BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6886

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609945.1|  PREDICTED: uncharacterized protein LOC104103724  96.7    5e-19   Nicotiana tomentosiformis
ref|XP_009781696.1|  PREDICTED: uncharacterized protein LOC104230558  92.8    1e-17   Nicotiana sylvestris
ref|XP_009803262.1|  PREDICTED: uncharacterized protein LOC104248655  91.7    3e-17   Nicotiana sylvestris
ref|XP_009616187.1|  PREDICTED: uncharacterized protein LOC104108774  91.7    4e-17   Nicotiana tomentosiformis
ref|XP_011093758.1|  PREDICTED: uncharacterized protein LOC105173636  90.9    5e-17   Sesamum indicum [beniseed]
ref|XP_006347843.1|  PREDICTED: uncharacterized protein LOC102585480  89.4    2e-16   Solanum tuberosum [potatoes]
ref|XP_006343519.1|  PREDICTED: uncharacterized protein LOC102599...  88.6    3e-16   Solanum tuberosum [potatoes]
ref|XP_004244900.1|  PREDICTED: uncharacterized protein LOC101266847  88.2    4e-16   Solanum lycopersicum
ref|XP_006347846.1|  PREDICTED: uncharacterized protein LOC102586...  85.5    2e-15   Solanum tuberosum [potatoes]
ref|XP_006347845.1|  PREDICTED: uncharacterized protein LOC102586...  85.5    3e-15   Solanum tuberosum [potatoes]
ref|XP_010312348.1|  PREDICTED: uncharacterized protein LOC104644...  85.1    3e-15   Solanum lycopersicum
ref|XP_010312343.1|  PREDICTED: uncharacterized protein LOC104644...  85.1    3e-15   Solanum lycopersicum
ref|XP_011078022.1|  PREDICTED: uncharacterized protein LOC105161875  84.3    6e-15   Sesamum indicum [beniseed]
gb|EYU23667.1|  hypothetical protein MIMGU_mgv1a001617mg              81.6    5e-14   Erythranthe guttata [common monkey flower]
gb|EYU27327.1|  hypothetical protein MIMGU_mgv1a001634mg              80.9    8e-14   Erythranthe guttata [common monkey flower]
ref|XP_010312310.1|  PREDICTED: uncharacterized protein LOC101260185  80.5    1e-13   Solanum lycopersicum
ref|XP_010312331.1|  PREDICTED: uncharacterized protein LOC104644393  79.0    2e-13   Solanum lycopersicum
gb|EYU28380.1|  hypothetical protein MIMGU_mgv1a002234mg              75.5    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_009785695.1|  PREDICTED: uncharacterized protein LOC104233932  74.3    9e-12   Nicotiana sylvestris
ref|XP_010315466.1|  PREDICTED: uncharacterized protein LOC104645463  67.8    7e-11   
emb|CDP15840.1|  unnamed protein product                              72.0    8e-11   Coffea canephora [robusta coffee]
ref|XP_006347863.1|  PREDICTED: uncharacterized protein LOC102594550  71.2    8e-11   Solanum tuberosum [potatoes]
emb|CDP20678.1|  unnamed protein product                              71.2    9e-11   Coffea canephora [robusta coffee]
ref|XP_009341995.1|  PREDICTED: uncharacterized protein LOC103934018  70.5    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_009335671.1|  PREDICTED: uncharacterized protein LOC103928367  70.5    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_010312319.1|  PREDICTED: uncharacterized protein LOC104644389  67.8    8e-10   
ref|XP_010240875.1|  PREDICTED: uncharacterized protein LOC104585627  68.6    9e-10   Nelumbo nucifera [Indian lotus]
gb|KHG13047.1|  DnaJ subfamily B member 12                            67.0    2e-09   Gossypium arboreum [tree cotton]
ref|XP_008355770.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.0    2e-09   
ref|XP_011023498.1|  PREDICTED: uncharacterized protein LOC105124962  67.0    3e-09   Populus euphratica
ref|XP_002319580.2|  hypothetical protein POPTR_0013s03040g           66.6    3e-09   
ref|XP_012089145.1|  PREDICTED: uncharacterized protein LOC105647608  66.2    4e-09   Jatropha curcas
ref|XP_010524767.1|  PREDICTED: uncharacterized protein LOC104802729  66.2    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_011659923.1|  PREDICTED: uncharacterized protein LOC101213491  65.9    5e-09   Cucumis sativus [cucumbers]
ref|XP_010097335.1|  J domain-containing protein                      66.2    6e-09   Morus notabilis
ref|XP_010097334.1|  J domain-containing protein                      65.9    6e-09   Morus notabilis
ref|XP_009373931.1|  PREDICTED: uncharacterized protein LOC103962880  65.9    6e-09   
ref|XP_007144775.1|  hypothetical protein PHAVU_007G183600g           65.5    6e-09   Phaseolus vulgaris [French bean]
gb|KHN20189.1|  DnaJ like subfamily B member 12                       65.5    7e-09   Glycine soja [wild soybean]
ref|XP_006606497.1|  PREDICTED: meiotically up-regulated gene 184...  65.5    7e-09   Glycine max [soybeans]
emb|CDX99992.1|  BnaC09g03090D                                        65.5    8e-09   
ref|XP_008366850.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    8e-09   
ref|XP_008359874.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    8e-09   
ref|XP_010024522.1|  PREDICTED: uncharacterized protein LOC104414985  65.5    8e-09   Eucalyptus grandis [rose gum]
ref|XP_011048882.1|  PREDICTED: uncharacterized protein LOC105142787  65.5    1e-08   Populus euphratica
ref|XP_006382690.1|  hypothetical protein POPTR_0005s04470g           64.7    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008246552.1|  PREDICTED: uncharacterized protein LOC103344708  64.3    2e-08   Prunus mume [ume]
emb|CDY27812.1|  BnaA05g32210D                                        58.5    3e-08   Brassica napus [oilseed rape]
gb|KJB72559.1|  hypothetical protein B456_011G184900                  63.5    4e-08   Gossypium raimondii
ref|XP_008450718.1|  PREDICTED: uncharacterized protein LOC103492216  62.8    6e-08   Cucumis melo [Oriental melon]
ref|XP_002266568.2|  PREDICTED: uncharacterized protein LOC100255461  62.8    6e-08   Vitis vinifera
emb|CBI34299.3|  unnamed protein product                              62.8    6e-08   Vitis vinifera
ref|XP_007030109.1|  DNAJ heat shock N-terminal domain-containing...  62.8    6e-08   
ref|XP_004153904.1|  PREDICTED: uncharacterized protein LOC101214527  62.4    8e-08   Cucumis sativus [cucumbers]
ref|XP_009787122.1|  PREDICTED: uncharacterized protein LOC104235134  62.4    8e-08   Nicotiana sylvestris
ref|XP_007207549.1|  hypothetical protein PRUPE_ppa017544mg           62.4    9e-08   
ref|XP_009151221.1|  PREDICTED: uncharacterized protein LOC103874549  62.0    1e-07   Brassica rapa
gb|KDO46342.1|  hypothetical protein CISIN_1g003534mg                 62.0    1e-07   Citrus sinensis [apfelsine]
ref|XP_006433149.1|  hypothetical protein CICLE_v10000081mg           62.0    1e-07   Citrus clementina [clementine]
ref|XP_006471822.1|  PREDICTED: uncharacterized protein LOC102608...  62.0    1e-07   Citrus sinensis [apfelsine]
ref|XP_009596456.1|  PREDICTED: uncharacterized protein LOC104092542  62.0    1e-07   Nicotiana tomentosiformis
ref|XP_006471825.1|  PREDICTED: uncharacterized protein LOC102608...  62.0    1e-07   
ref|XP_009624052.1|  PREDICTED: uncharacterized protein LOC104115174  62.0    1e-07   Nicotiana tomentosiformis
ref|XP_009111937.1|  PREDICTED: uncharacterized protein LOC103837329  61.6    1e-07   
emb|CDP20677.1|  unnamed protein product                              59.3    2e-07   Coffea canephora [robusta coffee]
ref|XP_007035447.1|  DNAJ heat shock N-terminal domain-containing...  61.2    2e-07   
ref|XP_010240852.1|  PREDICTED: uncharacterized protein LOC104585612  61.2    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_011009900.1|  PREDICTED: uncharacterized protein LOC105114890  61.2    2e-07   Populus euphratica
ref|XP_009383695.1|  PREDICTED: uncharacterized protein LOC103971406  61.2    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28586.1|  hypothetical protein B456_005G056900                  61.2    2e-07   Gossypium raimondii
emb|CDX80667.1|  BnaC07g27770D                                        60.8    2e-07   
ref|XP_010546913.1|  PREDICTED: uncharacterized protein LOC104818838  60.8    3e-07   Tarenaya hassleriana [spider flower]
gb|KJB19229.1|  hypothetical protein B456_003G089700                  60.8    3e-07   Gossypium raimondii
ref|XP_010540340.1|  PREDICTED: uncharacterized protein LOC104814150  60.8    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_006577265.1|  PREDICTED: uncharacterized protein LOC100782762  60.8    3e-07   Glycine max [soybeans]
ref|XP_010558494.1|  PREDICTED: uncharacterized protein LOC104827121  60.8    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_006855386.1|  PREDICTED: uncharacterized protein LOC18445183   60.8    3e-07   Amborella trichopoda
gb|KHG04775.1|  DnaJ subfamily B member 12                            60.5    4e-07   Gossypium arboreum [tree cotton]
ref|XP_002314476.2|  DNAJ heat shock N-terminal domain-containing...  60.5    4e-07   
ref|XP_006289445.1|  hypothetical protein CARUB_v10002959mg           60.5    4e-07   Capsella rubella
ref|XP_004495763.1|  PREDICTED: uncharacterized protein LOC101513909  60.1    4e-07   Cicer arietinum [garbanzo]
ref|XP_007147102.1|  hypothetical protein PHAVU_006G096300g           60.5    4e-07   Phaseolus vulgaris [French bean]
ref|XP_006389136.1|  hypothetical protein POPTR_0044s002902g          60.1    4e-07   
ref|XP_006356967.1|  PREDICTED: uncharacterized protein LOC102580437  60.1    5e-07   Solanum tuberosum [potatoes]
ref|XP_002874391.1|  DNAJ heat shock N-terminal domain-containing...  60.1    5e-07   
ref|XP_002884491.1|  hypothetical protein ARALYDRAFT_340677           60.1    5e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006394983.1|  hypothetical protein EUTSA_v10003562mg           60.1    5e-07   Eutrema salsugineum [saltwater cress]
ref|XP_009779333.1|  PREDICTED: uncharacterized protein LOC104228554  60.1    6e-07   Nicotiana sylvestris
gb|KJB44649.1|  hypothetical protein B456_007G263100                  59.3    6e-07   Gossypium raimondii
emb|CDY41917.1|  BnaC05g46870D                                        59.7    6e-07   Brassica napus [oilseed rape]
ref|XP_012088502.1|  PREDICTED: uncharacterized protein LOC105647119  59.7    7e-07   Jatropha curcas
ref|XP_003553743.1|  PREDICTED: uncharacterized protein LOC100819...  59.7    7e-07   Glycine max [soybeans]
ref|XP_009147303.1|  PREDICTED: protein split ends-like               59.3    7e-07   Brassica rapa
ref|XP_010941769.1|  PREDICTED: uncharacterized protein LOC105059940  59.7    7e-07   Elaeis guineensis
ref|XP_008776154.1|  PREDICTED: uncharacterized protein LOC103696336  59.3    8e-07   Phoenix dactylifera
gb|KEH43065.1|  DnaJ heat shock amino-terminal domain protein         59.3    8e-07   Medicago truncatula
ref|XP_012088500.1|  PREDICTED: uncharacterized protein LOC105647118  59.3    9e-07   Jatropha curcas
ref|XP_011470765.1|  PREDICTED: uncharacterized protein LOC105353384  58.2    1e-06   Fragaria vesca subsp. vesca
emb|CDY41935.1|  BnaC05g46690D                                        58.9    1e-06   Brassica napus [oilseed rape]
ref|XP_010464020.1|  PREDICTED: uncharacterized protein LOC104744640  58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009147302.1|  PREDICTED: flagellar attachment zone protein...  58.9    1e-06   Brassica rapa
ref|XP_004229298.1|  PREDICTED: uncharacterized protein LOC101248043  58.9    1e-06   Solanum lycopersicum
ref|XP_010420651.1|  PREDICTED: uncharacterized protein LOC104706189  58.9    1e-06   Camelina sativa [gold-of-pleasure]
emb|CDY27811.1|  BnaA05g32200D                                        58.5    2e-06   Brassica napus [oilseed rape]
ref|XP_004305041.1|  PREDICTED: uncharacterized protein LOC101309...  58.5    2e-06   Fragaria vesca subsp. vesca
ref|XP_011466352.1|  PREDICTED: uncharacterized protein LOC101309...  58.5    2e-06   Fragaria vesca subsp. vesca
emb|CDP18388.1|  unnamed protein product                              58.2    2e-06   Coffea canephora [robusta coffee]
gb|AAG51424.1|AC009465_24  hypothetical protein; 31126-29176          58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078109.1|  uncharacterized protein                          58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189810.1|  uncharacterized protein                          58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078108.1|  uncharacterized protein                          58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207755.1|  hypothetical protein PRUPE_ppa026943mg           57.8    2e-06   
ref|NP_187147.2|  uncharacterized protein                             58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382035.1|  PREDICTED: uncharacterized protein LOC103970110  58.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH42053.1|  DnaJ heat shock amino-terminal domain protein         58.2    2e-06   Medicago truncatula
ref|XP_010455145.1|  PREDICTED: uncharacterized protein LOC104736...  58.2    2e-06   
gb|KHN43244.1|  DnaJ like subfamily B member 14                       58.2    2e-06   Glycine soja [wild soybean]
ref|XP_004494655.1|  PREDICTED: uncharacterized protein LOC101488726  57.8    3e-06   Cicer arietinum [garbanzo]
ref|XP_003626352.1|  Chaperone protein dnaJ                           57.8    3e-06   Medicago truncatula
emb|CDY19714.1|  BnaA09g03670D                                        57.8    3e-06   Brassica napus [oilseed rape]
ref|XP_010540334.1|  PREDICTED: uncharacterized protein LOC104814147  57.8    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_010546655.1|  PREDICTED: uncharacterized protein LOC104818668  57.8    3e-06   Tarenaya hassleriana [spider flower]
gb|KHN47283.1|  DnaJ like subfamily B member 14                       57.8    3e-06   Glycine soja [wild soybean]
ref|XP_003541656.1|  PREDICTED: uncharacterized protein LOC100779...  57.8    3e-06   Glycine max [soybeans]
ref|XP_006297386.1|  hypothetical protein CARUB_v10013411mg           57.0    4e-06   
ref|XP_006297387.1|  hypothetical protein CARUB_v10013411mg           57.0    4e-06   
ref|XP_010914403.1|  PREDICTED: uncharacterized protein LOC105039818  57.4    4e-06   Elaeis guineensis
ref|XP_006408111.1|  hypothetical protein EUTSA_v10020307mg           57.0    4e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006300056.1|  hypothetical protein CARUB_v10016284mg           57.0    5e-06   
ref|XP_010492908.1|  PREDICTED: uncharacterized protein LOC104770215  57.0    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004293366.1|  PREDICTED: uncharacterized protein LOC101291024  56.6    6e-06   Fragaria vesca subsp. vesca
emb|CDY13918.1|  BnaC09g39080D                                        56.6    6e-06   Brassica napus [oilseed rape]
gb|KFK37904.1|  hypothetical protein AALP_AA3G044500                  56.6    8e-06   Arabis alpina [alpine rockcress]
ref|XP_006408128.1|  hypothetical protein EUTSA_v10022016mg           56.2    8e-06   
emb|CDX92582.1|  BnaA10g16210D                                        56.6    8e-06   
ref|XP_002276957.1|  PREDICTED: uncharacterized protein LOC100244334  56.2    1e-05   Vitis vinifera
ref|XP_002882387.1|  hypothetical protein ARALYDRAFT_477773           55.8    1e-05   
ref|XP_006471826.1|  PREDICTED: uncharacterized protein LOC102608...  55.8    1e-05   
ref|XP_010042011.1|  PREDICTED: uncharacterized protein LOC104431009  55.8    1e-05   Eucalyptus grandis [rose gum]
gb|KDO46337.1|  hypothetical protein CISIN_1g047376mg                 55.5    1e-05   Citrus sinensis [apfelsine]
ref|XP_003547217.1|  PREDICTED: uncharacterized protein LOC100817...  55.8    1e-05   Glycine max [soybeans]
ref|XP_003594017.1|  DnaJ protein-like protein                        55.8    1e-05   Medicago truncatula
gb|KEH36710.1|  DnaJ heat shock amino-terminal domain protein         55.8    1e-05   Medicago truncatula
ref|XP_006433152.1|  hypothetical protein CICLE_v10000394mg           55.8    1e-05   
ref|XP_010492905.1|  PREDICTED: uncharacterized protein LOC104770213  55.5    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010492901.1|  PREDICTED: uncharacterized protein LOC104770209  55.5    1e-05   
ref|XP_004229108.1|  PREDICTED: uncharacterized protein LOC101266860  55.5    1e-05   
ref|XP_010667707.1|  PREDICTED: uncharacterized protein LOC104884721  55.8    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009120944.1|  PREDICTED: uncharacterized protein LOC103845806  55.5    2e-05   Brassica rapa
ref|XP_002516853.1|  protein with unknown function                    55.1    2e-05   
emb|CBI26128.3|  unnamed protein product                              55.5    2e-05   Vitis vinifera
ref|XP_010492912.1|  PREDICTED: uncharacterized protein LOC104770218  55.5    2e-05   Camelina sativa [gold-of-pleasure]
gb|AAB61072.1|  contains similarity to a DNAJ-like domain             55.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198076.1|  DNAJ heat shock N-terminal domain-containing pr...  55.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512302.1|  protein with unknown function                    55.5    2e-05   Ricinus communis
ref|XP_010494032.1|  PREDICTED: uncharacterized protein LOC104771234  55.1    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY27796.1|  BnaA05g32050D                                        54.7    3e-05   Brassica napus [oilseed rape]
ref|XP_002520964.1|  protein with unknown function                    54.7    3e-05   
ref|XP_010485913.1|  PREDICTED: uncharacterized protein LOC104764150  54.7    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004486071.1|  PREDICTED: uncharacterized protein LOC101500...  54.7    3e-05   Cicer arietinum [garbanzo]
ref|XP_006844484.1|  PREDICTED: uncharacterized protein LOC18434349   54.7    3e-05   Amborella trichopoda
ref|XP_004486072.1|  PREDICTED: uncharacterized protein LOC101500...  54.7    3e-05   
ref|XP_009147276.1|  PREDICTED: trichohyalin-like                     54.7    3e-05   Brassica rapa
ref|XP_006400429.1|  hypothetical protein EUTSA_v10012639mg           54.7    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_011466354.1|  PREDICTED: uncharacterized protein LOC105352067  54.3    3e-05   Fragaria vesca subsp. vesca
ref|XP_002520963.1|  protein with unknown function                    54.3    4e-05   Ricinus communis
ref|XP_006290101.1|  hypothetical protein CARUB_v10003746mg           54.3    4e-05   
ref|XP_008458690.1|  PREDICTED: uncharacterized protein LOC103498020  54.3    4e-05   
ref|XP_011468429.1|  PREDICTED: uncharacterized protein LOC101311114  54.3    4e-05   Fragaria vesca subsp. vesca
ref|XP_009120945.1|  PREDICTED: uncharacterized protein LOC103845807  53.9    5e-05   Brassica rapa
emb|CDO98930.1|  unnamed protein product                              54.3    5e-05   Coffea canephora [robusta coffee]
ref|XP_008813744.1|  PREDICTED: uncharacterized protein LOC103724304  54.3    5e-05   
ref|XP_006287407.1|  hypothetical protein CARUB_v10000613mg           53.9    5e-05   
gb|ABF69988.1|  heat shock protein DnaJ N-terminal domain-contain...  53.9    6e-05   Musa acuminata [banana]
ref|XP_006380031.1|  hypothetical protein POPTR_0008s20070g           53.5    7e-05   
ref|XP_002871831.1|  hypothetical protein ARALYDRAFT_909887           53.5    7e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_006356999.1|  PREDICTED: uncharacterized protein LOC102591482  53.1    8e-05   
ref|XP_010492911.1|  PREDICTED: uncharacterized protein LOC104770217  53.5    8e-05   Camelina sativa [gold-of-pleasure]
emb|CDY24701.1|  BnaA05g31000D                                        53.1    8e-05   Brassica napus [oilseed rape]
ref|XP_009129660.1|  PREDICTED: dnaJ homolog subfamily C member 21    53.5    8e-05   Brassica rapa
ref|XP_010540338.1|  PREDICTED: uncharacterized protein LOC104814148  53.5    9e-05   Tarenaya hassleriana [spider flower]
ref|XP_010485885.1|  PREDICTED: uncharacterized protein LOC104764129  53.1    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007154216.1|  hypothetical protein PHAVU_003G100000g           53.5    9e-05   Phaseolus vulgaris [French bean]
ref|XP_006408126.1|  hypothetical protein EUTSA_v10019946mg           53.5    9e-05   Eutrema salsugineum [saltwater cress]
emb|CDY13917.1|  BnaC09g39090D                                        52.8    1e-04   Brassica napus [oilseed rape]
ref|XP_009147297.1|  PREDICTED: uncharacterized protein LOC103870872  53.1    1e-04   Brassica rapa
ref|XP_010423468.1|  PREDICTED: uncharacterized protein LOC104708539  53.1    1e-04   Camelina sativa [gold-of-pleasure]
gb|KHN03011.1|  Protein HLJ1                                          53.1    1e-04   Glycine soja [wild soybean]
ref|XP_007147854.1|  hypothetical protein PHAVU_006G160400g           53.1    1e-04   Phaseolus vulgaris [French bean]
ref|XP_003529595.1|  PREDICTED: uncharacterized protein LOC100795200  53.1    1e-04   Glycine max [soybeans]
ref|XP_010464019.1|  PREDICTED: uncharacterized protein LOC104744639  52.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002871835.1|  hypothetical protein ARALYDRAFT_909891           52.8    1e-04   Arabidopsis lyrata subsp. lyrata
emb|CDY27809.1|  BnaA05g32180D                                        52.8    1e-04   Brassica napus [oilseed rape]
ref|XP_010420622.1|  PREDICTED: uncharacterized protein LOC104706140  52.8    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009399319.1|  PREDICTED: uncharacterized protein LOC103983771  52.8    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967967.1|  PREDICTED: uncharacterized protein LOC101785664  52.4    2e-04   Setaria italica
gb|KEH41511.1|  DNAJ heat shock amino-terminal domain protein         52.0    2e-04   Medicago truncatula
ref|XP_004980633.1|  PREDICTED: uncharacterized protein LOC101766063  52.4    2e-04   Setaria italica
ref|XP_010495287.1|  PREDICTED: uncharacterized protein LOC104772357  52.4    2e-04   
ref|XP_002871836.1|  hypothetical protein ARALYDRAFT_909892           52.0    2e-04   
ref|XP_010492910.1|  PREDICTED: uncharacterized protein LOC104770216  52.0    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002457507.1|  hypothetical protein SORBIDRAFT_03g008500        52.0    2e-04   
emb|CDX88919.1|  BnaA03g07300D                                        52.0    3e-04   
ref|XP_009131689.1|  PREDICTED: uncharacterized protein LOC103856333  52.0    3e-04   
emb|CDY05255.1|  BnaC05g45480D                                        51.6    3e-04   
ref|XP_008657284.1|  PREDICTED: uncharacterized protein LOC103636721  51.6    3e-04   
ref|XP_006287025.1|  hypothetical protein CARUB_v10000173mg           51.6    3e-04   Capsella rubella
ref|XP_006400423.1|  hypothetical protein EUTSA_v10015238mg           51.2    4e-04   
gb|AFW79769.1|  hypothetical protein ZEAMMB73_584264                  51.6    4e-04   
ref|XP_004979549.1|  PREDICTED: uncharacterized protein LOC101754...  51.6    4e-04   Setaria italica
ref|XP_009131690.1|  PREDICTED: uncharacterized protein LOC103856334  51.2    4e-04   Brassica rapa
ref|XP_010098318.1|  DnaJ homolog subfamily B member 12               51.2    4e-04   Morus notabilis
emb|CDX70840.1|  BnaC03g09240D                                        50.8    5e-04   
ref|XP_002461875.1|  hypothetical protein SORBIDRAFT_02g009690        50.8    7e-04   Sorghum bicolor [broomcorn]
emb|CDY13939.1|  BnaC09g38870D                                        48.1    7e-04   Brassica napus [oilseed rape]
ref|XP_006353836.1|  PREDICTED: uncharacterized protein LOC102591026  49.3    7e-04   
ref|XP_006400425.1|  hypothetical protein EUTSA_v10013076mg           50.4    8e-04   
emb|CDY41919.1|  BnaC05g46850D                                        50.4    8e-04   Brassica napus [oilseed rape]
ref|XP_010495288.1|  PREDICTED: uncharacterized protein LOC104772358  50.1    9e-04   



>ref|XP_009609945.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609946.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609947.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609948.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
Length=780

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 14/111 (13%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQ TSQ +       F +K NELY FSH+IPSFR+TGTE+EGVP GSFELD A++P +P
Sbjct  665  LFQSTSQNKVGL----FFVKPNELYKFSHRIPSFRMTGTEKEGVPVGSFELDPAALPLNP  720

Query  555  NDLWYPLKEAIRNVEPELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
            +D+WYP K +  +   + +           +KV TP KS D KE+  +DG+
Sbjct  721  DDIWYPGKVSSDSTSAKSEL----------EKVTTPKKSVDWKEIGATDGE  761



>ref|XP_009781696.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
 ref|XP_009781697.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
 ref|XP_009781698.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
Length=777

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 68/111 (61%), Gaps = 14/111 (13%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQ TSQ ++      F +K NELY FSH+IPSFR+TGTE+EGVP GSFELD A++P +P
Sbjct  662  LFQSTSQNKAGL----FFVKPNELYKFSHRIPSFRMTGTEKEGVPVGSFELDPAALPLNP  717

Query  555  NDLWYPLKEAIRNVEPELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
            +D+WYP K +            +        KV TP KS + K +  +DG+
Sbjct  718  DDIWYPGKVS----------SDRTSAKSESAKVTTPKKSVNWKGIGATDGE  758



>ref|XP_009803262.1| PREDICTED: uncharacterized protein LOC104248655 [Nicotiana sylvestris]
 ref|XP_009803264.1| PREDICTED: uncharacterized protein LOC104248655 [Nicotiana sylvestris]
Length=1079

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 74/120 (62%), Gaps = 13/120 (11%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT      + S +F +K NELY FSH++PSF++TGTEREGVP GSFELD AS+P DP
Sbjct  665  LFQRT----RITLSGTFFVKPNELYKFSHRVPSFKMTGTEREGVPAGSFELDPASLPLDP  720

Query  555  NDLWYP--LKEAIRN-----VEPELKR--PGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
            +D+WYP  +KE  R      VE  L    PG   K+   +      KS D K ++ +DG+
Sbjct  721  DDIWYPGKVKEESRTSNSQPVEEVLFAVPPGTRDKSRTSENATISLKSGDLKGINATDGE  780



>ref|XP_009616187.1| PREDICTED: uncharacterized protein LOC104108774 [Nicotiana tomentosiformis]
 ref|XP_009616188.1| PREDICTED: uncharacterized protein LOC104108774 [Nicotiana tomentosiformis]
Length=1079

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 75/120 (63%), Gaps = 13/120 (11%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT      + S++F +K NELY FSH++PSF++TGTEREGVP GSFELD AS+P DP
Sbjct  665  LFQRT----RITVSATFFVKPNELYKFSHRVPSFKMTGTEREGVPAGSFELDPASLPLDP  720

Query  555  NDLWYP--LKEAIR--NVEPELKR-----PGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
            +D+WYP  +KE  R  N +P  +      PG   K+   +      KS D K +  +DG+
Sbjct  721  DDIWYPGKVKEESRTSNSQPIEEVLFAVPPGTRDKSRTSENATISLKSGDLKGIHATDGE  780



>ref|XP_011093758.1| PREDICTED: uncharacterized protein LOC105173636 [Sesamum indicum]
Length=826

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = -3

Query  717  QGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            QG     ++SFLI+ NELY FSH++PS ++TG+ER+GVP GSFELD AS+P +P+DL+YP
Sbjct  699  QGVGQCETNSFLIQPNELYKFSHRVPSVKMTGSERQGVPIGSFELDPASLPSNPDDLYYP  758

Query  537  --LKEAIRNVEPEL-----KRPGKNGKTMPPKKVGTPNKSTD  433
               K   RN++P +     +   + GKT+  K   TP KS D
Sbjct  759  GKAKTGCRNIDPGVNCSLPESIKEKGKTVESKGKSTPKKSVD  800



>ref|XP_006347843.1| PREDICTED: uncharacterized protein LOC102585480 [Solanum tuberosum]
Length=1081

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (60%), Gaps = 15/121 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR+   E  +    F +K NEL+ FSH+IPSF++TGTER+GVP GSFELD AS+P +P
Sbjct  677  LFQRSRLTEVGT----FYVKPNELFKFSHRIPSFKMTGTERDGVPAGSFELDPASLPLNP  732

Query  555  NDLWYPLK----------EAIRNVEPELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDG  406
            +D+WYP K          E + NV P +   G   K+   + V    KS + K +  ++G
Sbjct  733  DDIWYPEKVMEGSKGANSEPVENVSPAVS-SGNRDKSRKSENVTISLKSVELKSIHAANG  791

Query  405  D  403
            +
Sbjct  792  E  792



>ref|XP_006343519.1| PREDICTED: uncharacterized protein LOC102599775 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343520.1| PREDICTED: uncharacterized protein LOC102599775 isoform X2 [Solanum 
tuberosum]
Length=803

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 14/97 (14%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP--LKEAIRNV  514
            FL+  NELY FSH+IPSFR+TGTE+EGVP GSFELD AS+P +P+D+WYP  L +  RN 
Sbjct  700  FLVMPNELYKFSHQIPSFRMTGTEKEGVPVGSFELDPASLPLNPDDIWYPEKLNKDSRNP  759

Query  513  EPELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
            + EL            + V TP K  + K    +DG+
Sbjct  760  KSEL------------ENVTTPKKLVELKGTGATDGE  784



>ref|XP_004244900.1| PREDICTED: uncharacterized protein LOC101266847 [Solanum lycopersicum]
 ref|XP_004244901.1| PREDICTED: uncharacterized protein LOC101266847 [Solanum lycopersicum]
Length=789

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 10/95 (11%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            FL+K NELY FSH+IPSFR+TGTE+EGVP GSFELD AS+P +P+D+WYP K        
Sbjct  686  FLVKPNELYKFSHQIPSFRMTGTEKEGVPVGSFELDPASLPLNPDDIWYPEK--------  737

Query  507  ELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGD  403
             L +   N K+   + V TP K  + K    +DG+
Sbjct  738  -LNKDSGNPKS-ELENVTTPKKLVELKGTGATDGE  770



>ref|XP_006347846.1| PREDICTED: uncharacterized protein LOC102586152 isoform X2 [Solanum 
tuberosum]
Length=680

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F +K NELY FSH+IPSF++TGTEREGVP GSFELD AS+P +P+D+WYP
Sbjct  442  FFVKPNELYKFSHQIPSFKMTGTEREGVPAGSFELDPASLPLNPDDIWYP  491



>ref|XP_006347845.1| PREDICTED: uncharacterized protein LOC102586152 isoform X1 [Solanum 
tuberosum]
Length=843

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F +K NELY FSH+IPSF++TGTEREGVP GSFELD AS+P +P+D+WYP
Sbjct  442  FFVKPNELYKFSHQIPSFKMTGTEREGVPAGSFELDPASLPLNPDDIWYP  491



>ref|XP_010312348.1| PREDICTED: uncharacterized protein LOC104644401 isoform X2 [Solanum 
lycopersicum]
Length=646

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 7/85 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLK--EAIRNV  514
            F +K NELY FSH+IPSF++TGTEREGVP GSFELD AS+P  P+D+WYP K  E  R V
Sbjct  408  FFVKPNELYKFSHQIPSFKMTGTEREGVPAGSFELDPASLPLSPDDIWYPGKVMEDSRAV  467

Query  513  EPELKRPGKNGKTMPPKKVGTPNKS  439
              E   P +N   +P   +G  +KS
Sbjct  468  NSE---PVEND--LPAVPLGARDKS  487



>ref|XP_010312343.1| PREDICTED: uncharacterized protein LOC104644401 isoform X1 [Solanum 
lycopersicum]
Length=801

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 58/85 (68%), Gaps = 7/85 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLK--EAIRNV  514
            F +K NELY FSH+IPSF++TGTEREGVP GSFELD AS+P  P+D+WYP K  E  R V
Sbjct  408  FFVKPNELYKFSHQIPSFKMTGTEREGVPAGSFELDPASLPLSPDDIWYPGKVMEDSRAV  467

Query  513  EPELKRPGKNGKTMPPKKVGTPNKS  439
              E   P +N   +P   +G  +KS
Sbjct  468  NSE---PVEND--LPAVPLGARDKS  487



>ref|XP_011078022.1| PREDICTED: uncharacterized protein LOC105161875 [Sesamum indicum]
 ref|XP_011078023.1| PREDICTED: uncharacterized protein LOC105161875 [Sesamum indicum]
Length=789

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR+   E+D     FLI  +EL  FSH+IP F++TG EREGVP GSFELD AS+P +P
Sbjct  678  LFQRSRHTETDC----FLIGSSELLKFSHRIPCFKMTGAEREGVPVGSFELDPASLPLNP  733

Query  555  NDLWYPLKEAI---RNVEPELKRP  493
            +DL+YP K+ +   +N++P++ RP
Sbjct  734  DDLYYPGKQKMETKKNMDPKVDRP  757



>gb|EYU23667.1| hypothetical protein MIMGU_mgv1a001617mg [Erythranthe guttata]
Length=784

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR S+ E+D     F +  NELY FSH +PS +++G EREGVP GSFELD AS+P +P
Sbjct  660  LFQRASEREADF----FWVGANELYKFSHCVPSSKMSGDEREGVPVGSFELDPASLPLNP  715

Query  555  NDLWYPLKEAIRNVEPE-------LKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGDGE  397
            + L+YP K  + N+  +       LK   + GK+M  ++  TP K    K V      GE
Sbjct  716  DYLYYPSKGKMANINGKIGVCSSPLKSAKEKGKSMASEETSTPKKFAGFKRV-----QGE  770

Query  396  M  394
            M
Sbjct  771  M  771



>gb|EYU27327.1| hypothetical protein MIMGU_mgv1a001634mg [Erythranthe guttata]
Length=781

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 70/124 (56%), Gaps = 16/124 (13%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR S+ E+D     F +  NELY FSH +PS +++G ERE VP GSFELD AS+P +P
Sbjct  657  LFQRASEREADL----FWVGANELYKFSHCVPSTKMSGDEREDVPVGSFELDPASLPLNP  712

Query  555  NDLWYPLKEAIRNVEPE-------LKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGDGE  397
            + L+YP K  + N+  +       LK   + GK+M  ++  TP K    K V      GE
Sbjct  713  DYLYYPSKAKMANINGKIGVCSSPLKSAKEKGKSMASEETSTPKKFAGFKRV-----QGE  767

Query  396  MCML  385
            M  L
Sbjct  768  MSRL  771



>ref|XP_010312310.1| PREDICTED: uncharacterized protein LOC101260185 [Solanum lycopersicum]
Length=1086

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 70/121 (58%), Gaps = 15/121 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT      +   +F +K +EL+ FSH+IPSF++TGTER+GV  GSFELD AS+P +P
Sbjct  677  LFQRT----RLTGVGTFYVKPSELFKFSHRIPSFKMTGTERDGVHAGSFELDPASLPLNP  732

Query  555  NDLWYPLK----------EAIRNVEPELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDG  406
            +D+WYP K          + + NV P +   G   K+   + V    KS +   +  ++G
Sbjct  733  DDIWYPEKVMEGSKGANSQPVENVSPAVA-SGTRDKSRMSENVTISLKSVELNSIHTTNG  791

Query  405  D  403
            +
Sbjct  792  E  792



>ref|XP_010312331.1| PREDICTED: uncharacterized protein LOC104644393 [Solanum lycopersicum]
Length=445

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT        SSSF+IK NELY FSH+I SF++  TE  GVP GSFELD AS+P DP
Sbjct  369  IFQRTK----LFVSSSFVIKPNELYKFSHRILSFKMIRTEGTGVPVGSFELDTASLPLDP  424

Query  555  NDLWYPLK  532
            ND+WYP K
Sbjct  425  NDIWYPGK  432



>gb|EYU28380.1| hypothetical protein MIMGU_mgv1a002234mg [Erythranthe guttata]
Length=698

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR+SQ E+  S   F +  +E+Y FSH+IP F++TG+E+ GVP GSFELD AS+P +P
Sbjct  611  LFQRSSQSENGGS---FRVGPSEIYKFSHRIPCFKMTGSEKVGVPVGSFELDPASLPLNP  667

Query  555  NDLWYPLKEAIRNVEPELKRPGKNGKTMPPKKVG  454
            + L+YP K  + N +     PG N     PKK G
Sbjct  668  DGLYYPGKAKMENKDIA---PGDN---CAPKKKG  695



>ref|XP_009785695.1| PREDICTED: uncharacterized protein LOC104233932, partial [Nicotiana 
sylvestris]
Length=578

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT      +   +F I   + Y FSH+IPSF++TG E EGVP GSFELD  ++P +P
Sbjct  446  LFQRT----RPTVVDTFFIHPKDYYKFSHRIPSFKMTGAEGEGVPAGSFELDFYALPPNP  501

Query  555  NDLWYPLKE  529
            +D+WYP K+
Sbjct  502  DDIWYPGKD  510



>ref|XP_010315466.1| PREDICTED: uncharacterized protein LOC104645463 [Solanum lycopersicum]
Length=133

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            E+  FSH+IPSF++TGTEREGVP GSFEL+ AS+P   +D+WYP+
Sbjct  62   EICMFSHQIPSFKMTGTEREGVPSGSFELNPASLPLSSDDIWYPV  106



>emb|CDP15840.1| unnamed protein product [Coffea canephora]
Length=1135

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            LI  ++L+ FSH++PSF+++GTE+EGVPEG FELD A +P +P+D+ YPL
Sbjct  733  LIPSSDLFRFSHRVPSFKMSGTEKEGVPEGCFELDPACLPANPDDICYPL  782



>ref|XP_006347863.1| PREDICTED: uncharacterized protein LOC102594550 [Solanum tuberosum]
Length=493

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQRT      +   +F +K  ELY FSH+IPS +++GTERE VP GSFELD AS+P +P
Sbjct  431  IFQRTR----PTVVGAFFVKPKELYKFSHRIPS-KMSGTEREDVPVGSFELDPASLPLNP  485

Query  555  NDLWYPLK  532
            ND+W P K
Sbjct  486  NDIWCPGK  493



>emb|CDP20678.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 7/59 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +FQR+SQ        SFLI+  EL+ FSHK+PSFR+TGTER+GVP+GSFELD   +P D
Sbjct  428  LFQRSSQS-------SFLIEDQELFRFSHKVPSFRMTGTERQGVPKGSFELDPKDLPAD  479



>ref|XP_009341995.1| PREDICTED: uncharacterized protein LOC103934018 [Pyrus x bretschneideri]
Length=1080

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FSH+IPSF++TGTEREGVPEGSFE D A++P + 
Sbjct  620  LFQRREQ----HGVVMFQVLPNELYRFSHRIPSFKMTGTEREGVPEGSFEFDPAALPTNF  675

Query  555  NDL  547
            +DL
Sbjct  676  DDL  678



>ref|XP_009335671.1| PREDICTED: uncharacterized protein LOC103928367 [Pyrus x bretschneideri]
Length=1080

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FSH+IPSF++TGTEREGVPEGSFE D A++P + 
Sbjct  620  LFQRREQ----HGVVMFQVLPNELYRFSHRIPSFKMTGTEREGVPEGSFEFDPAALPTNF  675

Query  555  NDL  547
            +DL
Sbjct  676  DDL  678



>ref|XP_010312319.1| PREDICTED: uncharacterized protein LOC104644389 [Solanum lycopersicum]
Length=336

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            + +   ELY F H+IPSF++TG E +GVP GSFEL   S+P +PND WYP K      E 
Sbjct  218  YYVNPKELYKFPHRIPSFKMTGNEGKGVPAGSFELYPYSLPLNPNDTWYPGKVK----ET  273

Query  507  ELKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDGDGEM  394
               RP ++  +  P   G+  KS+  +  S S   G +
Sbjct  274  ANSRPVEDVSSAVPS--GSKEKSSTSEHASTSQMTGNL  309



>ref|XP_010240875.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240883.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240891.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240900.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240904.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
Length=1098

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 16/93 (17%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD-  559
            +FQRT++        SF I  NEL+ FSHK+PSFR+TG ER+ VPEGSFELD AS+P D 
Sbjct  673  LFQRTTK----EGVGSFQILPNELFRFSHKVPSFRMTGKERKDVPEGSFELDPASLPTDL  728

Query  558  -----PNDLWYPLKEAIRNVE------PELKRP  493
                 P D+   ++ A   V+      PE KRP
Sbjct  729  EKYACPEDVKVEVENADAKVKGSCPKSPENKRP  761



>gb|KHG13047.1| DnaJ subfamily B member 12 [Gossypium arboreum]
Length=949

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            VF RTS+        +F++  NEL+ FSHK+PSF LTG ER+GVP+GSFELD A++P++
Sbjct  625  VFSRTSKN----GVDTFVVPRNELFWFSHKVPSFVLTGKERKGVPKGSFELDTAALPEE  679



>ref|XP_008355770.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103419451 
[Malus domestica]
Length=1078

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FS +IPSF++TGTEREGVPEGSFE D A++P + 
Sbjct  618  LFQRREQ----HGVVMFQVPPNELYRFSXRIPSFKMTGTEREGVPEGSFEFDPAALPTNF  673

Query  555  NDL  547
            +DL
Sbjct  674  DDL  676



>ref|XP_011023498.1| PREDICTED: uncharacterized protein LOC105124962 [Populus euphratica]
 ref|XP_011023499.1| PREDICTED: uncharacterized protein LOC105124962 [Populus euphratica]
Length=1122

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR +          F I   ELY FSH+IPSFR++G E EGVP GSFELD AS+P + 
Sbjct  661  IFQRAAH----DGVIQFCIPPTELYKFSHRIPSFRMSGKEGEGVPAGSFELDPASLPSNL  716

Query  555  NDLWYPL  535
            +DL  P+
Sbjct  717  DDLGDPI  723



>ref|XP_002319580.2| hypothetical protein POPTR_0013s03040g [Populus trichocarpa]
 gb|EEE95503.2| hypothetical protein POPTR_0013s03040g [Populus trichocarpa]
Length=1091

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR +          F I   ELY FSH+IPSFR++G E EGVP GSFELD AS+P + 
Sbjct  660  IFQRAAH----DGVIQFCIPPTELYKFSHRIPSFRMSGKEGEGVPAGSFELDPASLPSNL  715

Query  555  NDLWYPL  535
            +DL  P+
Sbjct  716  DDLGDPI  722



>ref|XP_012089145.1| PREDICTED: uncharacterized protein LOC105647608 [Jatropha curcas]
 ref|XP_012089147.1| PREDICTED: uncharacterized protein LOC105647608 [Jatropha curcas]
 gb|KDP23582.1| hypothetical protein JCGZ_23415 [Jatropha curcas]
Length=904

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            VFQR    +       F I+ NELY FSH+IPSFR+TG E +GVP GSFELD A++P + 
Sbjct  689  VFQRADCDDVLK----FCIRPNELYRFSHRIPSFRMTGHEGKGVPAGSFELDTAALPDNF  744

Query  555  NDL  547
             +L
Sbjct  745  GNL  747



>ref|XP_010524767.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
 ref|XP_010524768.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
 ref|XP_010524769.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
Length=932

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            VF R ++G     S +F +   ELY FSH +PSFRLTG EREGVPEGS+ELD A++PQ+
Sbjct  618  VFCRMAKG----GSDTFQVHPLELYRFSHSVPSFRLTGKEREGVPEGSYELDPAALPQN  672



>ref|XP_011659923.1| PREDICTED: uncharacterized protein LOC101213491 [Cucumis sativus]
 ref|XP_011659924.1| PREDICTED: uncharacterized protein LOC101213491 [Cucumis sativus]
 ref|XP_011659925.1| PREDICTED: uncharacterized protein LOC101213491 [Cucumis sativus]
 gb|KGN66129.1| hypothetical protein Csa_1G572990 [Cucumis sativus]
Length=847

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 5/72 (7%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I  NELY FSH+IPS R+TG ER+GVP+GSFELD A++P + ND    L     NV+ 
Sbjct  654  FKIPPNELYRFSHQIPSVRMTGKERKGVPKGSFELDPAALPPNINDEHVDL----NNVKE  709

Query  507  ELK-RPGKNGKT  475
            E    P  +GKT
Sbjct  710  ETNDAPASSGKT  721



>ref|XP_010097335.1| J domain-containing protein [Morus notabilis]
 gb|EXB67645.1| J domain-containing protein [Morus notabilis]
Length=1164

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            VFQ+T Q        SF I  NE+Y FSH++PSFRL+G EREG+P+GS+ELD AS+P
Sbjct  685  VFQQTEQ----HGIFSFQIPPNEMYRFSHRVPSFRLSGEEREGIPKGSYELDPASLP  737



>ref|XP_010097334.1| J domain-containing protein [Morus notabilis]
 gb|EXB67644.1| J domain-containing protein [Morus notabilis]
Length=1164

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            VFQ+T Q        SF I  NE+Y FSH++PSFRL+G EREG+P+GS+ELD AS+P
Sbjct  685  VFQQTEQ----HGIFSFQIPPNEMYRFSHRVPSFRLSGEEREGIPKGSYELDPASLP  737



>ref|XP_009373931.1| PREDICTED: uncharacterized protein LOC103962880 [Pyrus x bretschneideri]
Length=835

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FSH+IPSF++TGTEREGVPE SFE D A++P   
Sbjct  615  LFQRIEQ----HGVVLFQVPPNELYRFSHRIPSFKMTGTEREGVPEESFEFDPAALPTSF  670

Query  555  NDL  547
            +D 
Sbjct  671  DDF  673



>ref|XP_007144775.1| hypothetical protein PHAVU_007G183600g [Phaseolus vulgaris]
 gb|ESW16769.1| hypothetical protein PHAVU_007G183600g [Phaseolus vulgaris]
Length=688

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +FQ+T +         F ++ NELY FSH+IPSF+++G EREGVP GSFE D AS+P +
Sbjct  621  LFQKTCEN----GVDVFYVRPNELYRFSHQIPSFKMSGNEREGVPRGSFEFDPASLPSN  675



>gb|KHN20189.1| DnaJ like subfamily B member 12 [Glycine soja]
Length=709

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT +       + F I+ NELY FSH+IPS+++TG EREGVP GSFE D A++P
Sbjct  643  LFQRTEKN----GVNIFYIEPNELYRFSHRIPSYKMTGYEREGVPRGSFEFDPAALP  695



>ref|XP_006606497.1| PREDICTED: meiotically up-regulated gene 184 protein-like isoform 
X1 [Glycine max]
 ref|XP_006606498.1| PREDICTED: meiotically up-regulated gene 184 protein-like isoform 
X2 [Glycine max]
Length=709

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT +       + F I+ NELY FSH+IPS+++TG EREGVP GSFE D A++P
Sbjct  643  LFQRTEKN----GVNIFYIEPNELYRFSHRIPSYKMTGYEREGVPRGSFEFDPAALP  695



>emb|CDX99992.1| BnaC09g03090D [Brassica napus]
Length=941

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 6/79 (8%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            NE+  FSHK+PSF+LTG EREGVP G FELD A++P+   +++  +K     V+ EL R 
Sbjct  600  NEMLRFSHKVPSFKLTGREREGVPPGCFELDTAALPK---EMFQVVKS---KVDVELDRK  653

Query  492  GKNGKTMPPKKVGTPNKST  436
              NGK+ P     T N++T
Sbjct  654  MANGKSDPCGLSETNNQAT  672



>ref|XP_008366850.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103430484 
[Malus domestica]
Length=837

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FSH+IPSF++TGTEREGVPE SFE D A++P   
Sbjct  619  LFQRIEQ----HGFVLFQVPPNELYRFSHRIPSFKMTGTEREGVPEESFEFDPAALPTSF  674

Query  555  NDL  547
            +D 
Sbjct  675  DDF  677



>ref|XP_008359874.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423564 
[Malus domestica]
Length=849

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR  Q         F +  NELY FSH+IPSF++TGTEREGVPE SFE D A++P   
Sbjct  631  LFQRIEQ----HGFVLFQVPPNELYRFSHRIPSFKMTGTEREGVPEESFEFDPAALPTSF  686

Query  555  NDL  547
            +D 
Sbjct  687  DDF  689



>ref|XP_010024522.1| PREDICTED: uncharacterized protein LOC104414985 [Eucalyptus grandis]
 gb|KCW60974.1| hypothetical protein EUGRSUZ_H03712 [Eucalyptus grandis]
Length=974

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 7/72 (10%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I  +ELY FSH++PS+R+TG EREGVP+GSFELD AS+P +       L+E + + +P
Sbjct  626  FQIGPDELYRFSHRVPSYRMTGDEREGVPKGSFELDPASMPSN-------LEEFVPSEDP  678

Query  507  ELKRPGKNGKTM  472
            E+   G + + +
Sbjct  679  EMSTNGSHCEAL  690



>ref|XP_011048882.1| PREDICTED: uncharacterized protein LOC105142787 [Populus euphratica]
 ref|XP_011048883.1| PREDICTED: uncharacterized protein LOC105142787 [Populus euphratica]
Length=1125

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL-----KEAI  523
            F I   ELY FSH+IPSFR++G E +GVP GSFELD AS+P + +DL  P      KE +
Sbjct  660  FCIPPTELYKFSHRIPSFRMSGKEGDGVPAGSFELDPASLPSNLDDLSDPSDAKLEKENV  719

Query  522  RNVEPEL--KRPGKNGKTM-PPKKVGTPNKSTDCKEVSDS  412
             N    L  + P    KT    KK+ TP K     E+  S
Sbjct  720  HNQSTNLCSQSPKSELKTTKSSKKIFTPKKYESGPEIGSS  759



>ref|XP_006382690.1| hypothetical protein POPTR_0005s04470g [Populus trichocarpa]
 gb|ERP60487.1| hypothetical protein POPTR_0005s04470g [Populus trichocarpa]
Length=1126

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL-----KEAI  523
            F I   ELY FSH+IPSFR++G E +GVP GSFELD AS+P + +DL  P      KE +
Sbjct  662  FCIPPTELYKFSHRIPSFRMSGKEGDGVPAGSFELDPASLPSNLDDLSDPSDTKLEKENV  721

Query  522  RNVEPEL--KRPGKNGKTMP-PKKVGTPNKSTDCKEVSDS  412
             N    L  + P    KT    +K+ TP K     E+  S
Sbjct  722  HNQSTNLCSQSPKSELKTTKVSRKICTPKKYESGPEIGSS  761



>ref|XP_008246552.1| PREDICTED: uncharacterized protein LOC103344708 [Prunus mume]
Length=1115

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 7/78 (9%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR+ Q         F +  NELY FSH+IPSF++TG ER+GVP+ SFE D AS+P + 
Sbjct  655  LFQRSEQ----HGVILFQVPRNELYRFSHRIPSFKMTGDERDGVPKESFEFDPASLPTNL  710

Query  555  NDLWYPLKEAIR--NVEP  508
            +D +  LK+  R  N EP
Sbjct  711  DD-FNDLKKGNRAMNTEP  727



>emb|CDY27812.1| BnaA05g32210D [Brassica napus]
Length=55

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             +I  +E+  FSH++PSF+LTG E +GVP GSFELD A+IP+D
Sbjct  1    MMIPSDEMLRFSHRVPSFKLTGDEEKGVPAGSFELDPAAIPKD  43



>gb|KJB72559.1| hypothetical protein B456_011G184900 [Gossypium raimondii]
Length=949

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            VF R S+        +F++  NEL+ FSH +PSF LTG ER+GVP+GSFELD A++P++
Sbjct  626  VFSRMSKN----GVDTFVVPRNELFRFSHMVPSFVLTGKERKGVPKGSFELDTAALPEE  680



>ref|XP_008450718.1| PREDICTED: uncharacterized protein LOC103492216 [Cucumis melo]
 ref|XP_008450719.1| PREDICTED: uncharacterized protein LOC103492216 [Cucumis melo]
Length=845

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I  NELY FSH+IPS R+TG ER+ VP+GSFELD A++P + N+        + NV+ 
Sbjct  651  FKIPPNELYRFSHQIPSVRMTGKERKDVPKGSFELDPAALPPNINE-----HVDLNNVKE  705

Query  507  E-LKRPGKNGKTMPPKKVGTPNKSTDCKEVSDSDG  406
            E +  P  +G+T P     +P +  +  ++ +++ 
Sbjct  706  ETIDAPAASGRTDPSHGFKSPKEKVEVIDLDNNEA  740



>ref|XP_002266568.2| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera]
 ref|XP_010660003.1| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera]
Length=1169

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            F I  +EL  FSH+IPSFR+TG+E EGVP+GSFELD A++P + ND 
Sbjct  697  FQIPPSELLRFSHRIPSFRMTGSEGEGVPKGSFELDPAALPNNLNDF  743



>emb|CBI34299.3| unnamed protein product [Vitis vinifera]
Length=804

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            F I  +EL  FSH+IPSFR+TG+E EGVP+GSFELD A++P + ND 
Sbjct  506  FQIPPSELLRFSHRIPSFRMTGSEGEGVPKGSFELDPAALPNNLNDF  552



>ref|XP_007030109.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY10611.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
Length=1029

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F +   ELY FSH+IPS R+TG EREGVP GSFELD AS+P + ++L  P
Sbjct  695  FQVSPRELYRFSHRIPSCRMTGKEREGVPLGSFELDPASLPTNLDELVDP  744



>ref|XP_004153904.1| PREDICTED: uncharacterized protein LOC101214527 [Cucumis sativus]
 ref|XP_011656662.1| PREDICTED: uncharacterized protein LOC101214527 [Cucumis sativus]
 ref|XP_011656663.1| PREDICTED: uncharacterized protein LOC101214527 [Cucumis sativus]
 gb|KGN46188.1| hypothetical protein Csa_6G067950 [Cucumis sativus]
Length=940

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 49/86 (57%), Gaps = 7/86 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F +   EL+ FSH++PSF LTG EREGVP GSFELD A++P  PN     L E I+ V+ 
Sbjct  610  FQVPAAELFRFSHRVPSFPLTGDEREGVPRGSFELDPAALP--PNLPEIILPEHIKEVDS  667

Query  507  ELKRP-----GKNGKTMPPKKVGTPN  445
            + +R      G NG+    +     N
Sbjct  668  DTRRSTLPMMGSNGEASTHEAAADTN  693



>ref|XP_009787122.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
 ref|XP_009787130.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
 ref|XP_009787138.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
Length=1064

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            FLI   E++ FSH++PSF++TG ER  VPEGSFELD AS+P D
Sbjct  637  FLIPAKEIFRFSHRVPSFKMTGMERNNVPEGSFELDPASLPID  679



>ref|XP_007207549.1| hypothetical protein PRUPE_ppa017544mg [Prunus persica]
 gb|EMJ08748.1| hypothetical protein PRUPE_ppa017544mg [Prunus persica]
Length=1061

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +FQR+ Q         F +  NEL+ FSH+IPSF++TG ER+GVP+ SFE D AS+P + 
Sbjct  601  LFQRSEQ----HGVILFQVPRNELFRFSHRIPSFKMTGDERDGVPKESFEFDPASLPTNL  656

Query  555  NDL  547
            +D 
Sbjct  657  DDF  659



>ref|XP_009151221.1| PREDICTED: uncharacterized protein LOC103874549 [Brassica rapa]
 emb|CDX86172.1| BnaA06g28890D [Brassica napus]
Length=629

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  NE+  FSHK+PSF++TG E EGVP G FELD+A++P+D
Sbjct  505  FQIPANEMLRFSHKVPSFKMTGRESEGVPPGCFELDIAALPKD  547



>gb|KDO46342.1| hypothetical protein CISIN_1g003534mg [Citrus sinensis]
 gb|KDO46343.1| hypothetical protein CISIN_1g003534mg [Citrus sinensis]
Length=812

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 17/109 (16%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP------QDPNDLWYPLKEA  526
            F I    +Y FSH+IPS+++TG EREGVP GSFE D AS+P       DP+D+    KE 
Sbjct  354  FSIAPAHMYKFSHQIPSYKMTGKEREGVPVGSFEFDPASLPTSVNKLDDPDDVQME-KEN  412

Query  525  IRNVEPELKRPGKNGK---TMPPKKVGTPNKSTDCKEVSDSDGDGEMCM  388
            + +    L      GK   TM  KK   P +        DSD +GE  M
Sbjct  413  LVSKSSGLSPASAKGKEKPTMDSKKTSLPKR-------PDSDPEGEHLM  454



>ref|XP_006433149.1| hypothetical protein CICLE_v10000081mg [Citrus clementina]
 ref|XP_006471828.1| PREDICTED: uncharacterized protein LOC102610046 isoform X1 [Citrus 
sinensis]
 ref|XP_006471829.1| PREDICTED: uncharacterized protein LOC102610046 isoform X2 [Citrus 
sinensis]
 ref|XP_006471830.1| PREDICTED: uncharacterized protein LOC102610046 isoform X3 [Citrus 
sinensis]
 ref|XP_006471831.1| PREDICTED: uncharacterized protein LOC102610046 isoform X4 [Citrus 
sinensis]
 ref|XP_006471832.1| PREDICTED: uncharacterized protein LOC102610046 isoform X5 [Citrus 
sinensis]
 gb|ESR46389.1| hypothetical protein CICLE_v10000081mg [Citrus clementina]
Length=1142

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 17/109 (16%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP------QDPNDLWYPLKEA  526
            F I    +Y FSH+IPS+++TG EREGVP GSFE D AS+P       DP+D+    KE 
Sbjct  684  FSIAPAHMYKFSHQIPSYKMTGKEREGVPVGSFEFDPASLPTSVNKLDDPDDVQME-KEN  742

Query  525  IRNVEPELKRPGKNGK---TMPPKKVGTPNKSTDCKEVSDSDGDGEMCM  388
            + +    L      GK   TM  KK   P +        DSD +GE  M
Sbjct  743  LVSKSSGLSPASAKGKEKPTMDSKKTSLPKR-------PDSDPEGEHLM  784



>ref|XP_006471822.1| PREDICTED: uncharacterized protein LOC102608495 isoform X1 [Citrus 
sinensis]
 ref|XP_006471823.1| PREDICTED: uncharacterized protein LOC102608495 isoform X2 [Citrus 
sinensis]
 ref|XP_006471824.1| PREDICTED: uncharacterized protein LOC102608495 isoform X3 [Citrus 
sinensis]
Length=1367

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 17/109 (16%)
 Frame = -3

Query  687   FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP------QDPNDLWYPLKEA  526
             F I    +Y FSH+IPS+++TG EREGVP GSFE D AS+P       DP+D+    KE 
Sbjct  909   FSIAPAHMYKFSHQIPSYKMTGKEREGVPVGSFEFDPASLPTSVNKLDDPDDVQME-KEN  967

Query  525   IRNVEPELKRPGKNGK---TMPPKKVGTPNKSTDCKEVSDSDGDGEMCM  388
             + +    L      GK   TM  KK   P +        DSD +GE  M
Sbjct  968   LVSKSSGLSPASAKGKEKPTMDSKKTSLPKR-------PDSDPEGEHLM  1009



>ref|XP_009596456.1| PREDICTED: uncharacterized protein LOC104092542 [Nicotiana tomentosiformis]
Length=1063

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            FLI   E++ FSH++PSF++TG ER  VPEGSFELD AS+P D
Sbjct  636  FLIPAKEIFRFSHRVPSFKMTGMERNDVPEGSFELDPASLPID  678



>ref|XP_006471825.1| PREDICTED: uncharacterized protein LOC102608495 isoform X4 [Citrus 
sinensis]
Length=1362

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 17/109 (16%)
 Frame = -3

Query  687   FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP------QDPNDLWYPLKEA  526
             F I    +Y FSH+IPS+++TG EREGVP GSFE D AS+P       DP+D+    KE 
Sbjct  904   FSIAPAHMYKFSHQIPSYKMTGKEREGVPVGSFEFDPASLPTSVNKLDDPDDVQME-KEN  962

Query  525   IRNVEPELKRPGKNGK---TMPPKKVGTPNKSTDCKEVSDSDGDGEMCM  388
             + +    L      GK   TM  KK   P +        DSD +GE  M
Sbjct  963   LVSKSSGLSPASAKGKEKPTMDSKKTSLPKR-------PDSDPEGEHLM  1004



>ref|XP_009624052.1| PREDICTED: uncharacterized protein LOC104115174 [Nicotiana tomentosiformis]
Length=1067

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            FLI   E++ FSH++PSF++TG ER  VPEGSFELD AS+P D
Sbjct  640  FLIPAKEIFRFSHRVPSFKMTGMERNDVPEGSFELDPASLPID  682



>ref|XP_009111937.1| PREDICTED: uncharacterized protein LOC103837329 [Brassica rapa]
Length=1043

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            NE+  FSHK+PSF+LTG EREGVP G FELD A++P+D
Sbjct  626  NEMLRFSHKVPSFKLTGREREGVPPGCFELDTAALPKD  663



>emb|CDP20677.1| unnamed protein product [Coffea canephora]
Length=202

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +FQR SQ E DS    FLI+  +L+ FSHK+PS ++TG++R GVPE SFELD   +P D
Sbjct  146  LFQRRSQSEKDS----FLIEDKKLFRFSHKVPSCKMTGSKRPGVPEESFELDPKDLPAD  200



>ref|XP_007035447.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY06373.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
Length=978

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            FLI  +EL+ FSHK+ SF LTG ER+G+P+GSFELD AS+P  P ++  P
Sbjct  660  FLIPPDELFRFSHKVLSFVLTGKERKGLPKGSFELDPASLPAHPEEIVAP  709



>ref|XP_010240852.1| PREDICTED: uncharacterized protein LOC104585612 [Nelumbo nucifera]
Length=1070

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT++       +SF I  NEL+ FSH +PSF++TG E E VPEGSFELD AS+P
Sbjct  666  LFQRTTK----EGVNSFQIPPNELFRFSHMVPSFKMTGKEXEDVPEGSFELDPASLP  718



>ref|XP_011009900.1| PREDICTED: uncharacterized protein LOC105114890 [Populus euphratica]
Length=957

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP--LKEAIRNV  514
            F I   EL+ FSH IPSF+LTG EREGVP GSFELD AS+P+   ++  P  L+E + N 
Sbjct  616  FEIPPAELFRFSHMIPSFKLTGNEREGVPRGSFELDPASLPKTILEIANPEDLREEVGNA  675



>ref|XP_009383695.1| PREDICTED: uncharacterized protein LOC103971406 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383698.1| PREDICTED: uncharacterized protein LOC103971406 [Musa acuminata 
subsp. malaccensis]
Length=1054

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F+I  +E+  FSH +PS+RL+GTEREG+P+GS ELD AS+P +
Sbjct  659  FVIPPHEILCFSHNVPSYRLSGTEREGIPQGSLELDCASLPSN  701



>gb|KJB28586.1| hypothetical protein B456_005G056900 [Gossypium raimondii]
Length=932

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             LI  NEL  FSHK+PSF LTG ER+GVP+GSFELD AS+P++
Sbjct  624  ILIPPNELLRFSHKVPSFVLTGKERKGVPKGSFELDPASLPEE  666



>emb|CDX80667.1| BnaC07g27770D [Brassica napus]
Length=665

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  NE+  FSHK+PSF++TG E EGVP G FELD+A++P+D
Sbjct  514  FQIPPNEMLRFSHKVPSFKMTGRESEGVPPGCFELDIAALPKD  556



>ref|XP_010546913.1| PREDICTED: uncharacterized protein LOC104818838 [Tarenaya hassleriana]
Length=965

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            I  +ELY +SH +PSFRLTG ERE VPEGS+ELD A++P++  ++  P
Sbjct  671  IPAHELYRWSHSVPSFRLTGNEREDVPEGSYELDPAALPENTEEISAP  718



>gb|KJB19229.1| hypothetical protein B456_003G089700 [Gossypium raimondii]
Length=1160

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F +   ELY FSH++PSFR++G EREG+P GSFELD A +P
Sbjct  689  FQVSSRELYRFSHRVPSFRMSGKEREGIPVGSFELDPACLP  729



>ref|XP_010540340.1| PREDICTED: uncharacterized protein LOC104814150 [Tarenaya hassleriana]
Length=871

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            E+  FSHK+PSFR+TGTEREGVP GSFELD +++P+D
Sbjct  826  EMCRFSHKVPSFRMTGTEREGVPPGSFELDPSALPKD  862



>ref|XP_006577265.1| PREDICTED: uncharacterized protein LOC100782762 [Glycine max]
 gb|KHN04034.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=1067

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT      +  S F I  NELY FSH+IPS+++TG ER+ VP GSFELD A +P
Sbjct  629  LFQRT----VLNRISLFCILPNELYKFSHRIPSYKMTGAERQDVPRGSFELDPAGLP  681



>ref|XP_010558494.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
 ref|XP_010558495.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
 ref|XP_010558496.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
Length=991

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +ELY FSH +PSFRLTG ER+GVPEGS+ELD A++P
Sbjct  694  HELYRFSHSVPSFRLTGKERKGVPEGSYELDPAALP  729



>ref|XP_006855386.1| PREDICTED: uncharacterized protein LOC18445183 [Amborella trichopoda]
 gb|ERN16853.1| hypothetical protein AMTR_s00057p00136560 [Amborella trichopoda]
Length=1095

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I  ++++ FSH++P++R+ G ER+G+P+GS ELD AS+P D  DL  P
Sbjct  682  FQITRDQMFRFSHQVPAYRMRGDERDGIPQGSMELDPASLPSDVKDLVLP  731



>gb|KHG04775.1| DnaJ subfamily B member 12 [Gossypium arboreum]
Length=1159

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F +   ELY FSH++PSFR++G EREG+P GSFELD A +P
Sbjct  688  FQVSSRELYRFSHQVPSFRMSGKEREGIPVGSFELDPACLP  728



>ref|XP_002314476.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEF00647.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=866

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            F I   EL+ FSH IPSF+LTG EREGVP GSFELD AS+P+
Sbjct  565  FEIPPAELFRFSHMIPSFKLTGNEREGVPRGSFELDPASLPK  606



>ref|XP_006289445.1| hypothetical protein CARUB_v10002959mg [Capsella rubella]
 gb|EOA22343.1| hypothetical protein CARUB_v10002959mg [Capsella rubella]
Length=1099

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 6/69 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +E+  FSHK+P+F++TG EREGVP G FELD A++P+   ++ Y   + + N E    RP
Sbjct  660  SEMLRFSHKVPAFKMTGKEREGVPPGCFELDTAALPKQLFEIDYSKADVVLNRE----RP  715

Query  492  GKNGKTMPP  466
              +GKT+ P
Sbjct  716  --DGKTIGP  722



>ref|XP_004495763.1| PREDICTED: uncharacterized protein LOC101513909 [Cicer arietinum]
Length=683

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPND  550
            NELY FSH+IPS++++G EREGVP G FELD A++P + +D
Sbjct  629  NELYRFSHRIPSYKMSGDEREGVPRGCFELDPAALPTNFDD  669



>ref|XP_007147102.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 ref|XP_007147103.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 gb|ESW19096.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 gb|ESW19097.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
Length=1070

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I  +E+Y FSH+IPS+++TG ER+GVP GSFELD A +P
Sbjct  645  FCISPHEMYRFSHRIPSYKMTGAERKGVPSGSFELDPAGLP  685



>ref|XP_006389136.1| hypothetical protein POPTR_0044s002902g, partial [Populus trichocarpa]
 gb|ERP48050.1| hypothetical protein POPTR_0044s002902g, partial [Populus trichocarpa]
Length=391

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 6/53 (11%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ------DPNDL  547
            F I   EL+ FSH IPSF+LTG EREGVP GSFELD AS+P+      +P DL
Sbjct  48   FEIPPAELFRFSHMIPSFKLTGNEREGVPRGSFELDPASLPKTILETANPEDL  100



>ref|XP_006356967.1| PREDICTED: uncharacterized protein LOC102580437 [Solanum tuberosum]
Length=917

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            FL+   E+  FSH++PSF++TG ER  VPEGSFELD AS+P D
Sbjct  609  FLVPAKEMLRFSHRVPSFKMTGMERNDVPEGSFELDPASLPTD  651



>ref|XP_002874391.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50650.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1104

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +E+  FSHK+PSF++TG EREGVP G FELD A++P++    ++ + ++  +V  E +RP
Sbjct  642  SEMLRFSHKVPSFKMTGKEREGVPPGCFELDTAALPKE----FFEVCDSKVDVGLERERP  697

Query  492  GKNGKTMPP  466
              NGKT  P
Sbjct  698  --NGKTGGP  704



>ref|XP_002884491.1| hypothetical protein ARALYDRAFT_340677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60750.1| hypothetical protein ARALYDRAFT_340677 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F+I   E+  FSHK+PSFRL G E+EGVP GSFELD A+IP
Sbjct  548  FMITPEEMQRFSHKVPSFRLNGEEKEGVPVGSFELDPAAIP  588



>ref|XP_006394983.1| hypothetical protein EUTSA_v10003562mg [Eutrema salsugineum]
 gb|ESQ32269.1| hypothetical protein EUTSA_v10003562mg [Eutrema salsugineum]
Length=1068

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +E+  FSHK+PSF++TG EREGVP G FELD A++P+D     +    +   V+  L R 
Sbjct  612  SEMLRFSHKVPSFKMTGKEREGVPPGCFELDTAALPKD----MFEFDNS--KVDAGLDRG  665

Query  492  GKNGKT  475
             +NGKT
Sbjct  666  RRNGKT  671



>ref|XP_009779333.1| PREDICTED: uncharacterized protein LOC104228554 [Nicotiana sylvestris]
Length=1066

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            FLI   E++ FSH++PSF++ G ER  VPEGSFELD AS+P D
Sbjct  639  FLIPAKEIFRFSHRVPSFKMIGMERNDVPEGSFELDPASLPID  681



>gb|KJB44649.1| hypothetical protein B456_007G263100 [Gossypium raimondii]
Length=321

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F +    LY FSH+IPS ++TG EREGVP GSFELD AS+P D
Sbjct  273  FRLSSRNLYRFSHQIPSVKMTGKEREGVPVGSFELDPASLPTD  315



>emb|CDY41917.1| BnaC05g46870D [Brassica napus]
Length=956

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             +++ +E+  FSH++PSF LTG ER+GVP GSFELD A+IP+D
Sbjct  903  MMVRCDEMLRFSHRVPSFVLTGDERKGVPAGSFELDPAAIPRD  945


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             +I  +E+  FSH++PSF LTG ER+GVP GSFELD A+IP+D
Sbjct  414  MMIPSDEMLRFSHRVPSFVLTGDERKGVPAGSFELDPAAIPKD  456



>ref|XP_012088502.1| PREDICTED: uncharacterized protein LOC105647119 [Jatropha curcas]
 ref|XP_012088503.1| PREDICTED: uncharacterized protein LOC105647119 [Jatropha curcas]
 ref|XP_012088504.1| PREDICTED: uncharacterized protein LOC105647119 [Jatropha curcas]
 gb|KDP23995.1| hypothetical protein JCGZ_25383 [Jatropha curcas]
Length=956

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I   EL+ FSH IPSF+LTG ER+GVP GSFELD AS+P++
Sbjct  618  FQIPPGELFRFSHMIPSFKLTGEERQGVPRGSFELDPASLPKN  660



>ref|XP_003553743.1| PREDICTED: uncharacterized protein LOC100819284 isoform X1 [Glycine 
max]
 ref|XP_006604830.1| PREDICTED: uncharacterized protein LOC100819284 isoform X2 [Glycine 
max]
Length=1058

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT      +  S F I  NELY FSH IPS+++TG ER+ VP GSFELD A +P
Sbjct  629  LFQRT----VLNRISFFCILPNELYKFSHHIPSYKMTGAERQDVPRGSFELDPAGLP  681



>ref|XP_009147303.1| PREDICTED: protein split ends-like [Brassica rapa]
Length=468

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             +I  +E+  FSH++PSF+LTG E++GVP GSFELD A+IP+D
Sbjct  414  MMIPSDEMLRFSHRVPSFKLTGDEKKGVPAGSFELDPAAIPKD  456



>ref|XP_010941769.1| PREDICTED: uncharacterized protein LOC105059940 [Elaeis guineensis]
Length=1068

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            ++I  +E+  FSH IPS+R+TG EREG+P+G FELD AS+P +  ++++ +
Sbjct  673  YVIPPSEILRFSHNIPSYRMTGAEREGIPKGCFELDSASLPNNFQEVFHSI  723



>ref|XP_008776154.1| PREDICTED: uncharacterized protein LOC103696336 [Phoenix dactylifera]
Length=1078

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            ++I  +E+  FSH IPS+R+TG EREG+P+G FELD AS+P +  ++++ +
Sbjct  683  YVIPPSEILRFSHNIPSYRMTGAEREGIPKGCFELDSASLPDNFQEVFHSI  733



>gb|KEH43065.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=664

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +F++T  G++  ++ +F I  N+ Y FSH+IPSFR++G EREGVP G FE D A++P
Sbjct  590  LFEKT--GKNGDNTFTFSIPPNQTYRFSHQIPSFRMSGDEREGVPRGCFEFDPAALP  644



>ref|XP_012088500.1| PREDICTED: uncharacterized protein LOC105647118 [Jatropha curcas]
 ref|XP_012088501.1| PREDICTED: uncharacterized protein LOC105647118 [Jatropha curcas]
 gb|KDP23994.1| hypothetical protein JCGZ_25382 [Jatropha curcas]
Length=957

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            F I   EL+ FSH IPSF+LTG ER+GVP+GSFELD AS+ Q+  ++
Sbjct  620  FQIPPGELFRFSHMIPSFKLTGEERQGVPKGSFELDPASLSQNIEEI  666



>ref|XP_011470765.1| PREDICTED: uncharacterized protein LOC105353384 [Fragaria vesca 
subsp. vesca]
Length=254

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  +ELY FSH+IPSF+++G E+ GVP+ SFELD AS+P D
Sbjct  212  FQIPAHELYRFSHRIPSFKMSGGEKRGVPKDSFELDPASLPSD  254



>emb|CDY41935.1| BnaC05g46690D [Brassica napus]
Length=532

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            VF+  +QG         +I+ +E+  FSH++PS RL+G E+EGVP GSFELD A++P
Sbjct  470  VFKHAAQG----RVVKLVIRPDEMQRFSHRVPSVRLSGDEKEGVPAGSFELDPAAVP  522



>ref|XP_010464020.1| PREDICTED: uncharacterized protein LOC104744640 [Camelina sativa]
Length=567

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F+I   E+  FSH++PSFR+ G E+EGVP GSFELD A+IP
Sbjct  493  FMISPEEMRRFSHRVPSFRMNGEEKEGVPAGSFELDPAAIP  533



>ref|XP_009147302.1| PREDICTED: flagellar attachment zone protein 1-like [Brassica 
rapa]
Length=549

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             ++  +E+  FSH++PSF+LTG E++GVP GSFELD A+IP+D
Sbjct  496  MMVTCDEMLRFSHRVPSFKLTGDEKKGVPAGSFELDPAAIPRD  538



>ref|XP_004229298.1| PREDICTED: uncharacterized protein LOC101248043 [Solanum lycopersicum]
Length=903

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F++   E+  FSH++PSF++TG ER  VPEGSFELD AS+P D
Sbjct  601  FVVPAKEMLRFSHRVPSFKMTGMERNDVPEGSFELDPASLPTD  643



>ref|XP_010420651.1| PREDICTED: uncharacterized protein LOC104706189 [Camelina sativa]
Length=906

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP-LKEAIRNVE  511
            F I  +EL  FSH++PS +LTG ER+GVP GS+ELD A+IP    D   P L+EA ++ +
Sbjct  605  FQISPHELLRFSHRVPSTKLTGKERDGVPVGSYELDTAAIPHKIEDEPVPVLREAAKSTQ  664



>emb|CDY27811.1| BnaA05g32200D [Brassica napus]
Length=479

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             ++  +E+  FSH++PSF LTG ER+GVP GSFELD A+IP+D
Sbjct  426  MMVTCDEMLRFSHRVPSFVLTGDERKGVPAGSFELDPAAIPRD  468



>ref|XP_004305041.1| PREDICTED: uncharacterized protein LOC101309953 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1117

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQ+T Q         F +  +ELY FSH+IPSF++TG E  GVP GSFELD AS+P
Sbjct  655  LFQKTEQ----HGVVMFQVPPHELYRFSHQIPSFKMTGCEGHGVPPGSFELDPASLP  707



>ref|XP_011466352.1| PREDICTED: uncharacterized protein LOC101309953 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1089

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQ+T Q         F +  +ELY FSH+IPSF++TG E  GVP GSFELD AS+P
Sbjct  627  LFQKTEQ----HGVVMFQVPPHELYRFSHQIPSFKMTGCEGHGVPPGSFELDPASLP  679



>emb|CDP18388.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            ++QR  QG+        LI  N+L  FSH++PS+ + GTE EGVPEGSFELD A+IP  P
Sbjct  592  LYQRKIQGKP------VLIPPNQLLRFSHRVPSYTMHGTEGEGVPEGSFELDPAAIPLAP  645



>gb|AAG51424.1|AC009465_24 hypothetical protein; 31126-29176 [Arabidopsis thaliana]
Length=603

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            V++R +Q          +I  +E+  FSH++PSF++TG E+EGVP GSFELD A++P+
Sbjct  531  VYERAAQN----GLVEIMISCDEMLRFSHRVPSFKMTGDEKEGVPAGSFELDPAAVPR  584



>ref|NP_001078109.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE74167.1| uncharacterized protein AT3G04960 [Arabidopsis thaliana]
Length=605

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            V++R +Q          +I  +E+  FSH++PSF++TG E+EGVP GSFELD A++P+
Sbjct  533  VYERAAQN----GLVEIMISCDEMLRFSHRVPSFKMTGDEKEGVPAGSFELDPAAVPR  586



>ref|NP_001189810.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE74168.1| uncharacterized protein AT3G04960 [Arabidopsis thaliana]
Length=553

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            V++R +Q          +I  +E+  FSH++PSF++TG E+EGVP GSFELD A++P+
Sbjct  481  VYERAAQN----GLVEIMISCDEMLRFSHRVPSFKMTGDEKEGVPAGSFELDPAAVPR  534



>ref|NP_001078108.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE74166.1| uncharacterized protein AT3G04960 [Arabidopsis thaliana]
Length=504

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            V++R +Q          +I  +E+  FSH++PSF++TG E+EGVP GSFELD A++P+
Sbjct  432  VYERAAQN----GLVEIMISCDEMLRFSHRVPSFKMTGDEKEGVPAGSFELDPAAVPR  485



>ref|XP_007207755.1| hypothetical protein PRUPE_ppa026943mg, partial [Prunus persica]
 gb|EMJ08954.1| hypothetical protein PRUPE_ppa026943mg, partial [Prunus persica]
Length=376

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F +  NELY FS++IPS +LTG ER+GVP+GSFE D A++P +
Sbjct  333  FRVPPNELYRFSNQIPSVKLTGDERDGVPKGSFEFDTAALPHE  375



>ref|NP_187147.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ACF40323.1| At3g04960 [Arabidopsis thaliana]
 gb|AEE74165.1| uncharacterized protein AT3G04960 [Arabidopsis thaliana]
Length=556

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            V++R +Q          +I  +E+  FSH++PSF++TG E+EGVP GSFELD A++P+
Sbjct  484  VYERAAQN----GLVEIMISCDEMLRFSHRVPSFKMTGDEKEGVPAGSFELDPAAVPR  537



>ref|XP_009382035.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382043.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382052.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382060.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
Length=1054

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            ++I  NE+  FSH IPS+RL GTE+EG+P+G  ELD AS+P D
Sbjct  680  YMIPPNEILRFSHGIPSYRLNGTEKEGIPQGCLELDPASLPTD  722



>gb|KEH42053.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=664

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I  NELY FSH+IPS++++G EREGVP   FELD A++P
Sbjct  600  FCIPLNELYRFSHQIPSYKMSGDEREGVPRDCFELDPAALP  640



>ref|XP_010455145.1| PREDICTED: uncharacterized protein LOC104736786 isoform X1 [Camelina 
sativa]
 ref|XP_010455147.1| PREDICTED: uncharacterized protein LOC104736786 isoform X2 [Camelina 
sativa]
 ref|XP_010455148.1| PREDICTED: uncharacterized protein LOC104736786 isoform X3 [Camelina 
sativa]
Length=1086

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 6/69 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +E+  FSHK+PSF++TG EREGVP G FELD A++P++     + +  +  +V  + +RP
Sbjct  655  SEMLRFSHKVPSFKMTGKEREGVPPGCFELDTAALPEE----LFEVDNSKADVGLDRERP  710

Query  492  GKNGKTMPP  466
              +GKT+ P
Sbjct  711  --DGKTIGP  717



>gb|KHN43244.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=1058

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +FQRT      +  S F I  NELY FSH IPS+++TG ER+  P GSFELD A +P
Sbjct  629  LFQRT----VLNRISFFCILPNELYKFSHHIPSYKMTGAERQDAPRGSFELDPAGLP  681



>ref|XP_004494655.1| PREDICTED: uncharacterized protein LOC101488726 [Cicer arietinum]
Length=1091

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASI  568
            +FQ+T Q         F +  NE+Y FSH++PS ++TG EREGVP GSFELD A +
Sbjct  636  LFQQTVQN----GIGLFCVPPNEMYKFSHQVPSVKMTGKEREGVPRGSFELDPAGL  687



>ref|XP_003626352.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|ABN08160.1| Heat shock protein DnaJ [Medicago truncatula]
 gb|AES82570.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=1084

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 8/67 (12%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ------DPNDLWYPLKEAIRNVEP  508
            ELY FSH++PSF +TG EREGVP GS+ELD A +P       D  D+     E + NV  
Sbjct  644  ELYRFSHRVPSFVMTGKEREGVPSGSYELDPAGLPMSVFQVGDHGDM--KDNEKLNNVRS  701

Query  507  ELKRPGK  487
              + P K
Sbjct  702  SFQEPSK  708



>emb|CDY19714.1| BnaA09g03670D [Brassica napus]
Length=962

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            NE   FSHK+PSF+LTG ERE VP G FELD A++P+D
Sbjct  623  NETLRFSHKVPSFKLTGRERESVPPGCFELDTAALPKD  660



>ref|XP_010540334.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540335.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540336.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540337.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
Length=1136

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  669   ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             E+  FSHK+PSFR+TGTE EGVP GSFELD +++P+D
Sbjct  1097  EMCRFSHKVPSFRMTGTEGEGVPPGSFELDPSALPKD  1133



>ref|XP_010546655.1| PREDICTED: uncharacterized protein LOC104818668 [Tarenaya hassleriana]
 ref|XP_010546657.1| PREDICTED: uncharacterized protein LOC104818668 [Tarenaya hassleriana]
Length=1205

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 4/59 (7%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +F R +QG+  + +  FL   +E++ FSHK+PSFR+TGTE EGVP  SFELD  ++P+D
Sbjct  709  LFVRATQGKVLACN--FL--PSEMHRFSHKVPSFRMTGTEGEGVPADSFELDPIALPKD  763



>gb|KHN47283.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=968

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I  +EL+ FSH++PSF++TG ER GVP GS+ELD  S+P +  ++  P
Sbjct  620  FQIPSSELFRFSHRVPSFKMTGQERAGVPVGSYELDPVSLPMNLEEIAVP  669



>ref|XP_003541656.1| PREDICTED: uncharacterized protein LOC100779228 isoform X1 [Glycine 
max]
 ref|XP_006594470.1| PREDICTED: uncharacterized protein LOC100779228 isoform X2 [Glycine 
max]
 ref|XP_006594471.1| PREDICTED: uncharacterized protein LOC100779228 isoform X3 [Glycine 
max]
 ref|XP_006594472.1| PREDICTED: uncharacterized protein LOC100779228 isoform X4 [Glycine 
max]
Length=968

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I  +EL+ FSH++PSF++TG ER GVP GS+ELD  S+P +  ++  P
Sbjct  620  FQIPSSELFRFSHRVPSFKMTGQERAGVPVGSYELDPVSLPMNLEEIAVP  669



>ref|XP_006297386.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
 gb|EOA30284.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
Length=468

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            +I+ +E+  FSH++PS  +TG E+EGVP GSFELD A+IPQ
Sbjct  413  MIQADEMLRFSHRVPSIEMTGHEKEGVPAGSFELDPAAIPQ  453



>ref|XP_006297387.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
 ref|XP_006297388.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
 gb|EOA30285.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
 gb|EOA30286.1| hypothetical protein CARUB_v10013411mg [Capsella rubella]
Length=537

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            +I+ +E+  FSH++PS  +TG E+EGVP GSFELD A+IPQ
Sbjct  482  MIQADEMLRFSHRVPSIEMTGHEKEGVPAGSFELDPAAIPQ  522



>ref|XP_010914403.1| PREDICTED: uncharacterized protein LOC105039818 [Elaeis guineensis]
 ref|XP_010914404.1| PREDICTED: uncharacterized protein LOC105039818 [Elaeis guineensis]
Length=1079

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            NE+  FSH IPS+R+TG EREG+P+  FELD AS+P +  ++++ +
Sbjct  689  NEILRFSHSIPSYRMTGAEREGIPKDCFELDSASLPNNFEEIFHSV  734



>ref|XP_006408111.1| hypothetical protein EUTSA_v10020307mg [Eutrema salsugineum]
 gb|ESQ49564.1| hypothetical protein EUTSA_v10020307mg [Eutrema salsugineum]
Length=619

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASI  568
            +I   E+Y FSH++PSFRL+G E+EGVP GSFELD A++
Sbjct  545  VINLEEMYRFSHRVPSFRLSGEEKEGVPAGSFELDPAAV  583



>ref|XP_006300056.1| hypothetical protein CARUB_v10016284mg, partial [Capsella rubella]
 gb|EOA32954.1| hypothetical protein CARUB_v10016284mg, partial [Capsella rubella]
Length=650

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 9/74 (12%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLK--EAIRNV  514
             +I   E+  FSH++PSFRL G EREGVP GSFELD A+I      +  PLK   +IR  
Sbjct  565  LMIAPEEMQRFSHRVPSFRLNGEEREGVPAGSFELDPAAI------ISVPLKPDRSIREE  618

Query  513  EPELKRPGKN-GKT  475
              E  R  ++ GKT
Sbjct  619  AEETARQSEDCGKT  632



>ref|XP_010492908.1| PREDICTED: uncharacterized protein LOC104770215 [Camelina sativa]
Length=444

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 4/66 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            VF R   G++D S    ++ HN LY FSH++PSF+LTGTE +GVP+ ++ELD A +P+  
Sbjct  235  VFFRMGTGDADISQ---ILPHN-LYRFSHRVPSFKLTGTEGQGVPKDAYELDQAVLPETI  290

Query  555  NDLWYP  538
             D+  P
Sbjct  291  KDIIVP  296



>ref|XP_004293366.1| PREDICTED: uncharacterized protein LOC101291024 [Fragaria vesca 
subsp. vesca]
Length=512

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 7/59 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +FQ+T Q         F +   ELY FSH+IPSF++TG E  GVP GSFELD A++P D
Sbjct  448  LFQQTEQ-------QGFQVPPAELYRFSHRIPSFKMTGHEGCGVPSGSFELDPAALPGD  499



>emb|CDY13918.1| BnaC09g39080D [Brassica napus]
Length=573

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            + + N LY FSH +PSFRLTGTE +GVP+ ++ELD A++P+   ++  P
Sbjct  279  IFRINTLYRFSHMVPSFRLTGTEAKGVPKDAYELDQAALPKTIQEVMVP  327



>gb|KFK37904.1| hypothetical protein AALP_AA3G044500 [Arabis alpina]
Length=629

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPND  550
            +I  +++ SFSH++PS++LTG E+EGVP GSFELD A+IP  P D
Sbjct  577  MISPDKMLSFSHRVPSYKLTGEEKEGVPVGSFELDPAAIP--PQD  619



>ref|XP_006408128.1| hypothetical protein EUTSA_v10022016mg, partial [Eutrema salsugineum]
 gb|ESQ49581.1| hypothetical protein EUTSA_v10022016mg, partial [Eutrema salsugineum]
Length=437

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            I  +++  FSH++PSF+LTG E+E VP GSFELD A++P+D
Sbjct  385  ISSDQMLRFSHRVPSFKLTGDEKERVPAGSFELDPAAVPRD  425



>emb|CDX92582.1| BnaA10g16210D [Brassica napus]
Length=842

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            VF R S         +F I  +EL  FSH IPS +LTG ER GVP GS+ELD A++PQ
Sbjct  530  VFHRVSAA-------AFQIPPHELLRFSHSIPSTKLTGRERSGVPVGSYELDTAALPQ  580



>ref|XP_002276957.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649800.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649802.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649803.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
Length=1044

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 15/100 (15%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
             LI  +EL  FSH+IPSF+LTG ER+ VP GS ELD AS+P +  ++  P        E 
Sbjct  692  ILIPPSELLRFSHRIPSFKLTGEERQDVPRGSLELDPASLPANVEEIPVP--------EE  743

Query  507  ELKRPGKNGKTMPPKKVGTPNKST--DCKEVSDSDGDGEM  394
            +LK    N  +      G+ +KST  + K ++ S+G   M
Sbjct  744  DLKMEASNANSN-----GSVSKSTEENVKPMTGSEGGSSM  778



>ref|XP_002882387.1| hypothetical protein ARALYDRAFT_477773 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58646.1| hypothetical protein ARALYDRAFT_477773, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=609

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             ++  +E+  FSH++PSF++TG ++EGVP GSFELD A++P++
Sbjct  549  IMVSCDEMLKFSHRVPSFKMTGDDKEGVPAGSFELDPAAVPRE  591



>ref|XP_006471826.1| PREDICTED: uncharacterized protein LOC102608495 isoform X5 [Citrus 
sinensis]
Length=1296

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  666   LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
             +Y FSH+IPS+R+TG ERE VP GSFE D AS+P   N L
Sbjct  1252  MYRFSHQIPSYRMTGKEREDVPVGSFEFDPASLPTSLNKL  1291


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            +Y FSH+IPS+R+TG ERE VP GSFELD AS+P   N L
Sbjct  912  MYRFSHQIPSYRMTGKEREEVPVGSFELDPASLPTCLNKL  951



>ref|XP_010042011.1| PREDICTED: uncharacterized protein LOC104431009 [Eucalyptus grandis]
 gb|KCW84950.1| hypothetical protein EUGRSUZ_B01771 [Eucalyptus grandis]
Length=770

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            F I   +LY FSH++PSF +TG ER GVP GSFELD A++  D +DL
Sbjct  687  FEIAPRDLYRFSHRVPSFVMTGNERRGVPAGSFELDPAAL--DIDDL  731



>gb|KDO46337.1| hypothetical protein CISIN_1g047376mg [Citrus sinensis]
Length=385

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            +Y FSH+IPS+R+TG ERE VP GSFE D AS+P   N L
Sbjct  341  MYRFSHQIPSYRMTGKEREDVPVGSFEFDPASLPTSLNKL  380


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            +Y FSH+IPS+R+TG ERE VP GSFELD AS+P   N L
Sbjct  1    MYRFSHQIPSYRMTGKEREEVPVGSFELDPASLPTCLNKL  40



>ref|XP_003547217.1| PREDICTED: uncharacterized protein LOC100817232 isoform X1 [Glycine 
max]
 ref|XP_006597546.1| PREDICTED: uncharacterized protein LOC100817232 isoform X2 [Glycine 
max]
Length=968

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            F I   EL+ FSH++PSF++TG ER GVP GS+ELD  S+P +  ++
Sbjct  620  FQIPSTELFRFSHRVPSFKMTGQERVGVPVGSYELDPVSLPMNLEEI  666



>ref|XP_003594017.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AES64268.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=946

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 8/67 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD-  559
            +F R ++G       SF I   EL+ FSH++PSF++TG ER GVP G+FELD  S+P + 
Sbjct  612  LFSRITKG----GGCSFQIPPAELFRFSHRVPSFKMTGLERAGVPVGAFELDPISLPMEE  667

Query  558  ---PNDL  547
               P+DL
Sbjct  668  ITLPDDL  674



>gb|KEH36710.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=933

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 8/67 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD-  559
            +F R ++G       SF I   EL+ FSH++PSF++TG ER GVP G+FELD  S+P + 
Sbjct  599  LFSRITKG----GGCSFQIPPAELFRFSHRVPSFKMTGLERAGVPVGAFELDPISLPMEE  654

Query  558  ---PNDL  547
               P+DL
Sbjct  655  ITLPDDL  661



>ref|XP_006433152.1| hypothetical protein CICLE_v10000394mg [Citrus clementina]
 gb|ESR46392.1| hypothetical protein CICLE_v10000394mg [Citrus clementina]
Length=741

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            +Y FSH+IPS+R+TG ERE VP GSFE D AS+P   N L
Sbjct  697  MYRFSHQIPSYRMTGKEREDVPVGSFEFDPASLPTSLNKL  736


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            +Y FSH+IPS+R+TG ERE VP GSFELD AS+P   N L
Sbjct  357  MYRFSHQIPSYRMTGKEREEVPVGSFELDPASLPTCLNKL  396



>ref|XP_010492905.1| PREDICTED: uncharacterized protein LOC104770213 [Camelina sativa]
 ref|XP_010492906.1| PREDICTED: uncharacterized protein LOC104770213 [Camelina sativa]
Length=564

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            VF R   GE+D S    ++ H+ LY FSH++PSF+LTG E +GVP+ ++ELD A++P+  
Sbjct  239  VFFRMGTGEADISQ---ILPHS-LYRFSHRVPSFKLTGYEGQGVPKDAYELDQAALPEAI  294

Query  555  NDLWYPLKEAIRNVEPE  505
             ++  P +  +   +PE
Sbjct  295  EEILVPSQLTVLKSKPE  311



>ref|XP_010492901.1| PREDICTED: uncharacterized protein LOC104770209 [Camelina sativa]
 ref|XP_010492902.1| PREDICTED: uncharacterized protein LOC104770209 [Camelina sativa]
Length=352

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            I++++ Y FSH++PSF+ TG E EGVP G++ELD A++P +  ++  PL
Sbjct  302  IRNHDEYQFSHRVPSFKTTGKEAEGVPRGAYELDPAALPANIKEIDVPL  350



>ref|XP_004229108.1| PREDICTED: uncharacterized protein LOC101266860 [Solanum lycopersicum]
Length=620

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
            FL+    ++ FSH+IPS ++TG ER+ VPEGSFELD  S+P D  D+
Sbjct  316  FLVPTKGMFRFSHRIPSMKMTGMERDDVPEGSFELDPTSLPIDQLDV  362



>ref|XP_010667707.1| PREDICTED: uncharacterized protein LOC104884721 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            I + E+  FSH++PS+R+TG ERE VP+ SFELD ASI  +  ++ YP
Sbjct  654  IPNAEILKFSHRVPSYRMTGDEREDVPKDSFELDSASITMNLEEISYP  701



>ref|XP_009120944.1| PREDICTED: uncharacterized protein LOC103845806 [Brassica rapa]
Length=842

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            VF R +         +F I  +EL  FSH IPS +LTG ER GVP GS+ELD A++PQ
Sbjct  530  VFHRVAAA-------AFQIPPHELLRFSHSIPSTKLTGRERSGVPVGSYELDTAALPQ  580



>ref|XP_002516853.1| protein with unknown function [Ricinus communis]
 gb|EEF45467.1| protein with unknown function [Ricinus communis]
Length=329

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 19/88 (22%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL----------WYP  538
            FLI   EL+ FSH IP F+ TG ER GVP+GSF+LD AS+P+D  ++          ++P
Sbjct  101  FLIPPTELFRFSHMIPLFKFTGAER-GVPKGSFKLDPASLPKDIEEIPKDYVLEDGNYHP  159

Query  537  LKEAIRNVEPELKRPGKNGKTMPPKKVG  454
             +  + NV          G ++PP  +G
Sbjct  160  NEFEVINV--------SEGCSIPPASIG  179



>emb|CBI26128.3| unnamed protein product [Vitis vinifera]
Length=716

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDL  547
             LI  +EL  FSH+IPSF+LTG ER+ VP GS ELD AS+P +  ++
Sbjct  443  ILIPPSELLRFSHRIPSFKLTGEERQDVPRGSLELDPASLPANVEEI  489



>ref|XP_010492912.1| PREDICTED: uncharacterized protein LOC104770218 [Camelina sativa]
Length=905

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            F I  +EL  FSH++PS +LTG ER+GVP GS+ELD A++P 
Sbjct  605  FKISPHELLRFSHRVPSTKLTGKERDGVPVGSYELDTAAVPH  646



>gb|AAB61072.1| contains similarity to a DNAJ-like domain [Arabidopsis thaliana]
Length=1609

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +++  FSHK+PSF++TG EREGVP G FELD A++P++  +++         V+  L R 
Sbjct  651  SQMLRFSHKVPSFKMTGKEREGVPPGCFELDPAALPKELFEVYDS------KVDVGLDRE  704

Query  492  GKNGKTMPP  466
              NGKT  P
Sbjct  705  LPNGKTGGP  713



>ref|NP_198076.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AED93662.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=1104

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +++  FSHK+PSF++TG EREGVP G FELD A++P++  +++         V+  L R 
Sbjct  651  SQMLRFSHKVPSFKMTGKEREGVPPGCFELDPAALPKELFEVYDS------KVDVGLDRE  704

Query  492  GKNGKTMPP  466
              NGKT  P
Sbjct  705  LPNGKTGGP  713



>ref|XP_002512302.1| protein with unknown function [Ricinus communis]
 gb|EEF49754.1| protein with unknown function [Ricinus communis]
Length=1131

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I+ +ELY FSH++PS R++G E EGVP  SFE D A++P +
Sbjct  704  FCIRPSELYRFSHRVPSVRMSGKEGEGVPACSFECDTAALPSN  746



>ref|XP_010494032.1| PREDICTED: uncharacterized protein LOC104771234 [Camelina sativa]
Length=1077

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            +E+  FSHK+PSF++TG ER+GVP G FELD A++P  P +L +    +  +V  + +RP
Sbjct  660  SEMLRFSHKVPSFKMTGKERKGVPPGCFELDTAALP--PEEL-FEGDNSKADVGLDRERP  716

Query  492  GKNGKTMPP  466
              +GKT+ P
Sbjct  717  --DGKTIGP  723



>emb|CDY27796.1| BnaA05g32050D [Brassica napus]
Length=529

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +I  +E+  FSH++PS RL+G E+EGVP GSFELD A++P
Sbjct  480  VIAPDEMQRFSHRVPSVRLSGDEKEGVPAGSFELDPAAVP  519



>ref|XP_002520964.1| protein with unknown function [Ricinus communis]
 gb|EEF41381.1| protein with unknown function [Ricinus communis]
Length=496

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I   ELY FSH++PS +++G E  GVPEGSFE D AS+P +
Sbjct  447  FFILPRELYRFSHRVPSVKMSGKEGLGVPEGSFECDTASLPSN  489



>ref|XP_010485913.1| PREDICTED: uncharacterized protein LOC104764150 [Camelina sativa]
Length=539

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASI  568
             +I   E++ FSH++PSFR+ G E+EGVP GSFELD A+I
Sbjct  465  VMINPEEMHRFSHRVPSFRMNGEEKEGVPAGSFELDPAAI  504



>ref|XP_004486071.1| PREDICTED: uncharacterized protein LOC101500991 isoform X1 [Cicer 
arietinum]
Length=971

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +F RT +G    S+ SF I   EL+ FSH++PS+++TG ER GVP GS+ELD  S+P + 
Sbjct  620  LFSRTMKG----SNCSFRIPPVELFRFSHRVPSYKMTGQERTGVPVGSYELDPVSLPVNL  675

Query  555  NDLWYP  538
             ++  P
Sbjct  676  EEIVSP  681



>ref|XP_006844484.1| PREDICTED: uncharacterized protein LOC18434349 [Amborella trichopoda]
 gb|ERN06159.1| hypothetical protein AMTR_s00016p00110380 [Amborella trichopoda]
Length=1054

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  681   IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
             +  NEL  FSH++P+FR+ G EREG+PEG  ELD AS+P
Sbjct  1006  LSRNELMCFSHQVPAFRVKGEEREGIPEGCLELDPASMP  1044



>ref|XP_004486072.1| PREDICTED: uncharacterized protein LOC101500991 isoform X2 [Cicer 
arietinum]
Length=929

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            +F RT +G    S+ SF I   EL+ FSH++PS+++TG ER GVP GS+ELD  S+P + 
Sbjct  578  LFSRTMKG----SNCSFRIPPVELFRFSHRVPSYKMTGQERTGVPVGSYELDPVSLPVNL  633

Query  555  NDLWYP  538
             ++  P
Sbjct  634  EEIVSP  639



>ref|XP_009147276.1| PREDICTED: trichohyalin-like [Brassica rapa]
Length=533

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            +I  +E+  FSH++PS RL+G E+EGVP GSFELD A++P
Sbjct  484  VIAPDEMQRFSHRVPSVRLSGDEKEGVPAGSFELDPAAVP  523



>ref|XP_006400429.1| hypothetical protein EUTSA_v10012639mg [Eutrema salsugineum]
 gb|ESQ41882.1| hypothetical protein EUTSA_v10012639mg [Eutrema salsugineum]
Length=887

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  +EL  FSH IPS +LTG ER  VP GS+ELD A++PQ+
Sbjct  584  FQIPPHELLRFSHSIPSIKLTGKERNDVPAGSYELDTAALPQN  626



>ref|XP_011466354.1| PREDICTED: uncharacterized protein LOC105352067 [Fragaria vesca 
subsp. vesca]
Length=335

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F +  NELY FSH+IPS++++G E  GVP+GSF+ D AS+P +
Sbjct  233  FQVSPNELYRFSHQIPSYKMSGREGYGVPKGSFKFDPASLPAN  275



>ref|XP_002520963.1| protein with unknown function [Ricinus communis]
 gb|EEF41380.1| protein with unknown function [Ricinus communis]
Length=1130

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (55%), Gaps = 10/99 (10%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I+ +ELY FSH +PS R++G E EGVP  SFE D A++P +   L    +  ++N + 
Sbjct  703  FFIQPSELYRFSHCVPSVRMSGKEGEGVPACSFECDTAALPSNLVTL-VDTENILKNTDT  761

Query  507  ELKRPGKNGKTM---PPKKVGT---PNKSTDCKEVSDSD  409
                PGK   T+   P + +G     N+   C++  DS+
Sbjct  762  G---PGKGTSTLGSSPSESIGRCKDDNQGDACQQEGDSN  797



>ref|XP_006290101.1| hypothetical protein CARUB_v10003746mg [Capsella rubella]
 gb|EOA22999.1| hypothetical protein CARUB_v10003746mg [Capsella rubella]
Length=634

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEPELKRP  493
            + LY FSH++PSF+LTGTE +GVP+ ++ELD A +P    ++  P          + K  
Sbjct  254  HRLYQFSHRVPSFKLTGTEGQGVPKDAYELDKAVLPDTIKEILVPSHLLAAPTALKSKLT  313

Query  492  GKNGKTMP  469
            G  G  MP
Sbjct  314  GSKGPGMP  321



>ref|XP_008458690.1| PREDICTED: uncharacterized protein LOC103498020 [Cucumis melo]
Length=921

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            EL+ FSH++PSF LTG ERE VP GSFELD A++P
Sbjct  617  ELFRFSHRVPSFPLTGDEREDVPRGSFELDPAALP  651



>ref|XP_011468429.1| PREDICTED: uncharacterized protein LOC101311114 [Fragaria vesca 
subsp. vesca]
Length=1754

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  687   FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             F +  NELY FSH+IPS++++G E  GVP+GSF+ D AS+P +
Sbjct  1056  FQVSPNELYRFSHQIPSYKMSGREGYGVPKGSFKFDPASLPAN  1098


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F +  NELY FSH+IPS ++TG E  GVP  SFE D AS+P
Sbjct  711  FQVSPNELYRFSHQIPSHKMTGREGYGVPADSFEFDPASLP  751



>ref|XP_009120945.1| PREDICTED: uncharacterized protein LOC103845807 [Brassica rapa]
Length=569

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            LY FSH +PSFRLTGTE +GVP+ ++ELD A++P+   ++  P
Sbjct  281  LYRFSHMVPSFRLTGTEAKGVPKEAYELDQAALPKTIQEVMVP  323



>emb|CDO98930.1| unnamed protein product [Coffea canephora]
Length=1029

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            FLI   +++ FSHKIPSFR++G + + VP+GSFELD AS+P
Sbjct  635  FLIPPKDIFRFSHKIPSFRMSGKKGKCVPQGSFELDPASLP  675



>ref|XP_008813744.1| PREDICTED: uncharacterized protein LOC103724304 [Phoenix dactylifera]
Length=1074

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  684  LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            +I  NE+  FSH IPS+R+TG E+ G+P+G  ELD AS+P +  ++++ +
Sbjct  684  VIPPNEILRFSHSIPSYRMTGAEKGGIPKGCLELDSASLPNNFQEIFHSI  733



>ref|XP_006287407.1| hypothetical protein CARUB_v10000613mg [Capsella rubella]
 gb|EOA20305.1| hypothetical protein CARUB_v10000613mg [Capsella rubella]
Length=555

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            ++ +H E Y FSH +PSF+ TG E EGVP+G++ELD A++P +  ++  PL
Sbjct  278  YICRHYE-YQFSHCVPSFKTTGKEAEGVPQGAYELDPAALPANIKEIDVPL  327



>gb|ABF69988.1| heat shock protein DnaJ N-terminal domain-containing protein 
[Musa acuminata]
Length=1015

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            NE+  FSH IPS+RLTGTE+E +P G  ELD AS+P +
Sbjct  678  NEILRFSHNIPSYRLTGTEKESIPRGCLELDPASLPTN  715



>ref|XP_006380031.1| hypothetical protein POPTR_0008s20070g [Populus trichocarpa]
 gb|ERP57828.1| hypothetical protein POPTR_0008s20070g [Populus trichocarpa]
Length=680

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I   EL+  SH IPSF+LTG EREGV +GSF+LD AS+P
Sbjct  500  FEIPPRELFRLSHMIPSFKLTGEEREGVQKGSFDLDPASLP  540



>ref|XP_002871831.1| hypothetical protein ARALYDRAFT_909887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48090.1| hypothetical protein ARALYDRAFT_909887 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I  + LY FSH++PSF+LTG E +GVP+ ++ELD A++P+   ++  P      N E 
Sbjct  261  FRILPHSLYRFSHRVPSFKLTGIEGKGVPKDAYELDQAALPESIEEIIVP-----SNSES  315

Query  507  ELK  499
            +LK
Sbjct  316  DLK  318



>ref|XP_006356999.1| PREDICTED: uncharacterized protein LOC102591482 [Solanum tuberosum]
Length=287

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASI  568
            FL+  N+++ FSH+IPS ++T  ER+ VPEGSFE+D +S+
Sbjct  152  FLVLANDMFKFSHRIPSMKMTWMERDDVPEGSFEIDHSSL  191



>ref|XP_010492911.1| PREDICTED: uncharacterized protein LOC104770217 [Camelina sativa]
Length=671

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I  + LY FSH++PSF+LTG E  GVP+ ++ELD A++P+   ++  P
Sbjct  373  FRILPHSLYRFSHRVPSFKLTGVEGNGVPKDAYELDQAALPEKIEEIIVP  422



>emb|CDY24701.1| BnaA05g31000D [Brassica napus]
Length=589

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I  +EL+ FSH++PSFRL GTE  GV EG FELD A++P
Sbjct  537  FEIPPHELFRFSHRVPSFRLKGTEGRGVLEGWFELDPAALP  577



>ref|XP_009129660.1| PREDICTED: dnaJ homolog subfamily C member 21 [Brassica rapa]
Length=653

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I  +EL+ FSH++PSFRL GTE  GV EG FELD A++P
Sbjct  598  FEIPPHELFRFSHRVPSFRLKGTEGRGVLEGWFELDPAALP  638



>ref|XP_010540338.1| PREDICTED: uncharacterized protein LOC104814148 [Tarenaya hassleriana]
 ref|XP_010540339.1| PREDICTED: uncharacterized protein LOC104814148 [Tarenaya hassleriana]
Length=1133

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  684   LIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
             + +  E+  FSHK+PSFR TGTE EG P GSFELD +++P+D
Sbjct  1025  IFEPREMCRFSHKVPSFRTTGTEGEGDPPGSFELDPSALPKD  1066



>ref|XP_010485885.1| PREDICTED: uncharacterized protein LOC104764129 [Camelina sativa]
Length=500

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
             +I  +E+  FSH++PS +LTG E EGVP G FELD A+IP+
Sbjct  444  IMIGSDEMLRFSHRVPSVKLTGDEEEGVPAGYFELDPAAIPR  485



>ref|XP_007154216.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 ref|XP_007154217.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 gb|ESW26210.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 gb|ESW26211.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
Length=1028

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            EL+ FSH++PSF++TG ER GVP GS+ELD  ++P
Sbjct  693  ELFRFSHRVPSFKMTGEERAGVPTGSYELDPGALP  727



>ref|XP_006408126.1| hypothetical protein EUTSA_v10019946mg [Eutrema salsugineum]
 gb|ESQ49579.1| hypothetical protein EUTSA_v10019946mg [Eutrema salsugineum]
Length=1112

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            NE+ SFSH++P+ ++TG E+E VP  S+ELD+A++P+D
Sbjct  659  NEMLSFSHRVPAVKMTGKEKECVPAVSYELDIAALPKD  696



>emb|CDY13917.1| BnaC09g39090D [Brassica napus]
Length=417

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            + LY FSH +PS RLTGTE  GVP+ ++ELD A++P+   ++  P
Sbjct  354  HSLYQFSHSVPSIRLTGTEARGVPKDAYELDQAALPKTIQEIMVP  398



>ref|XP_009147297.1| PREDICTED: uncharacterized protein LOC103870872 [Brassica rapa]
 ref|XP_009147298.1| PREDICTED: uncharacterized protein LOC103870872 [Brassica rapa]
Length=1262

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +  FSHK+P+ ++TGTE+EGVP GS+ELD  ++P+D
Sbjct  801  MLRFSHKVPAVKMTGTEKEGVPAGSYELDPTALPKD  836



>ref|XP_010423468.1| PREDICTED: uncharacterized protein LOC104708539 [Camelina sativa]
 ref|XP_010423527.1| PREDICTED: uncharacterized protein LOC104708539 [Camelina sativa]
Length=526

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
             +I   E+  FSH++PS +L G EREGVP GSFELD A+I   P
Sbjct  439  LMIAPEEMQRFSHRVPSLKLNGKEREGVPAGSFELDPAAIKSVP  482



>gb|KHN03011.1| Protein HLJ1 [Glycine soja]
Length=958

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (54%), Gaps = 5/80 (6%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I   EL+ FSH++PSF+LTG E  GVP GS+ELD  ++P +  ++  P      N + 
Sbjct  610  FQIPPQELFRFSHRVPSFKLTGQEGVGVPAGSYELDPGALPVNLEEIAVP-----ENSDV  664

Query  507  ELKRPGKNGKTMPPKKVGTP  448
            ++ R    G+   P     P
Sbjct  665  KVGRSSSGGENTRPSNRSEP  684



>ref|XP_007147854.1| hypothetical protein PHAVU_006G160400g [Phaseolus vulgaris]
 gb|ESW19848.1| hypothetical protein PHAVU_006G160400g [Phaseolus vulgaris]
Length=963

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            EL+ FSH++PSF++TG ER GVP GS+ELD  S+P    ++  P
Sbjct  625  ELFRFSHRVPSFKMTGQERVGVPVGSWELDPVSLPMHMEEIAVP  668



>ref|XP_003529595.1| PREDICTED: uncharacterized protein LOC100795200 [Glycine max]
Length=958

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (54%), Gaps = 5/80 (6%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            F I   EL+ FSH++PSF+LTG E  GVP GS+ELD  ++P +  ++  P      N + 
Sbjct  610  FQIPPQELFRFSHRVPSFKLTGQEGVGVPAGSYELDPGALPVNLEEIAVP-----ENSDV  664

Query  507  ELKRPGKNGKTMPPKKVGTP  448
            ++ R    G+   P     P
Sbjct  665  KVGRSSSGGENTRPSNRSEP  684



>ref|XP_010464019.1| PREDICTED: uncharacterized protein LOC104744639 [Camelina sativa]
Length=516

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
             +I   E+  FSH++PS +L G EREGVP GSFELD A+I   P
Sbjct  431  LMIAPEEMQIFSHRVPSLKLNGKEREGVPAGSFELDPAAITSVP  474



>ref|XP_002871835.1| hypothetical protein ARALYDRAFT_909891 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48094.1| hypothetical protein ARALYDRAFT_909891 [Arabidopsis lyrata subsp. 
lyrata]
Length=672

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I    LY FSH++PSF+LTG E +GVP+ ++ELD A++P+   ++  P
Sbjct  365  FRILPQSLYRFSHRVPSFKLTGIEGKGVPKDAYELDQAALPETIEEIIVP  414



>emb|CDY27809.1| BnaA05g32180D [Brassica napus]
Length=992

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +  FSHK+P+ ++TGTE+EGVP GS+ELD  ++P+D
Sbjct  652  MLRFSHKVPAVKMTGTEKEGVPAGSYELDPTALPKD  687



>ref|XP_010420622.1| PREDICTED: uncharacterized protein LOC104706140 [Camelina sativa]
Length=521

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
             +I  +E+  FSH++PS++L G E EGVP G FELD A+IP+
Sbjct  465  IMIGSDEMLRFSHRVPSYKLIGDEEEGVPAGYFELDPAAIPR  506



>ref|XP_009399319.1| PREDICTED: uncharacterized protein LOC103983771 [Musa acuminata 
subsp. malaccensis]
Length=1066

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +E+  FSH IPS+RLTGTE+E +P+G  ELD AS+P +
Sbjct  678  SEILRFSHNIPSYRLTGTEKESIPQGCLELDPASLPTN  715



>ref|XP_004967967.1| PREDICTED: uncharacterized protein LOC101785664 [Setaria italica]
Length=1039

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 12/101 (12%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            ++I   E   FSH +P   + GTE+EGVPEGS ELD A++P +       L+EA  +V P
Sbjct  688  YVISQGETLRFSHCVPHHLMRGTEKEGVPEGSLELDPAALPLN-------LEEAFPSVVP  740

Query  507  ELKRPGKNGKTMPPKKVGTPNKSTD---CKEVSDSDGDGEM  394
            E       G+    K  G+ ++++     ++VSD      M
Sbjct  741  ECSSVRSQGR--DAKHAGSASRNSSHRGSRKVSDGQHTASM  779



>gb|KEH41511.1| DNAJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=379

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  NELY FSH++PS++++  ER+ VP+  FELD A++P D
Sbjct  319  FHILPNELYKFSHRVPSYKMSVDERKDVPKDCFELDTAALPTD  361



>ref|XP_004980633.1| PREDICTED: uncharacterized protein LOC101766063 [Setaria italica]
Length=975

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F+I  +EL  FSH IP +R  GTE+ GVPEG  ELD A +P D
Sbjct  613  FVIPSSELLRFSHSIPFYRTNGTEKVGVPEGFMELDTACLPAD  655



>ref|XP_010495287.1| PREDICTED: uncharacterized protein LOC104772357 [Camelina sativa]
Length=546

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I    LY FSH++PSF+LTG E  GVP+ ++ELD A++P++
Sbjct  356  FRILPRSLYRFSHRVPSFKLTGVEGNGVPKDAYELDQAALPEE  398



>ref|XP_002871836.1| hypothetical protein ARALYDRAFT_909892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48095.1| hypothetical protein ARALYDRAFT_909892 [Arabidopsis lyrata subsp. 
lyrata]
Length=572

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYP  538
            F I  + LY FSH++PSF+LTG E +GVP+ ++ELD A++P+   ++  P
Sbjct  291  FRILPHSLYRFSHRVPSFKLTGIEGKGVPKDAYELDEAALPETIEEIVVP  340



>ref|XP_010492910.1| PREDICTED: uncharacterized protein LOC104770216 [Camelina sativa]
Length=654

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            F I    LY FSH++PSF+LTG E  GVP+ ++ELD A++P++ 
Sbjct  356  FRILPRSLYRFSHRVPSFKLTGVEGNGVPKDAYELDQAALPEEA  399



>ref|XP_002457507.1| hypothetical protein SORBIDRAFT_03g008500 [Sorghum bicolor]
 gb|EES02627.1| hypothetical protein SORBIDRAFT_03g008500 [Sorghum bicolor]
Length=903

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 7/61 (11%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            ++I H +   FSH +P   ++GTE+EG+PEGS ELD A++P       + L+EA  +  P
Sbjct  665  YVIPHGDTLRFSHCVPHHLMSGTEKEGIPEGSLELDPAALP-------FNLEEAFPSANP  717

Query  507  E  505
            E
Sbjct  718  E  718



>emb|CDX88919.1| BnaA03g07300D [Brassica napus]
Length=1581

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = -3

Query  735  VFQRTSQGEsdssssSFLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDP  556
            VF R   GE+D+S     I    +Y FSH IPSF+LTGTE +G+P+ ++ELD A++P+  
Sbjct  393  VFFRMGTGEADTSQ----ILPQNMYQFSHMIPSFKLTGTEAKGLPKDAYELDQAALPEKI  448

Query  555  NDLWYP  538
             ++  P
Sbjct  449  AEVTIP  454



>ref|XP_009131689.1| PREDICTED: uncharacterized protein LOC103856333 [Brassica rapa]
Length=704

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            I  + LY FSH IPSF+LTGT+ +GVP+ ++ELD A++P+
Sbjct  406  IPFHRLYRFSHMIPSFKLTGTDAKGVPKYAYELDQAALPE  445



>emb|CDY05255.1| BnaC05g45480D [Brassica napus]
Length=662

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F I  +EL+ FSH++PSFRL GTE  GV EG +ELD A++P
Sbjct  608  FEIPPHELFRFSHRVPSFRLKGTEGRGVLEGWYELDPAALP  648



>ref|XP_008657284.1| PREDICTED: uncharacterized protein LOC103636721 [Zea mays]
Length=809

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 11/89 (12%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            ++I   +   FSH +P + ++GTE+EG+PEGS ELD A++P +       L+EA  +  P
Sbjct  460  YVIPQGDTLRFSHCVPHYLMSGTEKEGIPEGSLELDPAALPSN-------LEEAFPSANP  512

Query  507  ELKRPGKNGKTMPPKKVGTPNKSTDCKEV  421
            E        K    K  G    S DCKE 
Sbjct  513  ECSSV--RSKEHNSKHAGL--SSEDCKET  537



>ref|XP_006287025.1| hypothetical protein CARUB_v10000173mg [Capsella rubella]
 gb|EOA19923.1| hypothetical protein CARUB_v10000173mg [Capsella rubella]
Length=903

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            F I  +EL  FSH IPS +LTG E  GVP GS+ELD A++PQ
Sbjct  603  FQILPHELLRFSHSIPSTKLTGKEGNGVPVGSYELDTAALPQ  644



>ref|XP_006400423.1| hypothetical protein EUTSA_v10015238mg [Eutrema salsugineum]
 gb|ESQ41876.1| hypothetical protein EUTSA_v10015238mg [Eutrema salsugineum]
Length=453

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -3

Query  681  IKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            I+H +   FSH++PSF++TG E EGVP G++ELD  S+P++  ++  PL
Sbjct  155  IRHTK--QFSHRVPSFKMTGLEAEGVPRGAYELDPKSLPENIKEIDVPL  201



>gb|AFW79769.1| hypothetical protein ZEAMMB73_584264 [Zea mays]
Length=728

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 11/89 (12%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPLKEAIRNVEP  508
            ++I   +   FSH +P + ++GTE+EG+PEGS ELD A++P +       L+EA  +  P
Sbjct  379  YVIPQGDTLRFSHCVPHYLMSGTEKEGIPEGSLELDPAALPSN-------LEEAFPSANP  431

Query  507  ELKRPGKNGKTMPPKKVGTPNKSTDCKEV  421
            E        K    K  G    S DCKE 
Sbjct  432  ECS--SVRSKEHNSKHAGL--SSEDCKET  456



>ref|XP_004979549.1| PREDICTED: uncharacterized protein LOC101754686 isoform X1 [Setaria 
italica]
 ref|XP_004979550.1| PREDICTED: uncharacterized protein LOC101754686 isoform X2 [Setaria 
italica]
Length=1196

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            F I  +EL  FSH+IP +R TG E+ G+P G  ELD AS+P D
Sbjct  845  FTITSSELLQFSHRIPFYRTTGNEKVGIPGGFLELDSASLPTD  887



>ref|XP_009131690.1| PREDICTED: uncharacterized protein LOC103856334 [Brassica rapa]
Length=534

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            + LY FSH IPSF+LTGTE +G+P+ ++ELD A++P
Sbjct  245  HSLYRFSHMIPSFKLTGTEAKGLPKDAYELDQAALP  280



>ref|XP_010098318.1| DnaJ homolog subfamily B member 12 [Morus notabilis]
 gb|EXB74822.1| DnaJ homolog subfamily B member 12 [Morus notabilis]
Length=930

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIP  565
            F++   EL  FSH IPS+++ G EREGV  GS ELD AS+P
Sbjct  625  FIVPPGELLRFSHMIPSYKMKGNEREGVATGSLELDPASLP  665



>emb|CDX70840.1| BnaC03g09240D [Brassica napus]
Length=584

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  657  FSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            FSH++PSF+ TG E EGVP G++ELD A++P++  ++  PL
Sbjct  304  FSHRVPSFKTTGIEAEGVPRGAYELDPAALPENIKEIDVPL  344



>ref|XP_002461875.1| hypothetical protein SORBIDRAFT_02g009690 [Sorghum bicolor]
 gb|EER98396.1| hypothetical protein SORBIDRAFT_02g009690 [Sorghum bicolor]
Length=1141

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL  535
            FLI      SFSH IP  RL  TER+ +P G+ ELD AS+P D +  + P+
Sbjct  779  FLIPSGNTLSFSHSIPFHRLAETERKHIPNGALELDTASLPSDLDKAFTPV  829



>emb|CDY13939.1| BnaC09g38870D [Brassica napus]
Length=122

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  669  ELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            EL  FSH IPS +L G ER  VP GS+ELD A++PQ
Sbjct  77   ELLRFSHSIPSTKLIGKERNCVPVGSYELDTAALPQ  112



>ref|XP_006353836.1| PREDICTED: uncharacterized protein LOC102591026 [Solanum tuberosum]
Length=203

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASI  568
            FL+   +++ FSH+IPS ++TG +R  VPEGSF+LD AS 
Sbjct  159  FLVPAKDMFRFSHRIPSMKMTGMDRNDVPEGSFKLDPASF  198



>ref|XP_006400425.1| hypothetical protein EUTSA_v10013076mg [Eutrema salsugineum]
 gb|ESQ41878.1| hypothetical protein EUTSA_v10013076mg [Eutrema salsugineum]
Length=581

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = -3

Query  687  FLIKHNELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQDPNDLWYPL-KEAIRNV-  514
            F I  + LY FSHK PSF+L G E +G+P+ ++ELD A++P+   ++  P  KEA   V 
Sbjct  279  FHILPHSLYRFSHKAPSFKLNGVEGKGLPKDAYELDQAALPEPIEEVIVPFYKEAKLTVP  338

Query  513  --EPELKRPGKNGKTM  472
              +PE      NGK  
Sbjct  339  KPKPEALCFTTNGKVF  354



>emb|CDY41919.1| BnaC05g46850D [Brassica napus]
Length=1191

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  666  LYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQD  559
            +  FSHK+P+ ++TG E+EGVP GS+ELD  ++P+D
Sbjct  736  MLRFSHKVPAVKMTGMEKEGVPAGSYELDPTALPKD  771



>ref|XP_010495288.1| PREDICTED: uncharacterized protein LOC104772358 [Camelina sativa]
Length=521

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  672  NELYSFSHKIPSFRLTGTEREGVPEGSFELDLASIPQ  562
            + LY FSH++PSF+LTG E +GVP+ ++ELD A +P+
Sbjct  250  HSLYRFSHRMPSFKLTGAEGQGVPKNAYELDQAVLPK  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1372351877325