPVG +LGF F+LGAKGIW GM+GGTV+QT
Sbjct  404  IQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT+RTDW KEVE AK RL+ WD KR+PLL
Sbjct  464  IILVWVTLRTDWDKEVESAKNRLSSWDEKRQPLL  497


 Score = 57.0 bits (136),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  319  FMISVGFNAAASVRVSNELGAGHPKSAS  346



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   179 bits (455),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KRL++W  K++ ++P+
Sbjct  471  FILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVVPE  506


 Score = 51.6 bits (122),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   177 bits (450),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G
Sbjct  340  SAFFSVWVVTGLSATISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPLLAITLVLGG  399

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT
Sbjct  400  IQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQT  459

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  460  AILLWVTIRTDWSKEVEEAQKRLNKWDEKKQPLL  493


 Score = 52.8 bits (125),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  315  FMISVGFNAAASVRVSNELGAGNPKSA  341



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   177 bits (450),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV   SFI+SVIAA +VLALR++ISY FT GEVVA AVSDLCPLLA++L+LNG
Sbjct  358  SAAFSVIVVTSWSFILSVIAAAIVLALRNLISYAFTGGEVVAAAVSDLCPLLAISLILNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVPVG +LGF+F LGAKGIW GM+GGTVMQT
Sbjct  418  IQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+W+T RTDW KEVE A+ RL +WD K+E +L +
Sbjct  478  IILIWITARTDWNKEVESAQYRLKKWDDKKEAILEE  513


 Score = 52.8 bits (125),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA HPKS +
Sbjct  333  FMISVGFNAAASVRVSNELGARHPKSAA  360



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   179 bits (453),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG
Sbjct  350  SAAFSVIIVNIYSLITSVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT
Sbjct  410  IQPVLSGVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            +IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  470  VILAWVTFRTDWVKEVEEASKRLDIWSNKK  499


 Score = 51.6 bits (122),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  325  FMISVGFNAAISVRVSNELGAGNPKSAA  352



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   178 bits (451),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  855  SRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLN  676
              AAFSVVVV L+SF+ISV+AA VV  LRHVISY FT GE VA AVSDLCP+LA+TL+LN
Sbjct  109  KSAAFSVVVVTLVSFLISVVAAAVVXVLRHVISYAFTGGETVAQAVSDLCPVLAITLMLN  168

Query  675  GVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQ  496
            G+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQ
Sbjct  169  GIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQ  228

Query  495  TIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T IL+WVT RT+W KEVE AK+R  +WD K++PLL
Sbjct  229  TFILIWVTARTNWNKEVEKAKERXEKWDDKKQPLL  263


 Score = 52.4 bits (124),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRV NELGAGHPKS +
Sbjct  85   FMISVGFNAATSVRVGNELGAGHPKSAA  112



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   177 bits (450),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A FSV VV  +S  IS I A+V+L LR+ ISY+FTDG+ V+DAV+DLCPLLA+TLVL G+
Sbjct  410  AFFSVWVVTGLSATISTILAVVILCLRNHISYLFTDGKAVSDAVADLCPLLAITLVLGGI  469

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT 
Sbjct  470  QPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTA  529

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVTIRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  530  ILLWVTIRTDWTKEVEEAQKRLNKWDEKKEPLL  562


 Score = 52.4 bits (124),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVGFNAAASVRVSNELGAG+PKS
Sbjct  384  FMISVGFNAAASVRVSNELGAGNPKS  409



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   177 bits (449),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVV+VN +S I+++I A+V+L+LR VISY FT GE VA+AVSDLCP LA+TL+LNGV
Sbjct  369  AAFSVVMVNSVSLIVAIIEAMVILSLRDVISYAFTSGETVANAVSDLCPFLAVTLILNGV  428

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G VLGF F+LGAKGIW GMIGGTV+QT 
Sbjct  429  QPVLSGVAVGCGWQAFVAYVNVGCYYFVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTA  488

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  382
            IL+W T +TDW+KEVE AKKRL++WD   +PLL  +
Sbjct  489  ILIWTTYQTDWIKEVEKAKKRLDKWDDINQPLLKAS  524


 Score = 52.8 bits (125),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAGHPK+ +
Sbjct  343  FMVSVGFNAAASVRVGNELGAGHPKAAA  370



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   178 bits (452),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  471  FILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506


 Score = 51.6 bits (122),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   178 bits (452),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I SVI AIV+LA R+++SY FTDGE V+ AVSDLCPLLALTLVLNG
Sbjct  242  SAAFSVIIVNIYSLITSVILAIVILACRNILSYAFTDGEKVSAAVSDLCPLLALTLVLNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY +G+P+GA+LGFYFN GAKGIW GMIGGT++QT
Sbjct  302  IQPVLSGVAVGCGWQTFVAKVNVGCYYFIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            +IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  362  VILAWVTFRTDWVKEVEEASKRLDIWSNKK  391


 Score = 51.6 bits (122),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  217  FMISVGFNAAISVRVSNELGAGNPKSAA  244



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   177 bits (449),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV +ISFIISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNG
Sbjct  357  SASFSVVVVTVISFIISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNG  416

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQT
Sbjct  417  VQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IILLWVT RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  477  IILLWVTFRTDWNKEVEESNKRLNKWEDRTETLIKE  512


 Score = 52.0 bits (123),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  332  FMISVGFNAAASVRVSNELGAKNPKSAS  359



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   178 bits (451),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV LISFIISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG
Sbjct  363  SASFSVMVVTLISFIISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNG  422

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QT
Sbjct  423  IQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQT  482

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  483  IILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516


 Score = 51.2 bits (121),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  338  FMISVGFNAAASVRVSNELGARNPKSAS  365



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   178 bits (451),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV LISFIISVI A+VVLA+R +ISY FTDGE VA AVSDLCPLLAL++VLNG
Sbjct  363  SASFSVMVVTLISFIISVIVALVVLAIRDIISYAFTDGEEVAAAVSDLCPLLALSIVLNG  422

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QT
Sbjct  423  IQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQT  482

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  483  IILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516


 Score = 51.2 bits (121),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  338  FMISVGFNAAASVRVSNELGARNPKSAS  365



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   177 bits (448),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV +ISFIISVI A+VV+ALR VISYVFT+GE VA AVSDLCPLLAL++ LNG
Sbjct  355  SASFSVVVVTVISFIISVILALVVIALRDVISYVFTEGEDVAAAVSDLCPLLALSITLNG  414

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF LGAKGIW GM+GG +MQT
Sbjct  415  VQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQT  474

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IILLWVT RTDW KEVE + KRLN+W+ + E L+ +
Sbjct  475  IILLWVTFRTDWNKEVEESNKRLNKWEDRTETLIKE  510


 Score = 52.0 bits (123),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  330  FMISVGFNAAASVRVSNELGAKNPKSAS  357



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   175 bits (444),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+VI AI+V+ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNG
Sbjct  242  SAAFSVVIVNLVSFIIAVIEAIIVMALRNVISYVFTEGETVANAVSELCPYLAVTLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT
Sbjct  302  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  362  LILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  395


 Score = 53.5 bits (127),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAGHPKS +
Sbjct  217  FMVSVGFNAAASVRVGNELGAGHPKSAA  244



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   176 bits (445),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  IS  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G
Sbjct  242  SAFFSVWVVTGISTTISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT
Sbjct  302  IQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ILLWVTIRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  362  AILLWVTIRTDWTKEVEEAQKRLNKWSEKKEPLL  395


 Score = 52.8 bits (125),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  217  FMISVGFNAAASVRVSNELGAGNPKSA  243



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   180 bits (456),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV  +SF+I+V  A+V L  R  ISY+FTDGE V+ AVSDLCP LA TL+LNG+
Sbjct  340  AAFSVVVVTALSFVITVAMAVVFLIFRDYISYIFTDGETVSRAVSDLCPFLAATLILNGI  399

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ  VAY+NVGCYY VGVP+G +LGF F+LGAKGIW GM+GGT MQT+
Sbjct  400  QPVLSGVAVGCGWQKTVAYINVGCYYFVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTL  459

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPKT  382
            IL W+T RTDW KEVE AKKRLNQWD K++PLL  T
Sbjct  460  ILFWITFRTDWNKEVEQAKKRLNQWDDKKQPLLAST  495


 Score = 48.5 bits (114),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPKSGS  845
            MIS+GFNAAASVRV NELGAGHP++ +
Sbjct  315  MISIGFNAAASVRVGNELGAGHPRAAA  341



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   177 bits (449),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV LISFIISVI A+VVLA+R VISY FTDGE VA AVSDLCPLLAL+++LNG
Sbjct  362  SASFSVVVVTLISFIISVIVALVVLAIRDVISYAFTDGEEVAAAVSDLCPLLALSIILNG  421

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G+VLGFYF L AKGIW GM+GGTV+QT
Sbjct  422  IQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQT  481

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT  TDW KEVE A KRLN+W+ K EPL+
Sbjct  482  IILVWVTFGTDWNKEVEEAAKRLNKWEDKTEPLV  515


 Score = 51.2 bits (121),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  337  FMISVGFNAAASVRVSNELGARNPKSAS  364



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   177 bits (448),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R ++SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITCVILAIVILACRDILSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTITQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KR+++W  K++ ++P+
Sbjct  471  FILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVVPE  506


 Score = 51.6 bits (122),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   175 bits (443),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA TL+LNG
Sbjct  344  SASFSVVVVTSCSFIISVIAAIIVMIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT
Sbjct  404  VQPVLSGVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +ILLWVT+RTDW KEVE AK RLN WD KR+P LP+
Sbjct  464  MILLWVTLRTDWDKEVENAKNRLNTWDDKRQPPLPE  499


 Score = 53.5 bits (127),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMIS GFN AASVRVSNELGAGHPKS S
Sbjct  319  FMISFGFNTAASVRVSNELGAGHPKSAS  346



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   172 bits (436),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV L SFII+VIAAIVV+ LR V+SY FTDGEVV+ AVS+L P LA+TL+LNG
Sbjct  342  SAAFSVIVVTLCSFIIAVIAAIVVMGLRDVLSYAFTDGEVVSKAVSELSPFLAVTLILNG  401

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GMIGGT +QT
Sbjct  402  VQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQT  461

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEVE A++RLN W+ K+EPLL
Sbjct  462  LILIWVTYRTDWNKEVEKARQRLNSWEDKKEPLL  495


 Score = 55.8 bits (133),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  317  FMISVGFNAAASVRVSNELGAGHPKSAA  344



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   174 bits (442),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +SF I+VI A+V+L +R  +SY+FT+GE VA AVS+L PLLA+TL+LNG
Sbjct  366  SAAFSVVVVTSLSFTIAVIIAVVILCIRDYLSYIFTEGETVAHAVSELTPLLAITLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNV CYY+VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT
Sbjct  426  IQPVLSGVAVGCGWQAFVAYVNVACYYIVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  486  LILIWVTFRTDWNKEVNEAIKRLNKWEDKKKPLL  519


 Score = 53.5 bits (127),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   175 bits (444),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S  IS I A+V+L LR+ ISY+FTDGE V+DAV+DLCP LA+TLVL G
Sbjct  277  SAFFSVWVVTGLSATISTILAVVILCLRNHISYLFTDGEAVSDAVADLCPFLAVTLVLGG  336

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT
Sbjct  337  IQPVLTGVAVGCGWQKFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQT  396

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ILLWVTIRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  397  TILLWVTIRTNWTEEVEEAQKRLNKWDEKKEPLL  430


 Score = 52.8 bits (125),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVGFNAAASVRVSNELGAG+PKS
Sbjct  252  FMISVGFNAAASVRVSNELGAGNPKS  277



>ref|XP_011628469.1| PREDICTED: protein TRANSPARENT TESTA 12 [Amborella trichopoda]
Length=503

 Score =   177 bits (449),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  ++FIISV+AAIVVLA+R+VISY FT GEVV++ VSDLCPLLALTL+LNG
Sbjct  347  SAAFSVVVVTTLAFIISVVAAIVVLAIRNVISYAFTGGEVVSNRVSDLCPLLALTLILNG  406

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQT
Sbjct  407  IQPVLSGVAVGCGWQAFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQT  466

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            IIL WVT+RTDW KEVE A++RLN+W  K+  L
Sbjct  467  IILTWVTLRTDWSKEVETAQQRLNKWGDKQPAL  499


 Score = 50.8 bits (120),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAG+PKS +
Sbjct  322  FMVSVGFNAAASVRVGNELGAGNPKSAA  349



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   174 bits (442),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV VV LISF+I+V+ AIVVL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNGV
Sbjct  345  AAFSVFVVTLISFLIAVVEAIVVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNGV  404

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT 
Sbjct  405  QPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTF  464

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+W T RTDW KEVE AK+RL++W+  +EPL  K
Sbjct  465  ILIWFTFRTDWNKEVEKAKERLDKWENVKEPLSKK  499


 Score = 53.1 bits (126),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGA HPKS +
Sbjct  319  FMVSVGFNAAASVRVSNELGAAHPKSAA  346



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   176 bits (447),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ VADAVSDLCPLLA+TLVLNG
Sbjct  352  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVADAVSDLCPLLAVTLVLNG  411

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT
Sbjct  412  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQT  471

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             IL WVT RTDW KEVE A KRL++W  K++
Sbjct  472  FILAWVTFRTDWTKEVEEASKRLDKWSNKKQ  502


 Score = 51.6 bits (122),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  327  FMISVGFNAAISVRVSNELGAGNPKSAA  354



>gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   177 bits (448),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  ++FIISV+AAIVVLA+R+VISY FT GEVV++ VSDLCPLLALTL+LNG
Sbjct  305  SAAFSVVVVTTLAFIISVVAAIVVLAIRNVISYAFTGGEVVSNRVSDLCPLLALTLILNG  364

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY VGVP G +LGFYFNLGA GIW GMIGGT+MQT
Sbjct  365  IQPVLSGVAVGCGWQAFVAYVNVGCYYFVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQT  424

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            IIL WVT+RTDW KEVE A++RLN+W  K+  L
Sbjct  425  IILTWVTLRTDWSKEVETAQQRLNKWGDKQPAL  457


 Score = 50.4 bits (119),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAG+PKS +
Sbjct  280  FMVSVGFNAAASVRVGNELGAGNPKSAA  307



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   176 bits (446),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+
Sbjct  363  AAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGI  422

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQTFVA VN+GCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT 
Sbjct  423  QPVLSGVAVGCGWQTFVAKVNIGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTF  482

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL WVT RTDW KE E A KR+++W  K++ ++P+
Sbjct  483  ILAWVTFRTDWTKEEEEASKRMDKWSNKKQEVVPE  517


 Score = 51.6 bits (122),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  337  FMISVGFNAAISVRVSNELGAGNPKSAA  364



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   176 bits (445),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A FSV VV     I+S I A V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+
Sbjct  340  AYFSVWVVTGSCTIVSAILAAVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGI  399

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY++GVP+G +LGF FNLG KGIW GM+GGT MQT 
Sbjct  400  QPVLSGVAVGCGWQQFVAYVNIGCYYIIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTA  459

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  460  ILVWVTLRTDWKKEVEEAQKRLNKWDDKKEPLL  492


 Score = 52.0 bits (123),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PK+ 
Sbjct  314  FMISVGFNAAASVRVSNELGAGNPKAA  340



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   176 bits (446),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VVN+ S IISVI A+V+LALR V+SY+FT+G+ VA AVSDLCPLLALTLVLNG+
Sbjct  350  AAFSVIVVNVYSLIISVILAVVILALRDVVSYLFTEGKDVAAAVSDLCPLLALTLVLNGI  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSG+AVGCGWQTFVA VNVGCYY+VG+P+GA+ GFYF  GAKGIW GMI GTVMQTI
Sbjct  410  QPVLSGMAVGCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            IL WVT  TDW KEV++A KRL+QW  ++EPL
Sbjct  470  ILAWVTFSTDWNKEVDLATKRLDQWSDRKEPL  501


 Score = 51.2 bits (121),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVRVSNELGAG+P+S +
Sbjct  324  FMIAVGFNAAASVRVSNELGAGNPRSAA  351



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   174 bits (440),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNG
Sbjct  353  SAAFSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT
Sbjct  413  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  391
            +IL+W+T RTDW KEVE AK+RL++W+ K  +PLL
Sbjct  473  LILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  507


 Score = 53.1 bits (126),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  328  FMVSVGFNAAASVRVSNELGAGNPKSAA  355



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   174 bits (440),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNG
Sbjct  279  SAAFSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAVTLILNG  338

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT
Sbjct  339  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQT  398

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  391
            +IL+W+T RTDW KEVE AK+RL++W+ K  +PLL
Sbjct  399  LILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPLL  433


 Score = 52.8 bits (125),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  254  FMVSVGFNAAASVRVSNELGAGNPKSAA  281



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   173 bits (438),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VVN +S I ++IAAI+VLALRHVISY+FT+GE VADAVS+L P LA +LVLNG+
Sbjct  358  AAFSVLVVNCLSTICAIIAAIIVLALRHVISYIFTEGETVADAVSELTPYLAASLVLNGI  417

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQTFVAYVNVGCYY++G+P+GA+ GFYF  GAKGIW G+I G  +QT+
Sbjct  418  QPVLSGVAVGCGWQTFVAYVNVGCYYLIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTL  477

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLW T RTDW KEVE+A+KRL  WD +++PLL
Sbjct  478  ILLWTTFRTDWNKEVEIAQKRLATWDDQKQPLL  510


 Score = 53.5 bits (127),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPK+ +
Sbjct  332  FMISVGFNAAASVRVGNELGAGHPKTAA  359



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   172 bits (437),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  +SY+FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  392  RDYLSYIFTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  451

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W+
Sbjct  452  IVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWE  511

Query  411  AKREPLL  391
             K++PLL
Sbjct  512  GKKQPLL  518


 Score = 53.5 bits (127),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  340  FMISVGFNAAASVRVSNELGAGNPKSAA  367



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   173 bits (439),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S  IS I A+V+L LR+ ISY+FT+GE V+DAV+DL PLLA+TLVL G
Sbjct  338  SAFFSVWVVTGLSATISTILAVVILCLRNHISYLFTNGEAVSDAVADLSPLLAITLVLGG  397

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G VLGF+FNLGAKGIW G+IGGT +QT
Sbjct  398  IQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQT  457

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  458  TILLWVTIRTDWTKEVEEAQKRLNKWDEKKQPLL  491


 Score = 52.8 bits (125),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  313  FMISVGFNAAASVRVSNELGAGNPKSA  339



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   169 bits (429),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV   SFIISVIAAI+VL  R  ISY+FT GEVVA A SDL P LA+T++LNG
Sbjct  250  SASFSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNG  309

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT
Sbjct  310  VQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQT  369

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  370  LILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  403


 Score = 56.6 bits (135),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  225  FMISVGFNAAASVRVSNELGAGHPKSAS  252



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   169 bits (429),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV   SFIISVIAAI+VL  R  ISY+FT GEVVA A SDL P LA+T++LNG
Sbjct  345  SASFSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTGGEVVAKAASDLSPFLAVTIILNG  404

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LGAKGIW GM+GGTV+QT
Sbjct  405  VQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQT  464

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  465  LILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  498


 Score = 56.6 bits (135),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  320  FMISVGFNAAASVRVSNELGAGHPKSAS  347



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   172 bits (435),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV + SF+ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLAL+L+LNG
Sbjct  348  SAAFSVVVVTISSFVISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLALSLILNG  407

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGFYFNL AKGIW GM+GGT MQT
Sbjct  408  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQT  467

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW--DAKRE  400
            IILLWVT RTDW KEVE AK RLN W  ++K++
Sbjct  468  IILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKQ  500


 Score = 54.3 bits (129),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG GHPKS +
Sbjct  323  FMISVGFNAAASVRVSNELGGGHPKSAA  350



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   169 bits (428),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV   SFIISVIAAI+VL  R  ISY+FT+GEVVA A SDL P LA TL+LNG
Sbjct  344  SASFSVLVVTSCSFIISVIAAIIVLIFRDSISYIFTEGEVVAKAASDLSPFLAATLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY++GVPVG VLGF F+LGAKGIW GM+GGTV+QT
Sbjct  404  IQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IIL+WVT+RTDW KEVE AK RL+ WD K +PLL
Sbjct  464  IILVWVTLRTDWDKEVESAKNRLSSWDEKGQPLL  497


 Score = 57.0 bits (136),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  319  FMISVGFNAAASVRVSNELGAGHPKSAS  346



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   174 bits (440),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  867  QDTQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALT  688
             +    AAF+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+T
Sbjct  358  SEHPKSAAFTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVT  417

Query  687  LVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGG  508
            L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGG
Sbjct  418  LILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGG  477

Query  507  TVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  478  TMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  516


 Score = 52.0 bits (123),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG+ HPKS +
Sbjct  338  FMISVGFNAAASVRVSNELGSEHPKSAA  365



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   170 bits (431),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+FSVVVV L SFIISVIAAI+V+  R  +SY+FT+GEVVA A SDL P LA TL+LNG+
Sbjct  345  ASFSVVVVTLCSFIISVIAAIIVMIFRDSMSYIFTEGEVVAKAASDLSPFLAATLILNGI  404

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGT++QT+
Sbjct  405  QPVLSGVAVGCGWQAFVAYVNVGCYYLLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTM  464

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILLWVT+RTDW KEVE AK RLN WD KR+P L +
Sbjct  465  ILLWVTLRTDWNKEVENAKNRLNTWDDKRQPPLQE  499


 Score = 55.5 bits (132),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFN AASVRVSNELGAGHPKS S
Sbjct  319  FMISVGFNTAASVRVSNELGAGHPKSAS  346



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   172 bits (436),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +SF +SV+AA++VL+LR  ISY+FT+GE VA AVSDLCPLLA ++VLNG
Sbjct  370  SAAFSVVVVTAVSFAVSVMAAMIVLSLRDYISYIFTEGETVARAVSDLCPLLAASIVLNG  429

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G +LGF F LG KGIWCG+I GTV QT
Sbjct  430  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQT  489

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILL VT RTDW KEVE AKKRL++W+ K EPLL
Sbjct  490  LILLVVTFRTDWNKEVEEAKKRLDKWEEKEEPLL  523


 Score = 53.1 bits (126),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  345  FMISVGFNAAASVRVSNELGAGNPKSAA  372



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   176 bits (446),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
                AAFSVV+V L+SFIIS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+
Sbjct  357  NHKSAAFSVVMVTLVSFIISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLI  416

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNGVQPVLSGVAVGCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT+
Sbjct  417  LNGVQPVLSGVAVGCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTL  476

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +QT+ILLWVT RTDW KEVE AK RL++W+ KR+P L
Sbjct  477  LQTLILLWVTFRTDWRKEVEKAKSRLHKWEDKRKPSL  513


 Score = 49.3 bits (116),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+ KS +
Sbjct  335  FMISVGFNAAASVRVSNELGAGNHKSAA  362



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   172 bits (437),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG
Sbjct  242  SAFFSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT
Sbjct  302  IQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
             ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  362  AILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396


 Score = 52.8 bits (125),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  217  FMISVGFNAAASVRVSNELGAGNPKSA  243



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   172 bits (436),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP LA+TL+LNG
Sbjct  242  SAAFSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLAITLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT
Sbjct  302  VQPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            +IL+WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  362  LILVWVTYRTDWSKEVGKAKQRLDKWEDXEDEPLL  396


 Score = 52.8 bits (125),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  217  FMVSVGFNAAASVRVSNELGAGNPKSAA  244



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   174 bits (441),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  33   SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNG  92

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT
Sbjct  93   IQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQT  152

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KR+++W  K++ L+ +
Sbjct  153  FILAWVTFRTDWTKEVEEASKRMDKWSDKKQELVRE  188


 Score = 51.2 bits (121),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  8    FMISVGFNAAISVRVSNELGAGNPKSAA  35



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   168 bits (426),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV   SFIISVIAAI+V+  R  ISY+FT+GEVVA A SDL P LA+T++LNG
Sbjct  346  SASFSVLVVTSCSFIISVIAAIIVMMFRDSISYIFTEGEVVAKAASDLSPFLAVTIILNG  405

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G +LGF F+LG KGIW GM+GGTV+QT
Sbjct  406  VQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQT  465

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  466  LILLWVTWRTDWNTEVEVAKNRLSSWDDKRQPLL  499


 Score = 57.0 bits (136),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  321  FMISVGFNAAASVRVSNELGAGHPKSAS  348



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   174 bits (442),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+T+VLNG
Sbjct  351  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYLFTEGKEVSDAVSDLCPLLAVTIVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQT+VA VN+GCYYV+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT
Sbjct  411  IQPVLSGVAVGCGWQTYVAKVNIGCYYVIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KE E A KR+++W  +++ ++P+
Sbjct  471  FILAWVTFRTDWSKEAEEASKRMDKWSNQKQEVVPE  506


 Score = 50.4 bits (119),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMIAVGFNAAISVRVSNELGAGNPKSAA  353



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   173 bits (439),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG
Sbjct  360  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGEKVSAAVSDLCPLLALTLVLNG  419

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY+VGVP+GA+ GFYF   AKGIW GMI GTVMQT
Sbjct  420  IQPVLSGVAVGCGWQTFVAKVNVGCYYIVGVPLGALFGFYFKFDAKGIWTGMICGTVMQT  479

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDWVKEVE A KRL++W  K+  ++P+
Sbjct  480  VILAWVTFRTDWVKEVEEASKRLDKWSNKKLEVVPE  515


 Score = 51.6 bits (122),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  335  FMISVGFNAAISVRVSNELGAGNPKSAA  362



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   173 bits (438),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  867  QDTQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALT  688
             +    AAF+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+T
Sbjct  358  SEHPKSAAFTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVT  417

Query  687  LVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGG  508
            L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF  +LGAKGIW GMIGG
Sbjct  418  LILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKNDLGAKGIWSGMIGG  477

Query  507  TVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PLL
Sbjct  478  TMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLL  516


 Score = 52.4 bits (124),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG+ HPKS +
Sbjct  338  FMISVGFNAAASVRVSNELGSEHPKSAA  365



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   173 bits (438),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +SFIISV+ A+++L LR  +SY FT+GE VA AVS+L PLLA+TL+LNG
Sbjct  365  SAAFSVVVVTTLSFIISVVTAVIILCLRDYLSYTFTEGETVAHAVSELTPLLAITLILNG  424

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT MQT
Sbjct  425  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQT  484

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  485  LILIWVTFRTDWNKEVDEAIKRLNKWEDKKQPLL  518


 Score = 52.0 bits (123),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM++VGFNAAASVRVSNELGAG+PKS +
Sbjct  340  FMVAVGFNAAASVRVSNELGAGNPKSAA  367



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   172 bits (437),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV ++S II+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG
Sbjct  334  SAFFSVWVVTVLSAIIAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNG  393

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT MQT
Sbjct  394  IQPVLSGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQT  453

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
             ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  454  AILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  488


 Score = 52.4 bits (124),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMIS+GFNAAASVRVSNELGAG+PKS 
Sbjct  309  FMISIGFNAAASVRVSNELGAGNPKSA  335



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   171 bits (432),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAF VVVV + SF+ISV+ AI+VL  RHV+SY FT G+V+A+A SDL PLLA++L+LNG
Sbjct  344  SAAFCVVVVTMSSFVISVVFAILVLLFRHVMSYAFTGGQVIAEAASDLAPLLAISLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGFYFNL AKGIW GM+GGT MQT
Sbjct  404  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IILLWVT RTDW KEVE AK RLN W +  ++PL 
Sbjct  464  IILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKPLF  498


 Score = 54.3 bits (129),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG GHPKS +
Sbjct  319  FMISVGFNAAASVRVSNELGGGHPKSAA  346



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   172 bits (435),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG
Sbjct  242  SAFFSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT
Sbjct  302  IQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
             ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  362  AILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396


 Score = 52.8 bits (125),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  217  FMISVGFNAAASVRVSNELGAGNPKSA  243



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   172 bits (435),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +   ISV+ AIV+L LR+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG
Sbjct  242  SAFFSVWVVTSLCAAISVVFAIVMLCLRNHISYLFTESEIVSDAVADLCPLLAITLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G VLGF FNLG KGIW GMIGGT MQT
Sbjct  302  IQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
             ILLWVTIRTDW KEVE A KRLN+W D K++PLL
Sbjct  362  AILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPLL  396


 Score = 52.8 bits (125),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  217  FMISVGFNAAASVRVSNELGAGNPKSA  243



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   173 bits (439),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVVVV +ISFIISVI A+V+L LR VISY FT+GE VA AVSDLCPLLAL++VLNG
Sbjct  362  SASFSVVVVTVISFIISVIVAVVILLLRDVISYAFTEGEEVAAAVSDLCPLLALSIVLNG  421

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAV+GFYF   AKGIW GM+GGTV+QT
Sbjct  422  IQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQT  481

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV  A++RLNQW+  +EPLL
Sbjct  482  LILMWVTFRTDWNKEVVEAERRLNQWEDVKEPLL  515


 Score = 50.8 bits (120),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  337  FMISVGFNAAASVRVSNELGARNPKSAS  364



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   175 bits (444),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VNL+SFII+VI AI+V+ALR+VISYVFT+GE VA+AVS+LCP LA+TL+LNG
Sbjct  267  SAAFSVVIVNLVSFIIAVIEAIIVMALRNVISYVFTEGETVANAVSELCPYLAVTLILNG  326

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT +QT
Sbjct  327  VQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIGCILGFKFDLGAKGIWSGMIGGTALQT  386

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  387  LILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  420


 Score = 48.9 bits (115),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 1/29 (3%)
 Frame = -2

Query  928  FMISVGFNAAAS-VRVSNELGAGHPKSGS  845
            FM+SVGFNAAAS VRV NELGAGHPKS +
Sbjct  241  FMVSVGFNAAASSVRVGNELGAGHPKSAA  269



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   168 bits (425),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L SFIISVI AI+VL LRHV+SY FT GE +A+A SDL PLLAL+L+LNG
Sbjct  353  SAAFSVVVVTLSSFIISVIFAILVLLLRHVMSYAFTSGETIAEAASDLAPLLALSLILNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F L AKGIW GM+GGT MQT
Sbjct  413  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGVILGFNFKLEAKGIWLGMLGGTAMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IILLWVT RT+W +EVE AK RLN W D  ++PLL
Sbjct  473  IILLWVTFRTNWEQEVEKAKSRLNMWQDQSKKPLL  507


 Score = 56.2 bits (134),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  328  FMISVGFNAAASVRVSNELGAGHPKSAA  355



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   171 bits (433),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S +I++I +IV+L LR+ +SY+FT+GEVV++AV+DLCPLLA+T++LNG
Sbjct  338  SAYFSVWVVTAVSTLITIILSIVILCLRNYVSYLFTEGEVVSNAVADLCPLLAITIILNG  397

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYYVVGVP+GA+LGF F LG KGIW GMIGGTVMQT
Sbjct  398  IQPVLSGVAVGCGWQQFVAYVNIGCYYVVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQT  457

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
             ILLWVT+RTDW KEVE A+KRLN+W D K EPLL
Sbjct  458  AILLWVTLRTDWSKEVEEAQKRLNKWEDKKTEPLL  492


 Score = 53.1 bits (126),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAG+PKS 
Sbjct  313  FMISVGFNAAASVRVSNELGAGNPKSA  339



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   172 bits (435),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +  IISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG
Sbjct  334  SAFFSVWVVTALCAIISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNG  393

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT
Sbjct  394  IQPVLTGVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQT  453

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  454  VILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  487


 Score = 52.0 bits (123),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNE+GAG+PKS 
Sbjct  309  FMISVGFNAAASVRVSNEIGAGNPKSA  335



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   167 bits (422),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV+VV   SF++SVIAAI+VL  R  ISY+FT+GEVVA A SDL P LA+TL+LNG
Sbjct  346  SASFSVLVVTSCSFVVSVIAAIIVLIFRDSISYIFTEGEVVAKAASDLSPFLAVTLILNG  405

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+LGAKGIW GM+GGTV+QT
Sbjct  406  VQPVLSGVAVGCGWQAFVAYVNVGCYYLIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQT  465

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +ILL VT RTDW KEVE AK RL+ WD K EPLL K
Sbjct  466  LILLGVTWRTDWNKEVEGAKNRLSTWDDKSEPLLQK  501


 Score = 57.0 bits (136),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  321  FMISVGFNAAASVRVSNELGAGHPKSAS  348



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   172 bits (437),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R VISY FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  382  RSVISYTFTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  441

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+WD
Sbjct  442  VVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWD  501

Query  411  AKRE  400
             K+E
Sbjct  502  DKQE  505


 Score = 51.6 bits (122),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELG+ HPKS +
Sbjct  330  FMISVGFNAAASVRVSNELGSRHPKSAA  357



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   173 bits (438),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAF+V +VN +SF+++V+ AI+VL+LRHVISY FT G  VA+AVSDLCP LA+TL+LNG
Sbjct  279  SAAFAVFMVNFVSFVVAVVEAIIVLSLRHVISYAFTSGGTVANAVSDLCPFLAVTLILNG  338

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ +VAYVNVGCYYVVG+P+G +LGF + LGAKGIW GMIGGT+MQT
Sbjct  339  VQPVLSGVAVGCGWQAYVAYVNVGCYYVVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQT  398

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+W T RTDW KEVE A++RL  WD K+EPLL
Sbjct  399  LILVWSTFRTDWNKEVEKARERLRTWDDKKEPLL  432


 Score = 50.8 bits (120),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRV NELGAG+PKS +
Sbjct  254  FMVSVGFNAAASVRVGNELGAGNPKSAA  281



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   171 bits (432),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LNGV
Sbjct  353  AAFSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILNGV  412

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+
Sbjct  413  QPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTL  472

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPLL  391
            IL+WVT RTDW KEV  AK+RL++W+ K  EPLL
Sbjct  473  ILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  506


 Score = 53.1 bits (126),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  327  FMVSVGFNAAASVRVSNELGAGNPKSAA  354



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   171 bits (434),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +  IISVI AI +L LR+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG
Sbjct  242  SAFFSVWVVTALCAIISVIFAIAILCLRNYISYLFTEGEIVSNAVADLCPLLATTLILNG  301

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G VLGF F LG KGIW GMIGGTVMQT
Sbjct  302  IQPVLTGVAVGCGWQQFVAYVNIGCYYVVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQT  361

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  362  VILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  395


 Score = 52.0 bits (123),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNE+GAG+PKS 
Sbjct  217  FMISVGFNAAASVRVSNEIGAGNPKSA  243



>ref|XP_012091357.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Jatropha curcas]
Length=510

 Score =   167 bits (422),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+VN  SF+I++I AI+VL  R+ +SY+FT G  VADAV++L P LAL+++LNG
Sbjct  354  SAAFSVVIVNFSSFVIALIIAILVLVFRNELSYIFTGGTTVADAVAELSPYLALSIILNG  413

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT++QT
Sbjct  414  IQPVLSGVAVGCGWQAFVAYVNVGCYYFVGLPLGGILGFVFDLGAKGIWSGMLGGTILQT  473

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +ILLWVT RTDW KEVEVA+ RL +WD   EPL+ +
Sbjct  474  LILLWVTFRTDWNKEVEVARIRLQRWDDVTEPLVTR  509


 Score = 56.6 bits (135),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS +
Sbjct  329  FMISVGFNAAASVRVSNELGAGHPKSAA  356



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   173 bits (438),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+FSV+VV  +SF +S + A+ VL LR  +SY+FT GE VA AVSDLCPLLALTLVLNGV
Sbjct  358  ASFSVLVVTSLSFAVSAVCAVAVLCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGV  417

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQT  493
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT
Sbjct  418  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  478  LILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  511


 Score = 50.1 bits (118),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAG+P++ S
Sbjct  332  FMISVGFNAAASVRVGNELGAGNPRAAS  359



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   167 bits (424),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S +ISV+ +IV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG
Sbjct  341  SAYFSVWVVTAVSTLISVMLSIVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNG  400

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT
Sbjct  401  IQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQT  460

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  391
             ILLWVT+RTDW KEVE A+KRL++W+ K+  EPLL
Sbjct  461  AILLWVTLRTDWNKEVEEAQKRLHKWEDKKTTEPLL  496


 Score = 55.5 bits (132),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVGFNAAASVRVSNELGAGHPKS
Sbjct  316  FMISVGFNAAASVRVSNELGAGHPKS  341



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   177 bits (449),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
             +  AAFSVVV     FIISVI AI++LALRHVISY FT+GE VADAVSDLCPLLA+T+V
Sbjct  346  NERSAAFSVVVATSSCFIISVIIAIILLALRHVISYAFTEGEYVADAVSDLCPLLAITVV  405

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+GA+LGF F+LGAKGIW GMIGGT+
Sbjct  406  LNGIQPVLSGVAVGCGWQVFVAYVNVGCYYFVGIPLGALLGFKFDLGAKGIWSGMIGGTL  465

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            MQTIILLWV  RTDW +EVE A KRLN+W+ K +
Sbjct  466  MQTIILLWVACRTDWKREVEEAAKRLNKWEDKHK  499


 Score = 45.4 bits (106),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S+GFNAA SVRVSNELGAG+ +S +
Sbjct  324  FMVSLGFNAAVSVRVSNELGAGNERSAA  351



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   169 bits (428),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV +++FIISVI A+ VL LR  +SY+FT+GE VA AVS+L PLL+LT++LNG
Sbjct  366  SAAFSVMVVTILAFIISVIIAVAVLCLRDYLSYIFTEGETVAHAVSELAPLLSLTIILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNV CYY+VGVP+G +LGF FN GAKGIW GMIGGT+MQT
Sbjct  426  IQPVLSGVAVGCGWQTFVAYVNVTCYYLVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEV+ A KRL++W+ K++ LL
Sbjct  486  VILLWVTFRTDWNKEVDQALKRLDKWEDKKQHLL  519


 Score = 53.5 bits (127),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   172 bits (436),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+FSV+VV  +SF +S + A+ VL LR  +SY+FT GE VA AVSDLCPLLALTLVLNGV
Sbjct  308  ASFSVLVVTSLSFAVSAVCAVAVLCLRDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGV  367

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQT  493
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKGIW GM IGGT+MQT
Sbjct  368  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQT  427

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE A+ RL++WD K++PLL
Sbjct  428  LILLWVTFRTDWTKEVENARARLDKWDDKKQPLL  461


 Score = 50.1 bits (118),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAG+P++ S
Sbjct  282  FMISVGFNAAASVRVGNELGAGNPRAAS  309



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   171 bits (434),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +SFIISVI A+V+L LR  +SY+FT+GE VA AVS+L PLLA+T++LNG
Sbjct  335  SAAFSVVVVTALSFIISVIIAVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITIILNG  394

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF FNLGAKGIW GMIGGT MQT
Sbjct  395  IQPVLSGVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQT  454

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  455  VILIWVTFRTDWNKEVDEAIKRLNKWEDEKQPLL  488


 Score = 50.8 bits (120),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             MIS+GFNAAASVRVSNELGAG+PKS +
Sbjct  310  LMISIGFNAAASVRVSNELGAGNPKSAA  337



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   169 bits (429),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVV+VNLISF+ISVI A++V+ALR+VISY FT+GE VA AVS+LCPLLA++LVLNG+
Sbjct  352  AAFSVVIVNLISFVISVIEAVIVIALRNVISYAFTEGETVAKAVSELCPLLAVSLVLNGI  411

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGA+GIW GM+GGT MQTI
Sbjct  412  QPVLSGVAVGCGWQKFVAYVNVGCYYVVGIPIGCLLGFKFHLGAQGIWSGMLGGTTMQTI  471

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            ILLWVT   DW  EVE A+ RL++W+  +EPL
Sbjct  472  ILLWVTFHADWNAEVEKARMRLDKWEDSKEPL  503


 Score = 52.8 bits (125),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  326  FMVSVGFNAAASVRVSNELGAGNPKSAA  353



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   170 bits (430),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -3

Query  855  SRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLN  676
              AAFSVV+VNL+SFII+VI AIVVL+LRHVISY FT G  VA  VSDLCP L +TL+LN
Sbjct  64   KSAAFSVVLVNLVSFIIAVIEAIVVLSLRHVISYAFTGGATVAKEVSDLCPFLVITLILN  123

Query  675  GVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQ  496
            GVQPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G VLGF F+LGAKGIW GMIGGTVMQ
Sbjct  124  GVQPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQ  183

Query  495  TIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            T+IL+WVT RTDW KEV  AK+RL++W D + EPLL
Sbjct  184  TLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPLL  219


 Score = 52.8 bits (125),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  40   FMVSVGFNAAASVRVSNELGAGNPKSAA  67



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   168 bits (425),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV ++SF +SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG
Sbjct  366  SAAFSVVVVTVLSFFLSVVISLVILLCRDYISYIFTDGEDVATAVSKLTPLLALTLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  426  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL+WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  486  LILMWVTFRTNWNREVEEAMKRLNKWEDK-TPLLSE  520


 Score = 53.5 bits (127),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   172 bits (437),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  858  QSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVL  679
               AAFSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+L
Sbjct  343  SKSAAFSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLIL  402

Query  678  NGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVM  499
            NG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVM
Sbjct  403  NGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVM  462

Query  498  QTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            QT+ILLWVT RTDW KEVE AKKRL++W+  + PL
Sbjct  463  QTVILLWVTFRTDWNKEVECAKKRLDKWENLKGPL  497


 Score = 48.9 bits (115),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM++VGFNAAASVRVSNELGA H KS +
Sbjct  320  FMVAVGFNAAASVRVSNELGAAHSKSAA  347



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   172 bits (436),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
                AAFSV +V L+SFII++I A  +L+LRHVISYVFT GE VA+AVS+LCPLLA+TL+
Sbjct  352  NHKSAAFSVAMVTLVSFIIALIEAGAILSLRHVISYVFTGGETVANAVSELCPLLAVTLI  411

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT+
Sbjct  412  LNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCLIGFKFDLGVKGIWSGMIGGTL  471

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            +QT+ILLWVT RTDW KEVE AK RL++W+ KR
Sbjct  472  LQTLILLWVTFRTDWKKEVEKAKSRLHKWEDKR  504


 Score = 49.3 bits (116),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+ KS +
Sbjct  330  FMISVGFNAAASVRVSNELGAGNHKSAA  357



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   167 bits (424),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV ++SFI+SV+ ++V+L  R  ISY+FTDGE VA AVS L PLLALTL+LNG
Sbjct  366  SAAFSVVVVTVLSFILSVVISLVILLCRDYISYIFTDGEDVAAAVSKLTPLLALTLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  426  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL+WVT RT+W +EVE A KRLN+W+ K  PLL +
Sbjct  486  LILMWVTFRTNWNREVEEAMKRLNKWEDK-TPLLSE  520


 Score = 53.9 bits (128),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   172 bits (435),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV  +S IIS+I A++V+  R VISY+FTDGE VA AVSDLCPLLALTLVLNG
Sbjct  359  SAAFSVLVVVALSTIISIICALLVIIFRDVISYIFTDGEAVAAAVSDLCPLLALTLVLNG  418

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVL+GVAVGCGWQ FVAYVN+GCYY+VGVP+G++LGFYFN GAKGIW G++GGT MQT
Sbjct  419  VQPVLTGVAVGCGWQAFVAYVNIGCYYIVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQT  478

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRL++WD   +P++
Sbjct  479  VILVWVTWRTDWNKEVDEAIKRLSKWDDTAKPVV  512


 Score = 49.7 bits (117),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            +MI+VGFNAAASVRVSNELG+G+PKS +
Sbjct  334  YMIAVGFNAAASVRVSNELGSGNPKSAA  361



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   166 bits (419),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+F+V VV   SFII+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG
Sbjct  350  SASFAVFVVTSTSFIIAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT
Sbjct  410  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  470  LILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  503


 Score = 55.5 bits (132),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVRVSNE+GAGHPKS S
Sbjct  325  FMIAVGFNAAASVRVSNEIGAGHPKSAS  352



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   167 bits (424),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV ++SFI+SVI ++V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG
Sbjct  358  SAAFSVLVVTVLSFILSVIISVVILLCRDYISYIFTEGEDVSRAVSQLTPLLAFTLILNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  418  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RT+WVKEVE A+KRLN+W+ ++ PLL
Sbjct  478  LILIWVTFRTNWVKEVEEAQKRLNKWE-EKSPLL  510


 Score = 53.5 bits (127),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  333  FMISVGFNAAASVRVSNELGAGNPKSAA  360



>ref|XP_012091359.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Jatropha curcas]
 gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   170 bits (430),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SFII+VI A+VVL LR+VISY FT+GE VA AVS+L PLLA+ L+LNG
Sbjct  351  SAAFSVVVVTLVSFIIAVIEAVVVLCLRNVISYAFTEGETVAKAVSELSPLLAVALLLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG VLGF F+ GAKGIW GMIGGTVMQT
Sbjct  411  IQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            IILLWVT RTDW+KEVE AK RL++WD  ++ L
Sbjct  471  IILLWVTFRTDWIKEVEKAKMRLDKWDDDKQTL  503


 Score = 51.2 bits (121),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELG G+PKS +
Sbjct  326  FMVSVGFNAAASVRVSNELGGGNPKSAA  353



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   170 bits (431),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+
Sbjct  355  AAFSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGI  414

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+
Sbjct  415  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTL  474

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  475  ILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507


 Score = 50.8 bits (120),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+P++ +
Sbjct  329  FMISVGFNAAASVRVSNELGAGNPRAAA  356



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   167 bits (424),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV VV LISF+I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNG
Sbjct  344  SAAFSVFVVTLISFLIAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGTVMQT
Sbjct  404  VQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             IL+W T R DW KEVE AKK L++W+  +E L
Sbjct  464  FILIWFTFRADWNKEVEKAKKHLDKWENVKETL  496


 Score = 53.5 bits (127),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGA HPKS +
Sbjct  319  FMVSVGFNAAASVRVSNELGAAHPKSAA  346



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   169 bits (428),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY FTDGE V+ AVSDLCPLLA+TLVLNG
Sbjct  353  SAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTDGETVSAAVSDLCPLLAITLVLNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  413  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDW KEVE A KRL+ W  K+  ++P+
Sbjct  473  VILAWVTFRTDWTKEVEEASKRLDIWSNKKLEVVPE  508


 Score = 52.0 bits (123),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  328  FMISVGFNAAISVRVSNELGAGNPKSAA  355



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   170 bits (431),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+
Sbjct  357  AAFSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGI  416

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+
Sbjct  417  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTL  476

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  477  ILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509


 Score = 50.8 bits (120),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+P++ +
Sbjct  331  FMISVGFNAAASVRVSNELGAGNPRAAA  358



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   167 bits (424),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV L SF+ISV+AA+ VL LR+VISY FT GE VA AVS LCPLLA++L+LNG
Sbjct  360  SAAFSVLVVTLTSFLISVVAAVAVLVLRNVISYAFTGGEAVAQAVSGLCPLLAISLMLNG  419

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G++LGFYF  GAKGIW G++GGT+MQT
Sbjct  420  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQT  479

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+ V +RTDW KEVE A +RL+QW+ K+EPLL +
Sbjct  480  IILIVVMVRTDWNKEVEKALERLDQWEDKKEPLLKE  515


 Score = 53.1 bits (126),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            +MISVGFNAAASVRV NELGAGHPKS +
Sbjct  335  YMISVGFNAAASVRVGNELGAGHPKSAA  362



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   168 bits (426),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV  +S IISVI A+V+L LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG
Sbjct  365  SAAFSVMVVTALSSIISVIIAVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITLILNG  424

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNV CYY+VG+P+GA+LGF F+LGAKGIW GMIGGT +QT
Sbjct  425  IQPVLSGVAVGCGWQAFVAYVNVACYYIVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQT  484

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  485  LILIWVTFRTDWNKEVYEATKRLNKWEDKKQPLL  518


 Score = 52.4 bits (124),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVRVSNELGAG+PKS +
Sbjct  340  FMIAVGFNAAASVRVSNELGAGNPKSAA  367



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   167 bits (424),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV VV LISF+I+V+ AI+VL LR+VISY FT+GE+VA+AVSDLCP LA+TL+LNG
Sbjct  344  SAAFSVFVVTLISFLIAVVEAIIVLCLRNVISYAFTEGEIVANAVSDLCPFLAVTLILNG  403

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF ++LGAKGIW GMIGGT+MQT
Sbjct  404  VQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKYDLGAKGIWTGMIGGTIMQT  463

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             IL+W T R DW KEVE AKK L++W+  +E L
Sbjct  464  FILIWFTFRADWNKEVEKAKKHLDKWENVKETL  496


 Score = 53.5 bits (127),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGA HPKS +
Sbjct  319  FMVSVGFNAAASVRVSNELGAAHPKSAA  346



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   165 bits (418),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+F+V VV   SFII+V  AI+V+ LRHV+SYVFT G  VADAVSDL P LA+++VLNG
Sbjct  277  SASFAVFVVTSTSFIIAVFLAILVMLLRHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNG  336

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+GA+LGF F+LG KGIW GMIGGTVMQT
Sbjct  337  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQT  396

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  397  LILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  430


 Score = 55.5 bits (132),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVRVSNE+GAGHPKS S
Sbjct  252  FMIAVGFNAAASVRVSNEIGAGHPKSAS  279



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   176 bits (446),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVV+VN++SFII+VI AIVVLALRHVISYVFT+GE VA+AVSDLCP LA+TL+LNG+
Sbjct  349  AAFSVVIVNMVSFIIAVIEAIVVLALRHVISYVFTEGETVANAVSDLCPYLAVTLILNGI  408

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ  VAY+NVGCYY VGVPVG VLGF FNLG KGIW GMIGGTV+QT+
Sbjct  409  QPVLSGVAVGCGWQAIVAYINVGCYYGVGVPVGCVLGFKFNLGVKGIWSGMIGGTVLQTL  468

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWD  412
            ILLW+T RTDW+KEV  AKKRL++W+
Sbjct  469  ILLWITFRTDWIKEVNTAKKRLDKWE  494


 Score = 44.7 bits (104),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  922  ISVGFNAAASVRVSNELGAGHPKSGS  845
            I VGFNAAASVRVSNELG+G+PK+ +
Sbjct  325  IGVGFNAAASVRVSNELGSGNPKAAA  350



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   169 bits (428),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV  +S   +V+ A+VVL+LR VISY FT GE VA AVS L P LA+TL+LNG
Sbjct  353  SAAFSVIVVTSVSLAFAVLEAVVVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT
Sbjct  413  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE AK R+ +WD K++PLL
Sbjct  473  LILLWVTFRTDWDKEVENAKSRVEKWDDKKQPLL  506


 Score = 51.6 bits (122),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELG+G+PKS +
Sbjct  328  FMVSVGFNAAASVRVSNELGSGNPKSAA  355



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   165 bits (417),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  IS IIS++ AIV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG
Sbjct  333  SAYFSVWVVTAISTIISIMLAIVILCLRNYISYIFTEGEVVSNAVADLCPLLAITLILNG  392

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GA+LGF F  G KGIW GMIGGT MQT
Sbjct  393  IQPVLSGVAVGCGWQEFVAYVNIGCYYIVGVPLGAILGFVFKFGVKGIWSGMIGGTFMQT  452

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR----EPLL  391
             ILLW T+RTDW KEVE A+KRL++W+ ++    EPLL
Sbjct  453  AILLWATLRTDWNKEVEEAQKRLHKWEDQKTTTTEPLL  490


 Score = 55.5 bits (132),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMISVGFNAAASVRVSNELGAGHPKS 
Sbjct  308  FMISVGFNAAASVRVSNELGAGHPKSA  334



>ref|XP_012091362.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Jatropha curcas]
Length=503

 Score =   167 bits (424),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            RHVISY FT+GE VA AVS+LCPLLA++L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  378  RHVISYAFTEGETVAKAVSELCPLLAVSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  437

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VG+P+G VLGF F+ GAKGIW GM+GGT MQT+ILLWVT RTDW+KEVE AK RL++W+
Sbjct  438  FVGIPLGCVLGFKFDFGAKGIWSGMLGGTTMQTLILLWVTFRTDWIKEVEKAKIRLDKWE  497

Query  411  AKREPL  394
              +E L
Sbjct  498  DNKEAL  503


 Score = 52.8 bits (125),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  326  FMVSVGFNAAASVRVSNELGAGNPKSAA  353



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   171 bits (433),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
                A+FSVVVV +ISFII  I A+VVLALR VISYVFT+GE VA AVSDL PLLAL +V
Sbjct  361  NSKSASFSVVVVTVISFIICAIIALVVLALRDVISYVFTEGEEVAAAVSDLSPLLALAIV  420

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+GAVLGFYF  GAKGIW GM+GGTV
Sbjct  421  LNGVQPVLSGVAVGCGWQTFVAYVNVGCYYGLGIPLGAVLGFYFKFGAKGIWLGMLGGTV  480

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +QTIIL+WVT RTDW  EV  + KRLN+W+ K E LL
Sbjct  481  LQTIILMWVTFRTDWNNEVVESNKRLNKWEGKTESLL  517


 Score = 48.9 bits (115),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGF AAASVRVSNELGAG+ KS S
Sbjct  339  FMISVGFQAAASVRVSNELGAGNSKSAS  366



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   167 bits (424),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV++VN+ S I  VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG
Sbjct  356  SASFSVIIVNIYSLITCVILAIVILAFRDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  416  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTLIQT  475

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL W+T RTDW KEVE + KRL++W  K+  ++P+
Sbjct  476  VILAWITFRTDWTKEVEESAKRLDKWSNKKPEVVPE  511


 Score = 52.8 bits (125),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS S
Sbjct  331  FMISVGFNAAISVRVSNELGAGNPKSAS  358



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   166 bits (421),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VV   S II++I AI+++ LR  ISY+FT G VVA+AVSDL P+LA++LVLNG+
Sbjct  353  AAFSVLVVTASSTIIAIIFAIIIMLLRDKISYMFTGGTVVAEAVSDLAPILAISLVLNGI  412

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVG YY +G+P+GAVLGF F LGAKGIW GM+GGT +QTI
Sbjct  413  QPVLSGVAVGCGWQAFVAYVNVGSYYFLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTI  472

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            IL+WVT+RTDW KEVE+A+ RLN+W+ K+E
Sbjct  473  ILIWVTVRTDWNKEVEIARGRLNRWEDKKE  502


 Score = 53.5 bits (127),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVRVSNELGAGHP+S +
Sbjct  327  FMIAVGFNAAASVRVSNELGAGHPRSAA  354



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   171 bits (433),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  858  QSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVL  679
               AAFSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GE+VA  VS+LCP LA+TL+L
Sbjct  343  SKSAAFSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEIVAKEVSELCPFLAVTLIL  402

Query  678  NGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVM  499
            NG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+LGAKGIW GMIGGTVM
Sbjct  403  NGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDLGAKGIWTGMIGGTVM  462

Query  498  QTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            QT+ILLWVT RTDW K+VE AKKRL++W+  + PL
Sbjct  463  QTVILLWVTFRTDWNKKVECAKKRLDKWENLKGPL  497


 Score = 48.9 bits (115),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM++VGFNAAASVRVSNELGA H KS +
Sbjct  320  FMVAVGFNAAASVRVSNELGAAHSKSAA  347



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   167 bits (423),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV ++S II+V+ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG
Sbjct  334  SAFFSVWVVTVLSAIIAVVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNG  393

Query  672  VQPVLS---GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            +QPVLS   GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT 
Sbjct  394  IQPVLSEISGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTA  453

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            MQT ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  454  MQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491


 Score = 52.4 bits (124),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMIS+GFNAAASVRVSNELGAG+PKS 
Sbjct  309  FMISIGFNAAASVRVSNELGAGNPKSA  335



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   165 bits (418),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S +IS++ AIV+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG
Sbjct  331  SAYFSVWVVTGVSTLISLVLAIVILCLRNYISYIFTEGEVVSNAVADLCPLLAITLVLNG  390

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+GA+LGF F LG KGIW GMIGGT MQT
Sbjct  391  IQPVLSGVAVGCGWQEFVAYVNVGCYYIVGVPLGAILGFVFKLGVKGIWSGMIGGTFMQT  450

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQW-DAK-REPLL  391
             IL+W T+RTDW KEVE A+KRLN+W D+K  EPLL
Sbjct  451  AILVWATLRTDWNKEVEEAQKRLNKWADSKTTEPLL  486


 Score = 54.3 bits (129),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMI+VGFNAAASVRVSNELGAGHPKS 
Sbjct  306  FMIAVGFNAAASVRVSNELGAGHPKSA  332



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   167 bits (423),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GEVVA  VS LCP LA+TL+LNG+
Sbjct  346  AAFSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEVVAKEVSSLCPYLAVTLILNGI  405

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G +LGF F+ GAKGIW GMIGGTVMQTI
Sbjct  406  QPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTI  465

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            ILLWVT  TDW KEVE A+KRL++W+  + PL
Sbjct  466  ILLWVTFSTDWNKEVESARKRLDKWENLKGPL  497


 Score = 52.4 bits (124),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM++VGFNAAASVRVSNELGA HPKS +
Sbjct  320  FMVAVGFNAAASVRVSNELGAAHPKSAA  347



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   165 bits (417),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV  +S +IS++  ++VL LR+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG
Sbjct  286  SAYFSVWVVTALSTLISIMLGVLVLCLRNYISYLFTEGEVVSNAVADLCPLLAVTLVLNG  345

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+GAVLGF F LG KGIW GMIGGT MQT
Sbjct  346  IQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQT  405

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EPLL  391
             IL+WVT+RTDW KEVE A+ RL++W+A +  EPLL
Sbjct  406  AILVWVTLRTDWNKEVEEAQNRLHKWEANKTTEPLL  441


 Score = 54.3 bits (129),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 25/27 (93%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMI+VGFNAAASVRVSNELGAGHPKS 
Sbjct  261  FMIAVGFNAAASVRVSNELGAGHPKSA  287



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   170 bits (430),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 133/162 (82%), Gaps = 5/162 (3%)
 Frame = -3

Query  861  TQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLV  682
                AAFSVV+V L+SFIIS+I A  +LA RHVISYVFT GE VA+AVSDLCPLLA+TL+
Sbjct  357  NHKSAAFSVVMVTLVSFIISLIEAGAILARRHVISYVFTGGETVANAVSDLCPLLAVTLI  416

Query  681  LNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            LNGVQPVLSGVAVGCGWQ  VAYVNVGCYYVVG+P G ++GF F+LG KGIW GMIGGT+
Sbjct  417  LNGVQPVLSGVAVGCGWQASVAYVNVGCYYVVGIPFGCLMGFKFDLGVKGIWSGMIGGTL  476

Query  501  MQTIILLWVTIRTDWVKE-----VEVAKKRLNQWDAKREPLL  391
            +QT+ILLWVT RTDW KE     VE AK RL++W+ KR+P L
Sbjct  477  LQTLILLWVTFRTDWRKEMFQFQVEKAKSRLHKWEDKRKPSL  518


 Score = 49.3 bits (116),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+ KS +
Sbjct  335  FMISVGFNAAASVRVSNELGAGNHKSAA  362



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   168 bits (425),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV VV L+SFIIS IAA+VVL LR VISYVFT+GE VA AVSDLCPLL+L+L+LNG
Sbjct  348  SASFSVKVVTLMSFIISAIAALVVLVLRDVISYVFTEGEAVAAAVSDLCPLLSLSLLLNG  407

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNV CYY VG+P+GAVLGFYF  GAKGIW GM+GGT MQT
Sbjct  408  IQPVLSGVAVGCGWQAFVAYVNVACYYGVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQT  467

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  468  VILMWVTFRTDWNKEVQEADKRLNKWEDKKEPLL  501


 Score = 51.2 bits (121),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA +PKS S
Sbjct  323  FMISVGFNAAASVRVSNELGARNPKSAS  350



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   167 bits (424),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AI++LA R V+SY FT+GE V+ AVSDLCPLLA+TLVLNG
Sbjct  358  SAAFSVIIVNIYSLITCVILAIIILACRDVLSYAFTEGENVSAAVSDLCPLLAVTLVLNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  418  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKFDAKGIWTGMICGTIIQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDW KEVE A KRL+ W  K+  ++P+
Sbjct  478  VILAWVTFRTDWTKEVEEASKRLDVWSNKKTEVVPE  513


 Score = 51.6 bits (122),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  333  FMISVGFNAAISVRVSNELGAGNPKSAA  360



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   170 bits (430),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV VV  ISF+I+V+ AI+VL LR+VISY FT+GE VA+AVSDLCP LA+TL+L+GV
Sbjct  350  AAFSVFVVTFISFLIAVVEAIIVLCLRNVISYAFTEGETVANAVSDLCPFLAVTLILSGV  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QP+ SGVAVGCGWQ FVAYVNVGC Y VG+PVG +LGF F+LGAKGIW GMIGGTVMQTI
Sbjct  410  QPIFSGVAVGCGWQAFVAYVNVGCNYAVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            ILLW T RTDW KEVE A+ RL++W   +EPL
Sbjct  470  ILLWFTYRTDWNKEVEKARTRLDKWGNVKEPL  501


 Score = 48.9 bits (115),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S+ FNAAASVRVSNELGA HPKS +
Sbjct  324  FMVSMVFNAAASVRVSNELGAAHPKSAA  351



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   167 bits (422),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A FSV VV +   IIS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+
Sbjct  340  AYFSVWVVTISCAIISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGI  399

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT 
Sbjct  400  QPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTA  459

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IL+WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  460  ILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493


 Score = 51.6 bits (122),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVGFNAAASVRVSNELGAG+PK+
Sbjct  314  FMISVGFNAAASVRVSNELGAGNPKA  339



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   167 bits (422),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A FSV VV +   IIS I A+V+L LR+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+
Sbjct  340  AYFSVWVVTISCAIISAILAVVILCLRNYISYLFTEGEVVSNAVADLCPLLAITLILNGI  399

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G +LGF F LG KGIW GM+GGT MQT 
Sbjct  400  QPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTA  459

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            IL+WVT+RTDW  EVE A+KRLN+W D K+EPLL
Sbjct  460  ILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPLL  493


 Score = 51.6 bits (122),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVGFNAAASVRVSNELGAG+PK+
Sbjct  314  FMISVGFNAAASVRVSNELGAGNPKA  339



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   165 bits (417),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV  +SFIISVI  +V+L LR  +SY+FT+GE VA AVS+L PLLA+TL+LNG
Sbjct  366  SAAFSVVVVTALSFIISVIIGVVILCLRDYLSYIFTEGETVAHAVSELTPLLAITLILNG  425

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGF FNLGAKGIW GMIGGT +QT
Sbjct  426  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQT  485

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RTDW KEV+ A KRLN+W+  ++ LL
Sbjct  486  LILIWVTFRTDWNKEVDEAIKRLNKWEDNKKALL  519


 Score = 53.5 bits (127),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  341  FMISVGFNAAASVRVSNELGAGNPKSAA  368



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AIV+LA R V+SY+FT+G+ V+DAVSDLCPLLA+TLVLNG
Sbjct  283  SAAFSVIIVNIYSLITCVILAIVILASRDVLSYLFTEGKEVSDAVSDLCPLLAVTLVLNG  342

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT
Sbjct  343  IQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQT  402

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
             IL WVT RTDW KEVE A KR+++W  +++ ++P+
Sbjct  403  FILAWVTFRTDWNKEVEEASKRMDKWSNQKQEVVPE  438



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   170 bits (431),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  411  AKREPLLPKT  382
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497


 Score = 47.8 bits (112),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPK  854
            MIS+GFNAAASVRV NELGAGHP+
Sbjct  317  MISIGFNAAASVRVGNELGAGHPR  340



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   164 bits (415),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSVV V  +SF+++++ AI+VL  R+ +SY+FT G  V++AV+DL P LA++++LNG
Sbjct  354  SASFSVVAVTTLSFLVALVFAILVLIFRYELSYIFTGGTEVSEAVADLSPFLAISILLNG  413

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ+FVAYVNV CYYVVG+PVG +LGFYF LG KGIW GMIGGTV+QT
Sbjct  414  IQPVLSGVAVGCGWQSFVAYVNVACYYVVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQT  473

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEVE A  RL++W+A +EPLL
Sbjct  474  VILLWVTFRTDWQKEVEKAASRLDKWEAVKEPLL  507


 Score = 53.9 bits (128),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGA HPKS S
Sbjct  329  FMISVGFNAAASVRVSNELGARHPKSAS  356



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   170 bits (430),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  269  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  328

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  329  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  388

Query  411  AKREPLLPKT  382
             K++PLL  T
Sbjct  389  DKKQPLLAGT  398


 Score = 47.8 bits (112),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPK  854
            MIS+GFNAAASVRV NELGAGHP+
Sbjct  218  MISIGFNAAASVRVGNELGAGHPR  241



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   165 bits (418),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A FSV VV ++S II+++ A+V++  R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG
Sbjct  334  SAFFSVWVVTVLSAIIAIVLAVVIMCFRNYISYIFTEGERVSDAVADLCPLLAITIILNG  393

Query  672  VQPVLS---GVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTV  502
            +QPVLS   GVAVGCGWQ FVAYVNVGCYY+VGVP+G +LGF FN G KG+W GMIGGT 
Sbjct  394  IQPVLSEISGVAVGCGWQQFVAYVNVGCYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTA  453

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPLL  391
            +QT ILLWVTIRTDW KEVE A+KRLN+W D K+EPLL
Sbjct  454  IQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPLL  491


 Score = 52.4 bits (124),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FMIS+GFNAAASVRVSNELGAG+PKS 
Sbjct  309  FMISIGFNAAASVRVSNELGAGNPKSA  335



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  855  SRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLN  676
              AAFSV +V  ISF+I+V+ AI+VL+LR+VISY FT+GEVVA  VS+LCP LA+TL+LN
Sbjct  15   KSAAFSVFMVTFISFLIAVVEAIIVLSLRNVISYAFTEGEVVAKEVSELCPYLAVTLILN  74

Query  675  GVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQ  496
            G+QPVLSGVAVGCGWQTFVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGT+MQ
Sbjct  75   GIQPVLSGVAVGCGWQTFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQ  134

Query  495  TIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            TIILLWVT RTDW KEVE AKKRL++W+
Sbjct  135  TIILLWVTFRTDWNKEVESAKKRLDKWE  162



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   167 bits (423),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV L+SF++SV+ + V+L     ISY+FT+GE V+ AVS L PLLA TL+LNG+
Sbjct  355  AAFSVVVVTLLSFVLSVLVSAVILLCGDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGI  414

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+
Sbjct  415  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTL  474

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  475  ILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507


 Score = 50.8 bits (120),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+P++ +
Sbjct  329  FMISVGFNAAASVRVSNELGAGNPRAAA  356



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   170 bits (430),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  411  AKREPLLPKT  382
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497


 Score = 47.8 bits (112),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPK  854
            MIS+GFNAAASVRV NELGAGHP+
Sbjct  317  MISIGFNAAASVRVGNELGAGHPR  340



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   166 bits (420),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV L+S   +V+ A+VVL+LR VISY FT GE VA AVS L P LA+TLVLNG
Sbjct  353  SAAFSVIVVTLVSLAFAVVEAVVVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLVLNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT+MQT
Sbjct  413  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT RTDW KEV+ AK R+ +WD K +PLL
Sbjct  473  LILLWVTFRTDWDKEVDNAKSRVEKWDDKEQPLL  506


 Score = 51.6 bits (122),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELG+G+PKS +
Sbjct  328  FMVSVGFNAAASVRVSNELGSGNPKSAA  355



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   167 bits (423),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   167 bits (423),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF+++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTSVSFLLAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   167 bits (423),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF+++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTSVSFLLAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVVVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   167 bits (422),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF+++V  A+VV++ R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTSVSFLLAVFEAVVVMSWRNVISYVFTDSPIVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   165 bits (418),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGV
Sbjct  347  AAFSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  467  ILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499


 Score = 51.6 bits (122),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PK+ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPKAAA  348



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   165 bits (418),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGV
Sbjct  347  AAFSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  467  ILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499


 Score = 51.6 bits (122),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+PK+ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPKAAA  348



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   163 bits (412),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SFI+++  A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNG+
Sbjct  305  AAFSTVVTTGVSFILALFEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGI  364

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  365  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTI  424

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VTIRTDW KEVE A +RL+QW+  + PLL +
Sbjct  425  ILLIVTIRTDWDKEVETASRRLDQWEGSQAPLLKQ  459


 Score = 53.9 bits (128),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAGHP+S +
Sbjct  279  FMVSVGFNAAASVRVSNELGAGHPRSAA  306



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   166 bits (421),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +L+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  VLVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   162 bits (411),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SFI+++  A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNG+
Sbjct  350  AAFSTVVTTGVSFILALFEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGI  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  410  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VTIRTDW KEVE A +RL+QW+  + PLL +
Sbjct  470  ILLIVTIRTDWDKEVETASRRLDQWEDSQAPLLKQ  504


 Score = 54.3 bits (129),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAGHP+S +
Sbjct  324  FMVSVGFNAAASVRVSNELGAGHPRSAA  351



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   163 bits (412),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            RH ISY FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  365  RHYISYAFTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  424

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W+
Sbjct  425  FVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWE  484

Query  411  AKREPLLPK  385
              ++PLL  
Sbjct  485  DNKQPLLSN  493


 Score = 53.5 bits (127),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAGHPKS  
Sbjct  313  FMISVGFNAAASVRVGNELGAGHPKSAE  340



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   165 bits (417),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I SVI AI+V   R V+SY FT+GE V+ AVSDLCP LA+TLVLNG
Sbjct  351  SAAFSVIIVNIYSLITSVILAIIVWLCRDVLSYAFTEGEEVSAAVSDLCPFLAVTLVLNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G + GFYF   AKGIW GMIGGT++QT
Sbjct  411  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPIGTLFGFYFEYDAKGIWTGMIGGTLIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            +IL+WV +RTDW KEVE A KRL++W  K+
Sbjct  471  VILVWVILRTDWTKEVEKASKRLDKWSNKK  500


 Score = 51.6 bits (122),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  326  FMISVGFNAAISVRVSNELGAGNPKSAA  353



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   167 bits (423),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV +V  +SFI + + A+VVL LR  +SY FT GE VA AVSDLCPLLA TLVLNG+
Sbjct  357  AAFSVFMVTSLSFIAATVCAVVVLCLRDQLSYFFTGGEAVARAVSDLCPLLAATLVLNGI  416

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQT  493
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G  LGFY +LGAKG+W GM IGGT+ QT
Sbjct  417  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQT  476

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLWVT+RTDW KEVE AK RL++WD K++PLL
Sbjct  477  LILLWVTVRTDWNKEVENAKARLDKWDDKKQPLL  510


 Score = 48.9 bits (115),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAG+P++ +
Sbjct  331  FMISVGFNAAASVRVGNELGAGNPRAAA  358



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   165 bits (418),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+
Sbjct  355  AAFSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGI  414

Query  669  Q--PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQ  496
            Q  PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQ
Sbjct  415  QLQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQ  474

Query  495  TIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  475  TLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509


 Score = 50.8 bits (120),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+P++ +
Sbjct  329  FMISVGFNAAASVRVSNELGAGNPRAAA  356



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   163 bits (413),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAF+VVVV   SFIISV+ AI+VL LRH ISYVFT+GE V++AVSDL P LA+++VLNG
Sbjct  349  SAAFAVVVVTSSSFIISVVCAIIVLVLRHDISYVFTEGETVSNAVSDLSPYLAISIVLNG  408

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+ GA+GIW GMIGGT +QT
Sbjct  409  IQPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQT  468

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            IIL+WVT RTDW KEVE A+ RLN ++ K+EP
Sbjct  469  IILVWVTYRTDWNKEVEKAQSRLNTYEDKKEP  500


 Score = 52.4 bits (124),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVR+ NELGAGHPKS +
Sbjct  324  FMIAVGFNAAASVRIGNELGAGHPKSAA  351



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   166 bits (419),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF+++V  A+VVL+ RHVISY FTD   VA AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLAVFEAVVVLSWRHVISYAFTDSPAVAKAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   166 bits (419),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++SV  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  140  AAFSTVVTTGVSFLLSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  199

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  200  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTI  259

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  260  ILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  294


 Score = 50.1 bits (118),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  114  FMVSVGFNAAASVRVSNELGAGNPRAAA  141



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   164 bits (416),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAF+V++V   SFIISV+ AIVVLALR+VISY FT+GE V++AVS L P LA++++LNG
Sbjct  351  SAAFAVIIVTSSSFIISVVCAIVVLALRNVISYAFTEGETVSNAVSALSPYLAVSIILNG  410

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G VLGF F+ GA+GIW GMIGGT +QT
Sbjct  411  IQPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQT  470

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +ILLWVT RTDW KEVE  K RL++WD K+EPLL +
Sbjct  471  LILLWVTFRTDWKKEVENVKNRLDRWDDKKEPLLTE  506


 Score = 50.8 bits (120),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            +M++VGFNAAASVRV NELGAGHPKS +
Sbjct  326  YMVAVGFNAAASVRVGNELGAGHPKSAA  353



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   164 bits (414),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ SFI  VI AIV+LA R V+SY FT+GE V+ AVS+LCPLLALTL+LNG
Sbjct  350  SAAFSVIIVNIYSFITCVILAIVILACRDVLSYAFTEGEKVSAAVSELCPLLALTLILNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY+VG+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  410  IQPVLSGVAVGCGWQTFVAKVNVGCYYIVGIPLGALFGFYFKFDAKGIWTGMICGTLIQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDW KEVE A KRL++W   +  ++P+
Sbjct  470  VILAWVTFRTDWTKEVEEASKRLDKWSNIKLEVVPE  505


 Score = 51.6 bits (122),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  325  FMISVGFNAAISVRVSNELGAGNPKSAA  352



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   165 bits (418),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VV L+S   +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+
Sbjct  374  AAFSVLVVTLVSLTFAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGI  433

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+
Sbjct  434  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTL  493

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  494  ILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526


 Score = 50.4 bits (119),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S GFNAAASVRVSNELGAG+PKS +
Sbjct  348  FMVSAGFNAAASVRVSNELGAGNPKSAA  375



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   165 bits (417),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++V ++S +I+++ A+VVL+LRHVISY FT+GE VA+AVS L P LA+TL+LNG
Sbjct  356  SAAFSVLMVTIVSLLIAIVEAVVVLSLRHVISYAFTEGETVANAVSHLTPYLAVTLILNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+LGAKGIW GMIGGT+MQT
Sbjct  416  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQT  475

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            IILLWVT RTDW KEV  A  RL +WD ++E
Sbjct  476  IILLWVTFRTDWNKEVGTAINRLEKWDDRQE  506


 Score = 50.4 bits (119),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             M+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  331  LMVSVGFNAAASVRVSNELGAGNPKSAA  358



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   165 bits (418),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++SV  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLSVFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF F++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT+RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTLRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   164 bits (416),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV L+SF++SV+ + V+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG+
Sbjct  243  AAFSVVVVTLLSFVLSVLVSAVILLCRDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGI  302

Query  669  Q--PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQ  496
            Q  PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQ
Sbjct  303  QLQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQ  362

Query  495  TIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  363  TLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  397


 Score = 50.8 bits (120),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+P++ +
Sbjct  217  FMISVGFNAAASVRVSNELGAGNPRAAA  244



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   165 bits (417),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWG  511

Query  411  AKREPL  394
              +EPL
Sbjct  512  KVKEPL  517


 Score = 50.4 bits (119),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVG NAAASVRVSNELGAG+PKS
Sbjct  340  FMISVGLNAAASVRVSNELGAGNPKS  365



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   165 bits (417),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VV ++S +I+++ A+VVL+LRHVISY FTDGE VA+AVS L P LA+TL++NG+
Sbjct  357  AAFSVLVVTIVSLLIAIVEAVVVLSLRHVISYAFTDGETVANAVSHLTPYLAVTLIINGI  416

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGF F+ GA+GIW GMIGGT+MQTI
Sbjct  417  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFKFDFGAEGIWTGMIGGTLMQTI  476

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            ILLWVT RTDW KEV  A  RL +WD ++E
Sbjct  477  ILLWVTFRTDWNKEVGTAINRLEKWDDRKE  506


 Score = 50.8 bits (120),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             M+SVGFNAAASVRVSNELGAG+PKS +
Sbjct  331  LMVSVGFNAAASVRVSNELGAGNPKSAA  358



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   165 bits (417),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VV L+S   +V+ A++VL+LR VISY FT GE VA AVS L P LA+TL+LNG+
Sbjct  374  AAFSVLVVTLVSLTFAVVEAVIVLSLRDVISYAFTSGETVAKAVSHLTPYLAVTLILNGI  433

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G +LGF F+LGA+GIW GMIGGT++QT+
Sbjct  434  QPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTL  493

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  494  ILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526


 Score = 50.4 bits (119),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S GFNAAASVRVSNELGAG+PKS +
Sbjct  348  FMVSAGFNAAASVRVSNELGAGNPKSAA  375



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   164 bits (416),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R +ISY FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDIISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQAFVAYVNVGCYY  450

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+
Sbjct  451  LVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWE  510

Query  411  AKREPL  394
              +E L
Sbjct  511  EVKEQL  516


 Score = 50.8 bits (120),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVG NAAASVRVSNELGAG+PKS
Sbjct  339  FMISVGLNAAASVRVSNELGAGNPKS  364



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   166 bits (419),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV+VV ++S +I+V+ A+VVL+ R VISY FTDGE VA+AVS L P LA+TL+LNG+
Sbjct  357  AAFSVLVVTIVSLMIAVVEAVVVLSFRDVISYAFTDGETVANAVSHLTPYLAITLILNGI  416

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYYV+G+P+G +LGF F+LGA+GIW GMIGGT MQTI
Sbjct  417  QPVLSGVAVGCGWQAFVAYVNVGCYYVLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTI  476

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            ILLWVT RTDW KEVE A  RL +W+ K+ P
Sbjct  477  ILLWVTFRTDWNKEVETAGNRLKKWEDKKLP  507


 Score = 49.3 bits (116),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGA +PKS +
Sbjct  331  FMVSVGFNAAASVRVSNELGARNPKSAA  358



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   161 bits (408),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV ++SF+++ I ++V+L  R  ISY++TDG+ VA AVS L PLLALTL+LNG
Sbjct  356  SAAFSVVVVTMLSFVLTSIISVVILLCRDYISYIYTDGDDVAQAVSKLTPLLALTLILNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  416  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  475

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RT+W KEV  + KRL++W+ K  PLL
Sbjct  476  LILVWVTFRTNWNKEVAESMKRLHKWEGK-TPLL  508


 Score = 53.9 bits (128),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  331  FMISVGFNAAASVRVSNELGAGNPKSAA  358



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   164 bits (415),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 2/153 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV  +SF+I++  A+V L  R  +SY+FT+GE VA AVSDLCPLLA TL+LNG+
Sbjct  346  AAFSVVVVTALSFVITLAMAVVFLVFRDYLSYIFTEGETVARAVSDLCPLLAATLILNGI  405

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVG  WQ  VAY+NVGCYY VG+P+G +LGF F+LGAKGIW GM+GGT MQT+
Sbjct  406  QPVLSGVAVG--WQKLVAYINVGCYYFVGIPLGILLGFKFHLGAKGIWTGMLGGTCMQTL  463

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL W+T RTDW KEVE A+KRLNQW+  ++PLL
Sbjct  464  ILFWITFRTDWDKEVEEARKRLNQWEDNKQPLL  496


 Score = 51.2 bits (121),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMIS+GFNAAASVRV NELGAGHP++ +
Sbjct  320  FMISIGFNAAASVRVGNELGAGHPRAAA  347



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   164 bits (415),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSV VV  ISF+I+V+ AI+VL LR+VISY FT GE VA+A   +CP LA+TL+LNGV
Sbjct  349  AAFSVFVVTFISFLIAVVEAIIVLCLRNVISYAFTKGETVANAQYLICPFLAVTLILNGV  408

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY VG+PVG +LGF F+LGAKGIW GMIGGTVMQTI
Sbjct  409  QPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTI  468

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            ILLW T RTDW KEVE A+ RL++W+  +EPL
Sbjct  469  ILLWFTYRTDWNKEVEKARTRLDKWENVKEPL  500


 Score = 50.8 bits (120),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             M+SVGFNAAASVRVSNELGA HPKS +
Sbjct  323  LMVSVGFNAAASVRVSNELGAAHPKSAA  350



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   163 bits (413),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I SVI AIV+LA R  +SY FT+G+ V+ AVSDLCPLLALTLVLNG
Sbjct  356  SAAFSVIIVNIYSLITSVILAIVILACRDFLSYAFTEGKKVSVAVSDLCPLLALTLVLNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVA VNVGCYY++G+P+G + GFYF   AKGIW GMI GT++QT
Sbjct  416  IQPVLSGVAVGCGWQAFVAKVNVGCYYIIGIPLGVIFGFYFKFDAKGIWTGMICGTLIQT  475

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDW KEVE A KRL++W  K+  ++P+
Sbjct  476  VILAWVTFRTDWTKEVEEASKRLDKWSNKKLEVVPE  511


 Score = 51.6 bits (122),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  331  FMISVGFNAAISVRVSNELGAGNPKSAA  358



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   164 bits (415),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV ++SFI+SVI +IV+L  R  ISY+FT+GE V+ AVS L PLLA TL+LNG
Sbjct  364  SAAFSVLVVTVLSFILSVIISIVILICRDYISYIFTEGEDVSRAVSQLTPLLAFTLILNG  423

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT
Sbjct  424  IQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQT  483

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL+WVT RT+W KEVE A KRLN+W+ K  P+L
Sbjct  484  LILVWVTFRTNWNKEVEEALKRLNKWEDK-SPIL  516


 Score = 50.8 bits (120),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             MISVGFNAAASVRVSNELGAG+PKS +
Sbjct  339  LMISVGFNAAASVRVSNELGAGNPKSAA  366



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   166 bits (419),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFSVVVV  ISFIISV+ A++VLALRHVISY FT GEVVA+AVS+LCPLLALTL+LNGV
Sbjct  347  AAFSVVVVTSISFIISVVFAVIVLALRHVISYAFTSGEVVANAVSELCPLLALTLLLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G +LGF FN GAKGIW GMIGGT MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  467  ILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499


 Score = 49.3 bits (116),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPKSGS  845
            M+SVGFNAAASVRVSNELGAG+PK+ +
Sbjct  322  MVSVGFNAAASVRVSNELGAGNPKAAA  348



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   164 bits (414),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            +FSVVVVNL S +ISVI A++VL LRHVISY FT G VV+DAVSDL P LA ++VL GVQ
Sbjct  363  SFSVVVVNLCSLLISVILAVIVLLLRHVISYAFTSGTVVSDAVSDLSPFLAASIVLGGVQ  422

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT MQT++
Sbjct  423  PVLSGVAVGCGWQAFVAYVNLACYYIIGIPLGCVLGFACDMGAKGIWTGMLGGTAMQTLV  482

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            LLW T RT+W KEVE A+ RL+ WDA  EPLL +
Sbjct  483  LLWATFRTNWGKEVEKAQGRLDTWDATNEPLLKE  516


 Score = 50.8 bits (120),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGF AAASVRVSNELGAGHP++ S
Sbjct  336  FMVSVGFQAAASVRVSNELGAGHPRATS  363



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   167 bits (422),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R+VI Y FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVIGYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWD  487

Query  411  AKREPLL  391
             K+E  L
Sbjct  488  VKQESTL  494


 Score = 47.8 bits (112),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             MIS+GFNAAASVRV NELG+ HPKS +
Sbjct  316  LMISIGFNAAASVRVGNELGSKHPKSAA  343



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   161 bits (407),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V   SFII+ I AI+VL LR V+SY FT G  VADAVS+L P LA++++LNG
Sbjct  358  SAAFSVVIVTSSSFIIAAIFAILVLVLRRVMSYAFTSGSTVADAVSELSPYLAISVLLNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVL+GVAVGCGWQ FVAYVNVGC+Y VG+P+G VLGF F+ GAKGIW GM+GGTV+QT
Sbjct  418  IQPVLTGVAVGCGWQAFVAYVNVGCFYFVGIPLGCVLGFKFDFGAKGIWSGMMGGTVIQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +IL++VT RTDW KEVE  + RL++W+ K+EPLL
Sbjct  478  LILMYVTFRTDWTKEVEKTRNRLDRWEDKKEPLL  511


 Score = 53.5 bits (127),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            +MI+VGFNAAASVRVSNELGAGHPKS +
Sbjct  333  YMIAVGFNAAASVRVSNELGAGHPKSAA  360



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   161 bits (407),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF++SVI ++V+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG
Sbjct  360  SAAFSVVVVTLLSFVLSVIISVVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNG  419

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  420  IQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  479

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            +IL+WVT RT+W KEVE A+KRLN+W+  + P
Sbjct  480  MILVWVTFRTNWNKEVEEAQKRLNKWEDSKAP  511


 Score = 53.5 bits (127),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  335  FMISVGFNAAASVRVSNELGAGNPKSAA  362



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   160 bits (406),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF++SVI +IV+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG
Sbjct  360  SAAFSVVVVTLLSFVLSVIISIVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNG  419

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  420  IQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  479

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            +IL+WVT RT+W KEVE A+KRLN+W+  + P
Sbjct  480  MILVWVTFRTNWNKEVEEAQKRLNKWEDSKAP  511


 Score = 53.5 bits (127),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  335  FMISVGFNAAASVRVSNELGAGNPKSAA  362



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   163 bits (412),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVV+V L+S  I+++ A +VL LR VISY FT GE VA AVS L P LA+TL+LNG
Sbjct  353  SAAFSVVIVTLVSLAIAIVEAAIVLLLRDVISYAFTSGETVAKAVSKLTPYLAVTLILNG  412

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF F+LGA+GIW GMIGGT MQT
Sbjct  413  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQT  472

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWD----AKREPLL  391
            IILLWVT RTDW+KEV  ++ RL +WD     +++PLL
Sbjct  473  IILLWVTFRTDWIKEVGTSRDRLEKWDDSNKQQQQPLL  510


 Score = 51.2 bits (121),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAA SVRVSNELGAG+PKS +
Sbjct  328  FMVSVGFNAAISVRVSNELGAGNPKSAA  355



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   168 bits (425),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  864  DTQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTL  685
            +    AAFSV+VVN+ISFII+VI A+VVLALR V+SY FTDGE VA+AVSDLCP LA+TL
Sbjct  346  EHPKSAAFSVIVVNMISFIIAVIEAVVVLALRRVVSYAFTDGETVANAVSDLCPYLAVTL  405

Query  684  VLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGT  505
            +LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT
Sbjct  406  ILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGT  465

Query  504  VMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            ++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  466  MLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  501


 Score = 46.2 bits (108),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  922  ISVGFNAAASVRVSNELGAGHPKSGS  845
            I +GFNAAASVRVSNELGA HPKS +
Sbjct  327  IGIGFNAAASVRVSNELGAEHPKSAA  352



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   168 bits (425),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  864  DTQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTL  685
            +    AAFSV+VVN+ISFII+VI A+VVLALR V+SY FTDGE VA+AVSDLCP LA+TL
Sbjct  345  EHPKSAAFSVIVVNMISFIIAVIEAVVVLALRRVVSYAFTDGETVANAVSDLCPYLAVTL  404

Query  684  VLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGT  505
            +LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+P+G VLGF F LG +GIW GMIGGT
Sbjct  405  ILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGIPLGCVLGFTFGLGVQGIWSGMIGGT  464

Query  504  VMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            ++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  465  MLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  500


 Score = 45.8 bits (107),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  922  ISVGFNAAASVRVSNELGAGHPKSGS  845
            I +GFNAAASVRVSNELGA HPKS +
Sbjct  326  IGIGFNAAASVRVSNELGAEHPKSAA  351



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   160 bits (405),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV + + IISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG
Sbjct  358  SAAFSVIVVTVCACIISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNG  417

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  418  IQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQT  477

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL+WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  478  VILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  512


 Score = 53.5 bits (127),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVG NAAASVRVSNELGAGHPKS +
Sbjct  333  FMISVGLNAAASVRVSNELGAGHPKSAA  360



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   160 bits (405),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV + + IISVIAAI +LA RHVISY FT GEVVA+AVSDLCPLLALTL+LNG
Sbjct  333  SAAFSVIVVTVCACIISVIAAITILAFRHVISYAFTGGEVVAEAVSDLCPLLALTLLLNG  392

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G++LGFYF LGAKGIW GM+GGT+MQT
Sbjct  393  IQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLGSLLGFYFKLGAKGIWSGMMGGTLMQT  452

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL+WVT RTDW KEVE A+ RLN+W+  + P +PK
Sbjct  453  VILVWVTFRTDWNKEVEAAQGRLNKWEDNKGP-VPK  487


 Score = 53.5 bits (127),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVG NAAASVRVSNELGAGHPKS +
Sbjct  308  FMISVGLNAAASVRVSNELGAGHPKSAA  335



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   159 bits (403),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAF+ VV   +SFI+S++ A+V+L+ R VISYVFTD   VA+AV++L P LA+T+VLNGV
Sbjct  305  AAFATVVTTGVSFILSLLEAVVILSWRQVISYVFTDSPAVAEAVAELSPYLAITIVLNGV  364

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY VG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  365  QPVLSGVAVGCGWQAFVAYVNIGCYYFVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTI  424

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VTIRTDW KEVE A +RL++W+  + PLL +
Sbjct  425  ILLIVTIRTDWDKEVETASRRLDKWEDTQAPLLKQ  459


 Score = 54.3 bits (129),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAGHP+S +
Sbjct  279  FMVSVGFNAAASVRVSNELGAGHPRSAA  306



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   163 bits (413),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +SF+++V  AIV+L+ RHVISY FTD   VA+AV+DL P LA+T++LNG+
Sbjct  347  AAFSTAVTTGVSFLLAVFEAIVLLSWRHVISYAFTDSPAVAEAVADLSPYLAITIILNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VTIRTDW KEV  A  RL+QW+  REPLL +
Sbjct  467  ILVIVTIRTDWDKEVAKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   160 bits (405),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+FSVVVV L+SF++SV+ +IV+L  R  ISY+FT+GE V+ AVS L PLLA+TL+LNG+
Sbjct  358  ASFSVVVVTLLSFVLSVLISIVILLCRDYISYIFTEGEDVSRAVSKLTPLLAVTLILNGI  417

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT MQT+
Sbjct  418  QPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTFMQTL  477

Query  489  ILLWVTIRTDWVKEVEV----------AKKRLNQWDAKREPLL  391
            IL+WVT RT+W KEV++          A+KRLN+W+  + PLL
Sbjct  478  ILVWVTYRTNWTKEVQIAITYSNLVEEAQKRLNKWNDSKAPLL  520


 Score = 53.5 bits (127),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PK+ S
Sbjct  332  FMISVGFNAAASVRVSNELGAGNPKAAS  359



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   159 bits (403),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FTDGE VA AVS L PLL LTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  412  RDYISYIFTDGEDVAAAVSKLTPLLGLTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  471

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  472  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWE  531

Query  411  AKREPLLPK  385
             K  PLL +
Sbjct  532  DK-TPLLSE  539


 Score = 53.9 bits (128),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  360  FMISVGFNAAASVRVSNELGAGNPKSAA  387



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  867  QDTQSRAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALT  688
             +    AAF+V VV L+S II+V+ A++VLALR VISY FT+GE VA AVSDLCP LA+T
Sbjct  339  SEHPKSAAFTVAVVTLVSLIIAVVEAVIVLALRDVISYAFTEGETVAKAVSDLCPFLAVT  398

Query  687  LVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGG  508
            L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G VLGF ++LGAKGIW GMIGG
Sbjct  399  LILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLGCVLGFKYDLGAKGIWSGMIGG  458

Query  507  TVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            T+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  459  TMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  497



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   161 bits (408),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AI+++  R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG
Sbjct  350  SAAFSVIIVNIYSLITCVILAIIIMVCRDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  410  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKYDAKGIWTGMICGTLIQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            +IL WVT RTDW KEVE A KRL+ W  K+
Sbjct  470  VILAWVTFRTDWTKEVEEASKRLDIWSNKK  499


 Score = 52.0 bits (123),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  325  FMISVGFNAAISVRVSNELGAGNPKSAA  352



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   161 bits (407),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +SF++S+  A+V+L+ RHVISYVFTD  VVA+AV++L P LA+T+VLNGV
Sbjct  353  AAFSTAVTTGVSFLLSLFEAVVILSWRHVISYVFTDSPVVAEAVAELAPYLAITIVLNGV  412

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GA GIW GMIGGT+MQTI
Sbjct  413  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTI  472

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VT RTDW KEVE A +RL+QW+  + PLL +
Sbjct  473  ILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  507


 Score = 51.2 bits (121),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  327  FMVSVGFNAAASVRVSNELGAGNPRSAA  354



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   159 bits (401),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVVV L+SF++SVI +IV+L  R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG
Sbjct  33   SAAFSVVVVTLLSFVLSVIISIVILLCRDYISYIFTEGDDVSRAVAQLSPLLAVTLILNG  92

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT
Sbjct  93   IQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQT  152

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            +IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  153  MILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  185


 Score = 53.1 bits (126),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAG+PKS +
Sbjct  8    FMISVGFNAAASVRVSNELGAGNPKSAA  35



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   162 bits (410),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A FS VV   +SF++++  AIVVL+ RHVISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AGFSTVVTTGVSFLLAIFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAVTIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501


 Score = 49.7 bits (117),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAAASVRVSNELGAG+P++ 
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAA  347



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   161 bits (408),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +S +++V  A+VV++ R+VISY FTD   VA+AV+DL P LA+T+VLNGV
Sbjct  347  AAFSTFVTTGVSLLLAVFEAVVVMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   162 bits (409),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +S +++V  A+VV++ R+VISY FTD   VA+AV+DL P LA+T+VLNGV
Sbjct  347  AAFSTFVTTGVSLLLAVFEAVVVMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G +LGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   160 bits (404),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV++VN+ S I  VI AI+++  R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG
Sbjct  350  SAAFSVIIVNIYSLITCVILAIIIIVCRDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNG  409

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVA VNVGCYY++G+P+GA+ GFYF   AKGIW GMI GT++QT
Sbjct  410  IQPVLSGVAVGCGWQMFVAKVNVGCYYIIGIPLGALFGFYFKYDAKGIWTGMICGTLIQT  469

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +IL WVT RTDW KEVE A +RL+ W  K+  ++ K
Sbjct  470  VILAWVTFRTDWTKEVEEASRRLDIWSNKKAEVISK  505


 Score = 52.0 bits (123),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS +
Sbjct  325  FMISVGFNAAISVRVSNELGAGNPKSAA  352



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   161 bits (407),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            +FSVV+VNL S +ISVI A+ VL LRHVISY FT G VVADAV++L P LA ++VLNGVQ
Sbjct  360  SFSVVIVNLCSLLISVILAVAVLLLRHVISYAFTSGTVVADAVAELSPFLAASIVLNGVQ  419

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVNV CYY++G+P+G VLGF  ++G KGIW GM+GGT++QTI+
Sbjct  420  PVLSGVAVGCGWQAFVAYVNVACYYIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTIV  479

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            LLW TIRT+W KEV  A+ RL++WD  +EPLL +
Sbjct  480  LLWATIRTNWGKEVGKAQSRLDKWDDNKEPLLRE  513


 Score = 50.4 bits (119),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPKSGS  845
            MISVGF AAASVRVSNELGAGHPK+ S
Sbjct  334  MISVGFQAAASVRVSNELGAGHPKATS  360



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   161 bits (408),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +S +++V  A+V+++ R+VISY FTD   VA+AV+DL P LA+T+VLNGV
Sbjct  347  AAFSTFVTTGVSLLLAVFEAVVIMSWRNVISYAFTDSPEVAEAVADLSPFLAITIVLNGV  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVEKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   160 bits (404),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            A+F+V++VNL S IISVI AI VL LRHVISY FT G VVA AV++L P LA ++VL GV
Sbjct  359  ASFAVIIVNLSSLIISVILAIAVLLLRHVISYAFTSGTVVAGAVAELSPFLAASIVLGGV  418

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+ CYY++G+P+G VLGF  ++GAKGIW GM+GGT+MQTI
Sbjct  419  QPVLSGVAVGCGWQAFVAYVNIACYYIIGIPLGCVLGFTCDMGAKGIWSGMLGGTIMQTI  478

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +LLW T RT+W KEVE A  RL+ W+  +EPLL +
Sbjct  479  VLLWATFRTNWKKEVEKAHSRLDSWNDNKEPLLKE  513


 Score = 51.6 bits (122),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGF AAASVRV NELGAGHPK+ S
Sbjct  333  FMISVGFQAAASVRVGNELGAGHPKAAS  360



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   161 bits (407),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   161 bits (407),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   161 bits (407),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS VV   +SF++++  AIVVL+ R+VISY FTD   VA+AV+DL P LA+T+VLNG+
Sbjct  347  AAFSTVVTTGVSFLLAIFEAIVVLSWRNVISYAFTDSPAVAEAVADLSPFLAITIVLNGI  406

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  407  QPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTI  466

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEV  A  RL+QW+  REPLL +
Sbjct  467  ILVIVTFRTDWDKEVAKASSRLDQWEESREPLLKQ  501


 Score = 50.1 bits (118),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  321  FMVSVGFNAAASVRVSNELGAGNPRAAA  348



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   155 bits (391),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            +F+VV V L SFII++  AIV+L LRHVISY FT G  VADAV++L P LA++++LNG+Q
Sbjct  381  SFAVVAVTLSSFIIALALAIVLLLLRHVISYAFTGGSTVADAVAELSPFLAISILLNGIQ  440

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVNVGCYY +G+P+G VLGF  + G KGIW GMIGGT++QTII
Sbjct  441  PVLSGVAVGCGWQAFVAYVNVGCYYFIGIPLGCVLGFKLDFGVKGIWSGMIGGTLIQTII  500

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            L WVT RTDW KEVE A  RLN WD  ++PLL
Sbjct  501  LSWVTFRTDWNKEVEKATNRLNIWDNIKQPLL  532


 Score = 56.2 bits (134),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRVSNELGAGHPKS S
Sbjct  354  FMISVGFNAAASVRVSNELGAGHPKSVS  381



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   158 bits (400),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAF+V+VV   SF+I+V  AIVVLALR+VISYVFT G  V+DAVS+L P LA++++LNG+
Sbjct  360  AAFAVIVVTSSSFLIAVFLAIVVLALRNVISYVFTSGTTVSDAVSELSPYLAVSIILNGI  419

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+ GAKGIW GMIGGT++QT+
Sbjct  420  QPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPIGVLLGFKFDFGAKGIWSGMIGGTLIQTM  479

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            IL+W T RT+W KEVE A+ RL+ W+  +EPL
Sbjct  480  ILIWFTSRTNWDKEVEKARNRLDTWEDNKEPL  511


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            +MISVGFNAAASVRVSNELGAGHP++ +
Sbjct  334  YMISVGFNAAASVRVSNELGAGHPRAAA  361



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   160 bits (405),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            +FS+V+VNL S +ISVI A+VVL LRHVISY FT G VVADAV++L P LA ++VLNGVQ
Sbjct  360  SFSIVIVNLCSLLISVILAVVVLLLRHVISYAFTSGTVVADAVTELSPFLAASIVLNGVQ  419

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVNV CYY++G+P+G VLGF  ++G KGIW GM+GGT++QT++
Sbjct  420  PVLSGVAVGCGWQAFVAYVNVACYYIIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTMV  479

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            LLW TIRT+W KEVE A+ R+++WD  +EPLL +
Sbjct  480  LLWATIRTNWGKEVEKAQSRVDRWDDNKEPLLRE  513


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  925  MISVGFNAAASVRVSNELGAGHPKSGS  845
            MISVGF AAASVRVSNELGAGHPK+ S
Sbjct  334  MISVGFQAAASVRVSNELGAGHPKATS  360



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   158 bits (400),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAF+VVVV   SFIIS + AI+VL LRH ISYVFT+GE V++AVSDL P LA+++VLNG+
Sbjct  330  AAFAVVVVTSSSFIISAVCAIIVLVLRHDISYVFTEGETVSNAVSDLSPYLAISIVLNGI  389

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF F+ GA+GIW GMIGGT +QTI
Sbjct  390  QPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTI  449

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            ILLWVT RTDW KEVE A+ RL+ ++ K++
Sbjct  450  ILLWVTYRTDWNKEVEKAQSRLDTYEDKKD  479


 Score = 52.8 bits (125),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMI+VGFNAAASVR+ NELGAGHPKS +
Sbjct  304  FMIAVGFNAAASVRIGNELGAGHPKSAA  331



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   158 bits (399),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV++VN+ S I  VI AIV+LA R V+SY FT+GE V+ AVSDLCPLLALTLVLNG
Sbjct  356  SASFSVIIVNIYSLITCVILAIVILAFRDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAK---GIWCGMIGGTV  502
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF L      GIW GMI GT+
Sbjct  416  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKLIIAFKFGIWTGMICGTL  475

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +QT+IL W+T RTDW KEVE + KRL++W  K+  ++P+
Sbjct  476  IQTVILAWITFRTDWTKEVEESAKRLDKWSNKKPEVVPE  514


 Score = 52.8 bits (125),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS S
Sbjct  331  FMISVGFNAAISVRVSNELGAGNPKSAS  358



>ref|XP_011652908.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   162 bits (410),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R+VISY FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVISYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP+G +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNKWD  487

Query  411  AKRE  400
             K+E
Sbjct  488  DKQE  491


 Score = 48.1 bits (113),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
             MISVGFNAAASVRV NELG+ HPKS +
Sbjct  316  LMISVGFNAAASVRVGNELGSKHPKSAA  343



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   163 bits (412),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG
Sbjct  380  SAAFSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNG  439

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT
Sbjct  440  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQT  499

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  500  LILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  533


 Score = 47.4 bits (111),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            F +S GFNAAASVRVSNELGAG+PKS +
Sbjct  355  FNVSAGFNAAASVRVSNELGAGNPKSAA  382



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   163 bits (412),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSV+VV L+S   +V+ A++VL+LR VISY FT GE V  AVS L P LA+TL+LNG
Sbjct  373  SAAFSVLVVTLVSLTXAVVEAVIVLSLRDVISYAFTSGETVXKAVSHLTPYLAVTLILNG  432

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G VLGF F+LGA+GIW GMIGGT++QT
Sbjct  433  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQT  492

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  493  LILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  526


 Score = 47.4 bits (111),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            F +S GFNAAASVRVSNELGAG+PKS +
Sbjct  348  FNVSAGFNAAASVRVSNELGAGNPKSAA  375



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   164 bits (416),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  386  RDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYY  445

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD
Sbjct  446  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWD  505

Query  411  AKREPLL  391
               +P++
Sbjct  506  DTAKPIV  512


 Score = 45.4 bits (106),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPK  854
            +MI+VGFNAAASVRVSNELG+ +PK
Sbjct  334  YMIAVGFNAAASVRVSNELGSANPK  358



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   157 bits (397),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             A+FSV++VN+ S I  VI AIV+LA R V+SYVFT+GE V+ AVSDLCPLLALTLVLNG
Sbjct  356  SASFSVIIVNIYSLITCVILAIVILAFRDVLSYVFTEGEEVSAAVSDLCPLLALTLVLNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAK---GIWCGMIGGTV  502
            +QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+GA+ GFYF L      GIW GMI GT+
Sbjct  416  IQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFKLIIAFKFGIWTGMICGTL  475

Query  501  MQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            +QT+IL WVT RTDW KE  ++ KRL++W  K+  ++P+
Sbjct  476  IQTVILAWVTFRTDWTKEASLSSKRLDKWSNKKLEVVPE  514


 Score = 52.8 bits (125),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA SVRVSNELGAG+PKS S
Sbjct  331  FMISVGFNAAISVRVSNELGAGNPKSAS  358



>ref|XP_010493132.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=503

 Score =   157 bits (398),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V  ++SF++S+  A+V+L+ RHVISY+FTD E VA+AV++L P LA+T+VLNGV
Sbjct  350  AAFSTAVTTVVSFLLSLFEAVVILSWRHVISYIFTDSEAVAEAVAELSPFLAITIVLNGV  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTI
Sbjct  410  QPVLSGVAVGCGWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A +RL+QW+    PLL +
Sbjct  470  ILVIVTFRTDWDKEVEKASRRLDQWE-DSSPLLKQ  503


 Score = 51.6 bits (122),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  324  FMVSVGFNAAASVRVSNELGAGNPRSAA  351



>ref|XP_010476100.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010476101.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=503

 Score =   157 bits (398),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V  ++SF++S+  A+V+L+ RHVISY+FTD E VA+AV++L P LA+T+VLNGV
Sbjct  350  AAFSTAVTTVVSFLLSLFEAVVILSWRHVISYIFTDSEAVAEAVAELSPFLAITIVLNGV  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQTI
Sbjct  410  QPVLSGVAVGCGWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VT RTDW KEVE A +RL+QW+    PLL +
Sbjct  470  ILVIVTFRTDWDKEVEKASRRLDQWE-DSSPLLKQ  503


 Score = 51.6 bits (122),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  324  FMVSVGFNAAASVRVSNELGAGNPRSAA  351



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   160 bits (405),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISYVFT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYVFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  411  AKREPL  394
             K+EPL
Sbjct  495  DKKEPL  500


 Score = 48.9 bits (115),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAAASVR SNELGA +PKS 
Sbjct  323  FMVSVGFNAAASVRTSNELGAANPKSA  349



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   156 bits (394),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            RH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  387  RHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  446

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD
Sbjct  447  VVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  506

Query  411  AKREPL  394
             K EPL
Sbjct  507  VK-EPL  511


 Score = 53.1 bits (126),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVG NAAASVRVSNELGAGHPKS
Sbjct  335  FMISVGLNAAASVRVSNELGAGHPKS  360



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   158 bits (400),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEV  A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVVEAAKRLNKWG  511

Query  411  AKREPL  394
              +E L
Sbjct  512  EVKETL  517


 Score = 50.4 bits (119),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVG NAAASVRVSNELGAG+PKS
Sbjct  340  FMISVGLNAAASVRVSNELGAGNPKS  365



>gb|KFK33086.1| hypothetical protein AALP_AA6G328900 [Arabis alpina]
Length=535

 Score =   158 bits (399),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +SF++S++ A+++L+ RHVISY+FTD   VA+AV+DL P LA+T+VLNGV
Sbjct  349  AAFSTAVTTGVSFLLSLLEAVLILSWRHVISYIFTDSVEVAEAVADLSPYLAITIVLNGV  408

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMIGGT+MQTI
Sbjct  409  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTI  468

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IL+ VTIRTDW KEVE A +RL+QW+  + PLL +
Sbjct  469  ILVIVTIRTDWDKEVEKASRRLDQWE-DQAPLLKQ  502


 Score = 50.8 bits (120),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+S+GFNAAASVRVSNELGAG+P+S +
Sbjct  323  FMVSIGFNAAASVRVSNELGAGNPRSAA  350



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   158 bits (400),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R+VISY FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  199  RNVISYAFTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  258

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+
Sbjct  259  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWE  318

Query  411  AKREPLLPK  385
              REPLL +
Sbjct  319  ESREPLLKQ  327


 Score = 50.4 bits (119),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P++ +
Sbjct  148  FMVSVGFNAAASVRVSNELGAGNPRAAA  175



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   160 bits (404),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYIFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  411  AKREPL  394
             K+EPL
Sbjct  495  DKKEPL  500


 Score = 48.9 bits (115),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAAASVR SNELGA +PKS 
Sbjct  323  FMVSVGFNAAASVRTSNELGAANPKSA  349



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score =   157 bits (398),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  846  AFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ  667
            +FSV+VVNL S +ISVI A++VL+LRHVISY FT G VV+DAVS+L P LA ++VL GVQ
Sbjct  360  SFSVIVVNLCSLLISVILAVIVLSLRHVISYAFTSGTVVSDAVSELSPFLAASIVLGGVQ  419

Query  666  PVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTII  487
            PVLSGVAVGCGWQ FVAYVN+GCYY++GVP+G VLGF  ++GAKGIW GM+GGT +QT++
Sbjct  420  PVLSGVAVGCGWQAFVAYVNLGCYYIIGVPLGCVLGFACDMGAKGIWTGMLGGTAVQTLV  479

Query  486  LLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            LLW T RT+W KEVE A+ RL+ WD  +EPLL +
Sbjct  480  LLWATFRTNWDKEVEKAQSRLDTWDDVKEPLLKE  513


 Score = 50.8 bits (120),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGF AAASVRVSNELGAGHP++ S
Sbjct  333  FMVSVGFQAAASVRVSNELGAGHPRATS  360



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   157 bits (397),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  843  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  664
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQP
Sbjct  356  FSVIVVTSISLALSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQP  415

Query  663  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  484
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  416  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  475

Query  483  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  476  VYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  508


 Score = 50.8 bits (120),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMI+VGFNAAASVRV NELGA HPKS
Sbjct  328  FMIAVGFNAAASVRVGNELGAAHPKS  353



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  843  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  664
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LAL+++LNG+QP
Sbjct  355  FSVIVVTSISLALSVILAILVLILRNVMSYAFTGGSTVADSVAELSPFLALSVILNGIQP  414

Query  663  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  484
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  415  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  474

Query  483  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  475  VYVTLRTDWNKEVEKARNRMDEWGDKTELLLKE  507


 Score = 50.8 bits (120),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMI+VGFNAAASVRV NELGA HPKS
Sbjct  327  FMIAVGFNAAASVRVGNELGAAHPKS  352



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   156 bits (395),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFS  V   +SF++S+  AIV+L+ RHVISY+FTD   VA+AV++L P LA+T+VLNG
Sbjct  65   SAAFSTAVTTGVSFLLSLFEAIVILSWRHVISYIFTDSPAVAEAVAELSPFLAITIVLNG  124

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            VQPVLSGVAVGCGWQ +VAYVN+GCYY+VG+P+G VLGF +++GA+GIW GMIGGT+MQT
Sbjct  125  VQPVLSGVAVGCGWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQT  184

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            IIL+ VT RTDWVKEVE A +RL+QW+    PLL +
Sbjct  185  IILVIVTFRTDWVKEVEKASRRLDQWE-DTSPLLKQ  219


 Score = 51.6 bits (122),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  40   FMVSVGFNAAASVRVSNELGAGNPRSAA  67



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   158 bits (399),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  411  AKREPLL  391
             K+EPLL
Sbjct  500  DKKEPLL  506


 Score = 49.7 bits (117),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAA SVR SNELGAG+PKS 
Sbjct  328  FMVSVGFNAAVSVRTSNELGAGNPKSA  354



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score =   156 bits (395),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +SF++S+  A+++L+ R+VISYVFTD   VA+AV++L P LA+T+VLNGV
Sbjct  350  AAFSTAVTTGVSFLLSLFEAVLILSWRNVISYVFTDSPAVAEAVAELTPYLAITIVLNGV  409

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTI
Sbjct  410  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTI  469

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VT RTDW KEVE A +RL+QW+  + PLL +
Sbjct  470  ILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  504


 Score = 51.2 bits (121),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  324  FMVSVGFNAAASVRVSNELGAGNPRSAA  351



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  843  FSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQP  664
            FSV+VV  IS  +SVI AI+VL LR+V+SY FT G  VAD+V++L P LA +++LNGVQP
Sbjct  245  FSVIVVTSISLALSVILAILVLILRNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQP  304

Query  663  VLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIIL  484
            VLSGVAVGCGWQ FVAYVNVGCYY++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL
Sbjct  305  VLSGVAVGCGWQAFVAYVNVGCYYLIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIIL  364

Query  483  LWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ++VT+RTDW KEVE A+ R+++W  K E LL +
Sbjct  365  VYVTLRTDWNKEVEKARNRMDEWGDKTEQLLKE  397


 Score = 50.8 bits (120),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMI+VGFNAAASVRV NELGA HPKS
Sbjct  217  FMIAVGFNAAASVRVGNELGAAHPKS  242



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   157 bits (396),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  381  RDYVSYIFTSDIHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  440

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  441  IVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  500

Query  411  AKREP  397
             K+EP
Sbjct  501  EKKEP  505


 Score = 50.8 bits (120),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAAASVR SNELGAG+PKS 
Sbjct  329  FMVSVGFNAAASVRTSNELGAGNPKSA  355



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   158 bits (399),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWD  499

Query  411  AKREPL  394
             K+EPL
Sbjct  500  DKKEPL  505


 Score = 49.3 bits (116),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAA SVR SNELGAG+PKS 
Sbjct  328  FMVSVGFNAAVSVRTSNELGAGNPKSA  354



>gb|EYU29853.1| hypothetical protein MIMGU_mgv1a004772mg [Erythranthe guttata]
Length=511

 Score =   157 bits (397),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  852  RAAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNG  673
             AAFSVVV    SFII+VI AI+ +  RH +SY FT G+VV+DAVSDL PLL   +VLNG
Sbjct  356  SAAFSVVVSTGTSFIIAVICAIITIVFRHQMSYAFTSGKVVSDAVSDLTPLLTGAIVLNG  415

Query  672  VQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQT  493
            +QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+PVGAVLGF FNLGAKGIW GM+GGT+MQT
Sbjct  416  IQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPVGAVLGFKFNLGAKGIWAGMLGGTLMQT  475

Query  492  IILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            +IL+WVT+RTDW+ EVE    R+++W+  +E L
Sbjct  476  LILIWVTLRTDWINEVEKTSIRIDKWNDLKERL  508


 Score = 50.1 bits (118),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAA S+RVSNELGA HP+S +
Sbjct  331  FMISVGFNAAVSIRVSNELGAKHPRSAA  358



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   156 bits (395),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            V+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  499

Query  411  AKREPL  394
             K+  L
Sbjct  500  DKKNSL  505


 Score = 50.4 bits (119),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSG  848
            FM+SVGFNAAAS+R SNELGAG+PKS 
Sbjct  328  FMVSVGFNAAASIRTSNELGAGNPKSA  354



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score =   157 bits (397),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  +V  +S  +S IA +V   LRH +SY+FT GEVV+ AV+DLCPLL  T+VL G+
Sbjct  340  AAFSAWMVTALSAFVSAIAGLVTFLLRHKLSYIFTSGEVVSRAVADLCPLLVGTIVLCGI  399

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ  VAY+N+GCYY +G+P+G +LGF F+ G KG+W GMIGGT++QT+
Sbjct  400  QPVLSGVAVGCGWQATVAYINIGCYYFIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTL  459

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            IL+W+T+RTDW KEVE A+KRL++WD  R+PLL
Sbjct  460  ILIWITLRTDWNKEVEEARKRLDKWDDTRQPLL  492


 Score = 50.1 bits (118),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FMISVGFNAAASVRV NELGAG+P+S +
Sbjct  314  FMISVGFNAAASVRVGNELGAGNPRSAA  341



>emb|CDY64933.1| BnaCnng45550D [Brassica napus]
Length=505

 Score =   155 bits (393),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  849  AAFSVVVVNlisfiisviaaivvlaLRHVISYVFTDGEVVADAVSDLCPLLALTLVLNGV  670
            AAFS  V   +SF++S+  A+++L+ R+VISY+FTD   VA+AV++L P LA+T+VLNGV
Sbjct  351  AAFSTAVTTGVSFLLSLFEAVLILSWRNVISYLFTDSPAVAEAVAELTPYLAITIVLNGV  410

Query  669  QPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTI  490
            QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G VLGF +++GAKGIW GMI GT+MQTI
Sbjct  411  QPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTI  470

Query  489  ILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLLPK  385
            ILL VT RTDW KEVE A +RL+QW+  + PLL +
Sbjct  471  ILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLLKQ  505


 Score = 51.6 bits (122),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKSGS  845
            FM+SVGFNAAASVRVSNELGAG+P+S +
Sbjct  325  FMVSVGFNAAASVRVSNELGAGNPRSAA  352



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   154 bits (388),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  771  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  592
            RH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  387  RHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  446

Query  591  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
            VVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE A KRLN+WD
Sbjct  447  VVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEANKRLNKWD  506

Query  411  AKREPL  394
             K EPL
Sbjct  507  VK-EPL  511


 Score = 53.1 bits (126),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  928  FMISVGFNAAASVRVSNELGAGHPKS  851
            FMISVG NAAASVRVSNELGAGHPKS
Sbjct  335  FMISVGLNAAASVRVSNELGAGHPKS  360



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2186598153920