BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6863

Length=897
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092625.1|  PREDICTED: uncharacterized protein LOC105172...    105   1e-23   
ref|XP_011092616.1|  PREDICTED: uncharacterized protein LOC105172...    106   1e-23   
gb|KJB22336.1|  hypothetical protein B456_004G042000                    104   6e-23   Gossypium raimondii
gb|KJB22340.1|  hypothetical protein B456_004G042000                    104   8e-23   Gossypium raimondii
gb|KJB22339.1|  hypothetical protein B456_004G042000                    104   2e-22   Gossypium raimondii
ref|XP_007051771.1|  Uncharacterized protein TCM_005310                 103   2e-22   Theobroma cacao [chocolate]
gb|KHG18490.1|  Ribosomal RNA small subunit methyltransferase G         103   2e-22   Gossypium arboreum [tree cotton]
gb|KJB22338.1|  hypothetical protein B456_004G042000                    103   2e-22   Gossypium raimondii
gb|KJB22334.1|  hypothetical protein B456_004G042000                    103   2e-22   Gossypium raimondii
ref|XP_011036565.1|  PREDICTED: uncharacterized protein LOC105134...    102   4e-22   Populus euphratica
ref|XP_011036556.1|  PREDICTED: uncharacterized protein LOC105134...    101   2e-21   Populus euphratica
ref|XP_002320140.1|  hypothetical protein POPTR_0014s08190g             101   2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006445010.1|  hypothetical protein CICLE_v10021690mg           97.8    5e-21   
gb|KDO86222.1|  hypothetical protein CISIN_1g024415mg                 97.1    6e-21   Citrus sinensis [apfelsine]
ref|XP_004138497.1|  PREDICTED: uncharacterized protein LOC101221288  99.8    7e-21   Cucumis sativus [cucumbers]
gb|KDO86223.1|  hypothetical protein CISIN_1g024415mg                 98.6    8e-21   Citrus sinensis [apfelsine]
ref|XP_009768013.1|  PREDICTED: uncharacterized protein LOC104219077  99.8    8e-21   Nicotiana sylvestris
gb|KDO86219.1|  hypothetical protein CISIN_1g024415mg                 98.2    8e-21   Citrus sinensis [apfelsine]
gb|EYU32140.1|  hypothetical protein MIMGU_mgv1a011795mg              99.4    8e-21   Erythranthe guttata [common monkey flower]
gb|KDO86218.1|  hypothetical protein CISIN_1g024415mg                 97.8    8e-21   Citrus sinensis [apfelsine]
ref|XP_006445007.1|  hypothetical protein CICLE_v10021690mg           97.8    1e-20   
ref|XP_006445008.1|  hypothetical protein CICLE_v10021690mg           97.8    1e-20   
gb|KDO86216.1|  hypothetical protein CISIN_1g024415mg                 98.2    2e-20   Citrus sinensis [apfelsine]
ref|XP_004248047.1|  PREDICTED: uncharacterized protein LOC101253...  98.6    2e-20   Solanum lycopersicum
ref|XP_006445009.1|  hypothetical protein CICLE_v10021690mg           98.2    2e-20   Citrus clementina [clementine]
ref|XP_010056396.1|  PREDICTED: uncharacterized protein LOC104444425  98.2    3e-20   Eucalyptus grandis [rose gum]
gb|EYU32139.1|  hypothetical protein MIMGU_mgv1a011795mg              98.2    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_006364150.1|  PREDICTED: uncharacterized protein LOC102604822  97.8    4e-20   Solanum tuberosum [potatoes]
ref|XP_010523762.1|  PREDICTED: uncharacterized protein LOC104802037  97.4    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_006445011.1|  hypothetical protein CICLE_v10021689mg           96.3    5e-20   Citrus clementina [clementine]
ref|XP_009622825.1|  PREDICTED: uncharacterized protein LOC104114152  97.1    5e-20   Nicotiana tomentosiformis
ref|XP_010326971.1|  PREDICTED: uncharacterized protein LOC101253...  96.7    6e-20   Solanum lycopersicum
emb|CDP08796.1|  unnamed protein product                              96.7    8e-20   Coffea canephora [robusta coffee]
gb|KDO86214.1|  hypothetical protein CISIN_1g024003mg                 95.5    1e-19   Citrus sinensis [apfelsine]
gb|KDO86213.1|  hypothetical protein CISIN_1g024003mg                 95.5    1e-19   Citrus sinensis [apfelsine]
ref|XP_006491134.1|  PREDICTED: uncharacterized protein LOC102608...  95.9    1e-19   Citrus sinensis [apfelsine]
ref|XP_006445012.1|  hypothetical protein CICLE_v10021689mg           95.9    1e-19   
gb|KHN29347.1|  hypothetical protein glysoja_005071                   94.7    2e-19   Glycine soja [wild soybean]
gb|AFK48185.1|  unknown                                               94.7    2e-19   Lotus japonicus
gb|EYU32142.1|  hypothetical protein MIMGU_mgv1a011872mg              94.7    2e-19   Erythranthe guttata [common monkey flower]
gb|KDO86210.1|  hypothetical protein CISIN_1g024003mg                 95.1    3e-19   Citrus sinensis [apfelsine]
gb|KDO86211.1|  hypothetical protein CISIN_1g024003mg                 95.1    3e-19   Citrus sinensis [apfelsine]
gb|KDO86212.1|  hypothetical protein CISIN_1g024003mg                 94.7    3e-19   Citrus sinensis [apfelsine]
gb|AFK38203.1|  unknown                                               94.4    5e-19   Lotus japonicus
gb|EYU32143.1|  hypothetical protein MIMGU_mgv1a011872mg              94.4    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_010508079.1|  PREDICTED: uncharacterized protein LOC104784718  94.0    6e-19   
ref|XP_010506594.1|  PREDICTED: uncharacterized protein LOC104783176  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010518258.1|  PREDICTED: uncharacterized protein LOC104793570  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010508078.1|  PREDICTED: uncharacterized protein LOC104784717  94.4    6e-19   Camelina sativa [gold-of-pleasure]
gb|AAL27556.1|AF420411_1  hypothetical protein                        90.9    1e-18   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008458208.1|  PREDICTED: uncharacterized protein LOC103497707  93.2    1e-18   Cucumis melo [Oriental melon]
ref|XP_007139823.1|  hypothetical protein PHAVU_008G061600g           93.2    1e-18   Phaseolus vulgaris [French bean]
ref|XP_010087947.1|  hypothetical protein L484_012399                 90.9    1e-18   
ref|XP_002511878.1|  conserved hypothetical protein                   92.4    2e-18   Ricinus communis
ref|XP_006601835.1|  PREDICTED: uncharacterized protein LOC100810...  92.0    2e-18   Glycine max [soybeans]
ref|NP_001031547.1|  uncharacterized protein                          91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001239728.1|  uncharacterized protein LOC100810003             91.7    4e-18   Glycine max [soybeans]
ref|XP_009384561.1|  PREDICTED: uncharacterized protein LOC103972086  91.3    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002880212.1|  hypothetical protein ARALYDRAFT_904052           91.3    5e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_008244645.1|  PREDICTED: uncharacterized protein LOC103342...  91.3    5e-18   Prunus mume [ume]
ref|XP_008244646.1|  PREDICTED: uncharacterized protein LOC103342...  91.3    6e-18   
ref|NP_001031546.1|  uncharacterized protein                          90.9    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011469002.1|  PREDICTED: uncharacterized protein LOC101295560  90.9    7e-18   Fragaria vesca subsp. vesca
ref|NP_566060.1|  uncharacterized protein                             90.9    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492754.1|  PREDICTED: uncharacterized protein LOC101510...  90.9    8e-18   Cicer arietinum [garbanzo]
ref|XP_004492755.1|  PREDICTED: uncharacterized protein LOC101510...  90.5    9e-18   
ref|XP_006295045.1|  hypothetical protein CARUB_v10024113mg           89.4    9e-18   
ref|XP_010255309.1|  PREDICTED: uncharacterized protein LOC104596...  89.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_006397785.1|  hypothetical protein EUTSA_v10001586mg           89.7    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_012083366.1|  PREDICTED: uncharacterized protein LOC105642...  88.6    3e-17   Jatropha curcas
ref|XP_007218810.1|  hypothetical protein PRUPE_ppa009991mg           88.6    4e-17   Prunus persica
ref|XP_012083365.1|  PREDICTED: uncharacterized protein LOC105642...  88.6    4e-17   Jatropha curcas
ref|XP_010255310.1|  PREDICTED: uncharacterized protein LOC104596...  87.8    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010918743.1|  PREDICTED: uncharacterized protein LOC105043034  88.2    5e-17   Elaeis guineensis
ref|XP_007139822.1|  hypothetical protein PHAVU_008G061500g           88.2    5e-17   Phaseolus vulgaris [French bean]
dbj|BAC83355.2|  unknown protein                                      88.6    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KEH23368.1|  hypothetical protein MTR_7g077880                     87.4    6e-17   Medicago truncatula
emb|CAN70694.1|  hypothetical protein VITISV_002394                   88.2    6e-17   Vitis vinifera
ref|XP_002275801.1|  PREDICTED: uncharacterized protein LOC100260183  88.2    6e-17   Vitis vinifera
ref|XP_006827564.1|  PREDICTED: uncharacterized protein LOC184228...  88.2    6e-17   Amborella trichopoda
emb|CDY18881.1|  BnaC04g04690D                                        88.2    7e-17   Brassica napus [oilseed rape]
ref|XP_011624852.1|  PREDICTED: uncharacterized protein LOC184228...  87.8    7e-17   Amborella trichopoda
gb|ACJ84457.1|  unknown                                               85.9    1e-16   Medicago truncatula
ref|XP_006657631.1|  PREDICTED: uncharacterized protein LOC102713007  87.4    1e-16   Oryza brachyantha
gb|AFK34805.1|  unknown                                               87.0    1e-16   Medicago truncatula
gb|AFK49194.1|  unknown                                               87.4    1e-16   Lotus japonicus
gb|KHM99365.1|  hypothetical protein glysoja_028822                   87.0    1e-16   Glycine soja [wild soybean]
gb|KFK37383.1|  hypothetical protein AALP_AA4G250000                  87.0    1e-16   Arabis alpina [alpine rockcress]
ref|XP_003623980.1|  hypothetical protein MTR_7g077870                87.0    1e-16   Medicago truncatula
gb|EEC76618.1|  hypothetical protein OsI_14495                        87.0    1e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001059469.1|  Os07g0418000                                     87.0    1e-16   
ref|XP_008801330.1|  PREDICTED: uncharacterized protein LOC103715476  87.0    1e-16   
ref|XP_003623981.1|  hypothetical protein MTR_7g077880                87.0    2e-16   Medicago truncatula
ref|XP_009367812.1|  PREDICTED: uncharacterized protein LOC103957377  86.7    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_004492759.1|  PREDICTED: uncharacterized protein LOC101511624  86.7    2e-16   Cicer arietinum [garbanzo]
ref|XP_010670120.1|  PREDICTED: uncharacterized protein LOC104887219  86.3    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009143199.1|  PREDICTED: uncharacterized protein LOC103866942  85.9    3e-16   Brassica rapa
ref|XP_003568582.1|  PREDICTED: uncharacterized protein LOC100823061  85.5    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_008338880.1|  PREDICTED: uncharacterized protein LOC103401933  85.5    5e-16   Malus domestica [apple tree]
ref|XP_004306764.1|  PREDICTED: uncharacterized protein LOC101294106  85.5    5e-16   Fragaria vesca subsp. vesca
emb|CDX74783.1|  BnaA05g05290D                                        85.1    6e-16   
ref|XP_010255308.1|  PREDICTED: uncharacterized protein LOC104596...  85.1    7e-16   Nelumbo nucifera [Indian lotus]
ref|XP_008343405.1|  PREDICTED: uncharacterized protein LOC103406175  85.1    9e-16   
ref|XP_004984348.1|  PREDICTED: uncharacterized protein LOC101783107  85.5    9e-16   Setaria italica
ref|XP_008344005.1|  PREDICTED: uncharacterized protein LOC103406759  85.1    1e-15   
ref|NP_001276321.1|  uncharacterized protein LOC100809469             84.0    1e-15   Glycine max [soybeans]
ref|XP_004492756.1|  PREDICTED: uncharacterized protein LOC101510...  84.0    2e-15   Cicer arietinum [garbanzo]
ref|XP_006428290.1|  hypothetical protein CICLE_v10013186mg           79.7    3e-15   
gb|EPS59432.1|  hypothetical protein M569_15374                       82.0    3e-15   Genlisea aurea
ref|XP_002461895.1|  hypothetical protein SORBIDRAFT_02g009970        84.0    3e-15   Sorghum bicolor [broomcorn]
ref|XP_006428288.1|  hypothetical protein CICLE_v10013186mg           79.7    4e-15   
ref|XP_006480381.1|  PREDICTED: uncharacterized protein LOC102607...  79.3    4e-15   Citrus sinensis [apfelsine]
ref|NP_001143648.1|  uncharacterized protein LOC100276370             82.8    9e-15   Zea mays [maize]
tpg|DAA39436.1|  TPA: hypothetical protein ZEAMMB73_910853            82.8    9e-15   
gb|ABR16780.1|  unknown                                               81.6    1e-14   Picea sitchensis
dbj|BAJ92002.1|  predicted protein                                    80.9    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK26606.1|  unknown                                               81.6    1e-14   Picea sitchensis
gb|EMT00704.1|  hypothetical protein F775_08758                       80.1    4e-14   
gb|EMS45488.1|  hypothetical protein TRIUR3_03694                     79.0    5e-14   Triticum urartu
ref|XP_004306768.1|  PREDICTED: uncharacterized protein LOC101295853  79.3    6e-14   Fragaria vesca subsp. vesca
gb|KHN29346.1|  hypothetical protein glysoja_005070                   75.1    4e-13   Glycine soja [wild soybean]
ref|XP_002968931.1|  hypothetical protein SELMODRAFT_90693            75.5    2e-12   Selaginella moellendorffii
ref|XP_006421478.1|  hypothetical protein CICLE_v10006592mg           71.6    2e-12   
ref|XP_006428289.1|  hypothetical protein CICLE_v10013186mg           70.1    8e-12   
ref|XP_002989978.1|  hypothetical protein SELMODRAFT_428440           73.2    1e-11   Selaginella moellendorffii
ref|XP_007052235.1|  TRAF-like family protein                         71.6    7e-11   
gb|KJB22335.1|  hypothetical protein B456_004G042000                  68.6    1e-10   Gossypium raimondii
ref|XP_001759804.1|  predicted protein                                69.7    2e-10   
ref|XP_001771402.1|  predicted protein                                67.4    9e-10   
ref|XP_004295150.1|  PREDICTED: uncharacterized protein LOC101305350  67.8    1e-09   Fragaria vesca subsp. vesca
ref|XP_006432614.1|  hypothetical protein CICLE_v10003222mg           58.5    4e-07   
ref|XP_006494209.1|  PREDICTED: uncharacterized protein LOC102628...  57.8    4e-07   Citrus sinensis [apfelsine]
gb|ACF83654.1|  unknown                                               52.8    4e-05   Zea mays [maize]
ref|XP_003057547.1|  predicted protein                                52.8    1e-04   Micromonas pusilla CCMP1545
ref|XP_001698105.1|  hypothetical protein CHLREDRAFT_151387           52.0    3e-04   Chlamydomonas reinhardtii
ref|XP_002946102.1|  hypothetical protein VOLCADRAFT_101579           52.0    3e-04   Volvox carteri f. nagariensis



>ref|XP_011092625.1| PREDICTED: uncharacterized protein LOC105172743 isoform X2 [Sesamum 
indicum]
Length=171

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENWMKIKPVI+EEWNENRD LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  82   SSVAEGLTVEGILENWMKIKPVIMEEWNENRDELIDLFGKVRDEWMDNDLATWIGAN  138



>ref|XP_011092616.1| PREDICTED: uncharacterized protein LOC105172743 isoform X1 [Sesamum 
indicum]
Length=210

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENWMKIKPVI+EEWNENRD LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  82   SSVAEGLTVEGILENWMKIKPVIMEEWNENRDELIDLFGKVRDEWMDNDLATWIGAN  138



>gb|KJB22336.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=218

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  32   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  89

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  90   FYPGVPDALK-FSSSTIYIVTTKQSR  114



>gb|KJB22340.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=232

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  82   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  140  FYPGVPDALK-FSSSTIYIVTTKQSR  164



>gb|KJB22339.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=260

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  74   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  131

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  132  FYPGVPDALK-FSSSTIYIVTTKQSR  156



>ref|XP_007051771.1| Uncharacterized protein TCM_005310 [Theobroma cacao]
 gb|EOX95928.1| Uncharacterized protein TCM_005310 [Theobroma cacao]
Length=268

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW K+KPVI+EEWNENRDALIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  82   SSVAEGLTVEGILENWSKLKPVIMEEWNENRDALIDLFGKVRDEWMDNDLATWIGAN  138



>gb|KHG18490.1| Ribosomal RNA small subunit methyltransferase G [Gossypium arboreum]
Length=266

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  80   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  137

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  138  FYPGVPDALK-FSSSTIYIVTTKQSR  162



>gb|KJB22338.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=247

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  82   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  140  FYPGVPDALK-FSSSTIYIVTTKQSR  164



>gb|KJB22334.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=268

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTV+ ILENW KIKPVI+EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   
Sbjct  82   SSVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK  +S+ I  + ++ +R
Sbjct  140  FYPGVPDALK-FSSSTIYIVTTKQSR  164



>ref|XP_011036565.1| PREDICTED: uncharacterized protein LOC105134023 isoform X2 [Populus 
euphratica]
Length=218

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++V+EGLTVD ILENW KIKPVI+EEW ENRDALI+LFGKVR+EWMDNDL+TWIGAN   
Sbjct  32   SSVSEGLTVDGILENWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANR--  89

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK   S+ I  + ++ +R
Sbjct  90   FYPGVPDALK-FASSSIYIVTTKQSR  114



>ref|XP_011036556.1| PREDICTED: uncharacterized protein LOC105134023 isoform X1 [Populus 
euphratica]
Length=268

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++V+EGLTVD ILENW KIKPVI+EEW ENRDALI+LFGKVR+EWMDNDL+TWIGAN   
Sbjct  82   SSVSEGLTVDGILENWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK   S+ I  + ++ +R
Sbjct  140  FYPGVPDALK-FASSSIYIVTTKQSR  164



>ref|XP_002320140.1| hypothetical protein POPTR_0014s08190g [Populus trichocarpa]
 gb|EEE98455.1| hypothetical protein POPTR_0014s08190g [Populus trichocarpa]
Length=268

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGLTVD IL+NW KIKPVI+EEW ENRDALI+LFGKVR+EWMDNDL+TWIGAN   
Sbjct  82   SSVAEGLTVDGILDNWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK   S+ I  + ++ +R
Sbjct  140  FYPGVPDALK-FASSSIYIVTTKQSR  164



>ref|XP_006445010.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58250.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86221.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=166

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>gb|KDO86222.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=145

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>ref|XP_004138497.1| PREDICTED: uncharacterized protein LOC101221288 [Cucumis sativus]
 gb|KGN45668.1| hypothetical protein Csa_6G004590 [Cucumis sativus]
Length=268

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = -3

Query  406  FNYLESSLEIYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLTVDK  227
            F+ +ESSLE + +   Y ++     +  G E              S   ++VAEGLTV  
Sbjct  36   FDEVESSLENWIVDQMYTVRPV---VETGYENLLLVRLLLEMRLPSIRKSSVAEGLTVHG  92

Query  226  ILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ILENW K+KPVI+EEW ENRDALIDLFGKVR++W+D DL+TWIGAN
Sbjct  93   ILENWSKLKPVIMEEWGENRDALIDLFGKVRDQWIDEDLATWIGAN  138



>gb|KDO86223.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=218

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  32   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  88



>ref|XP_009768013.1| PREDICTED: uncharacterized protein LOC104219077 [Nicotiana sylvestris]
Length=268

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 69/109 (63%), Gaps = 9/109 (8%)
 Frame = -3

Query  406  FNYLESSLE---IYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLT  236
            FN ++SSLE   +  M    P+ E       G E              S   ++VAEGLT
Sbjct  36   FNGVDSSLEDWIVDQMHVVRPVVET------GYENLLLVRLLLETRIPSIRKSSVAEGLT  89

Query  235  VDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            V+ ILENW KIKP+IV EWNE+RD+LIDLFGKVR+EWMDNDL+TWIG N
Sbjct  90   VEGILENWAKIKPIIVAEWNEDRDSLIDLFGKVRDEWMDNDLATWIGTN  138



>gb|KDO86219.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=193

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>gb|EYU32140.1| hypothetical protein MIMGU_mgv1a011795mg [Erythranthe guttata]
Length=268

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+++LENW+ IKPVI+ EW+ENRDALIDLFGKVR+EW+DNDL+TWIGAN
Sbjct  82   SSVAEGLTVEEVLENWLTIKPVIMSEWDENRDALIDLFGKVRDEWLDNDLATWIGAN  138



>gb|KDO86218.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=190

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>ref|XP_006445007.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58247.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86217.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=202

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>ref|XP_006445008.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58248.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86220.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=208

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>gb|KDO86216.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=233

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>ref|XP_004248047.1| PREDICTED: uncharacterized protein LOC101253323 isoform X1 [Solanum 
lycopersicum]
Length=268

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW KIKP+I+ EWNE+RD LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  82   SSVAEGLTVEGILENWSKIKPIIMAEWNEDRDFLIDLFGKVRDEWMDNDLATWIGAN  138



>ref|XP_006445009.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 ref|XP_006491136.1| PREDICTED: uncharacterized protein LOC102608684 [Citrus sinensis]
 gb|ESR58249.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86215.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=268

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGAN  138



>ref|XP_010056396.1| PREDICTED: uncharacterized protein LOC104444425 [Eucalyptus grandis]
 gb|KCW73107.1| hypothetical protein EUGRSUZ_E01551 [Eucalyptus grandis]
Length=268

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  274  SST*YATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIG  95
            SS   ++VAEGLT+D ILE+W KIKPVI+EEW ENR+ L+DLFGKVR+EWMD DL TWI 
Sbjct  77   SSIRKSSVAEGLTIDGILESWSKIKPVIMEEWGENRETLVDLFGKVRDEWMDKDLGTWIA  136

Query  94   AN  89
            AN
Sbjct  137  AN  138



>gb|EYU32139.1| hypothetical protein MIMGU_mgv1a011795mg [Erythranthe guttata]
Length=270

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -3

Query  253  VAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            VAEGLTV+++LENW+ IKPVI+ EW+ENRDALIDLFGKVR+EW+DNDL+TWIGAN
Sbjct  86   VAEGLTVEEVLENWLTIKPVIMSEWDENRDALIDLFGKVRDEWLDNDLATWIGAN  140



>ref|XP_006364150.1| PREDICTED: uncharacterized protein LOC102604822 [Solanum tuberosum]
Length=268

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = -3

Query  406  FNYLESSLE---IYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLT  236
            FN ++SSLE   +  M    P+ E       G E          +   S   ++VAEGLT
Sbjct  36   FNGVDSSLEDWIVDQMHVVRPVVET------GYENLLLVRLLLESRIPSIRKSSVAEGLT  89

Query  235  VDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            V+ ILENW KIKP+I+ EWNE++D LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  90   VEGILENWAKIKPIIMAEWNEDKDFLIDLFGKVRDEWMDNDLATWIGAN  138



>ref|XP_010523762.1| PREDICTED: uncharacterized protein LOC104802037 [Tarenaya hassleriana]
Length=268

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W KIKPVI+E WNE+RDAL+DLFGKVR+EWMD DL+TW+GAN
Sbjct  82   SSVAEGLTVDVILESWSKIKPVIMEAWNEDRDALVDLFGKVRDEWMDKDLTTWMGAN  138



>ref|XP_006445011.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
 gb|ESR58251.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
Length=218

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV++ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  32   SSVAEGLTVEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  88



>ref|XP_009622825.1| PREDICTED: uncharacterized protein LOC104114152 [Nicotiana tomentosiformis]
Length=268

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 9/109 (8%)
 Frame = -3

Query  406  FNYLESSLE---IYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLT  236
            FN ++SSLE   +  M    P+ E       G E              S   ++VAEGLT
Sbjct  36   FNGVDSSLEDWIVDQMHVVRPVVET------GYENLLLVRLLLETRIPSIRKSSVAEGLT  89

Query  235  VDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            V+ ILENW KIKP+I+ EW+E+RD LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  90   VEGILENWAKIKPIIMAEWDEDRDFLIDLFGKVRDEWMDNDLATWIGAN  138



>ref|XP_010326971.1| PREDICTED: uncharacterized protein LOC101253323 isoform X2 [Solanum 
lycopersicum]
Length=238

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -3

Query  253  VAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            VAEGLTV+ ILENW KIKP+I+ EWNE+RD LIDLFGKVR+EWMDNDL+TWIGAN
Sbjct  54   VAEGLTVEGILENWSKIKPIIMAEWNEDRDFLIDLFGKVRDEWMDNDLATWIGAN  108



>emb|CDP08796.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV  IL+NW KIKP+I+EEW+E RD LIDLFGK+R+EWMDNDL+TWIGAN
Sbjct  82   SSVAEGLTVKGILDNWSKIKPIIMEEWDEKRDPLIDLFGKIRDEWMDNDLATWIGAN  138



>gb|KDO86214.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=218

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  32   SSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  88



>gb|KDO86213.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=220

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  82   SSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  138



>ref|XP_006491134.1| PREDICTED: uncharacterized protein LOC102608197 isoform X1 [Citrus 
sinensis]
Length=274

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = -3

Query  406  FNYLESSLE---IYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLT  236
            F+ ++S+LE   +  M   + + +    +  G E              S   ++VAEGLT
Sbjct  36   FDGVDSALEDWIVDQMHTCFILLQLRPVIETGYETLLLVRLLLEMRLPSLRKSSVAEGLT  95

Query  235  VDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            V++ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  96   VEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  144



>ref|XP_006445012.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
 ref|XP_006491135.1| PREDICTED: uncharacterized protein LOC102608197 isoform X2 [Citrus 
sinensis]
 gb|ESR58252.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
Length=268

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV++ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  82   SSVAEGLTVEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  138



>gb|KHN29347.1| hypothetical protein glysoja_005071 [Glycine soja]
Length=212

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -3

Query  256  TVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQVF  77
            TVAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVR+EW++ D +TWIGAN    
Sbjct  51   TVAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGANSHFA  110

Query  76   FAVLK*MTSNCI  41
             A+L+ +    I
Sbjct  111  DALLQELAGVAI  122



>gb|AFK48185.1| unknown [Lotus japonicus]
Length=212

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE W K+KPVI+EEW ENRDALIDLFGKVR+EW++ + +TWIGAN
Sbjct  82   SSVAEGLTVDGILEKWSKLKPVIMEEWGENRDALIDLFGKVRDEWLEQNFATWIGAN  138



>gb|EYU32142.1| hypothetical protein MIMGU_mgv1a011872mg [Erythranthe guttata]
Length=215

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +++AEGLTV++ILENW  IKPVI+ EW+E+RD LIDLFGKVR+EW+DNDL+TWIGAN
Sbjct  82   SSIAEGLTVEEILENWSTIKPVIMAEWDEDRDVLIDLFGKVRDEWIDNDLATWIGAN  138



>gb|KDO86210.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=274

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  88   SSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  144



>gb|KDO86211.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=268

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  82   SSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  138



>gb|KDO86212.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=263

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVR+EWMD D +TWIGAN
Sbjct  82   SSVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGAN  138



>gb|AFK38203.1| unknown [Lotus japonicus]
Length=268

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE W K+KPVI+EEW ENRDALIDLFGKVR+EW++ + +TWIGAN
Sbjct  82   SSVAEGLTVDGILEKWSKLKPVIMEEWGENRDALIDLFGKVRDEWLEQNFATWIGAN  138



>gb|EYU32143.1| hypothetical protein MIMGU_mgv1a011872mg [Erythranthe guttata]
Length=268

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +++AEGLTV++ILENW  IKPVI+ EW+E+RD LIDLFGKVR+EW+DNDL+TWIGAN
Sbjct  82   SSIAEGLTVEEILENWSTIKPVIMAEWDEDRDVLIDLFGKVRDEWIDNDLATWIGAN  138



>ref|XP_010508079.1| PREDICTED: uncharacterized protein LOC104784718 [Camelina sativa]
Length=268

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +TVAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVR++WM+ DL+TWIGAN
Sbjct  82   STVAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGAN  138



>ref|XP_010506594.1| PREDICTED: uncharacterized protein LOC104783176 [Camelina sativa]
Length=268

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +TVAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVR++WM+ DL+TWIGAN
Sbjct  82   STVAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGAN  138



>ref|XP_010518258.1| PREDICTED: uncharacterized protein LOC104793570 [Camelina sativa]
Length=268

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +TVAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVR++WM+ DL+TWIGAN
Sbjct  82   STVAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGAN  138



>ref|XP_010508078.1| PREDICTED: uncharacterized protein LOC104784717 [Camelina sativa]
Length=302

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            +TVAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVR++WM+ DL+TWIGAN
Sbjct  116  STVAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGAN  172



>gb|AAL27556.1|AF420411_1 hypothetical protein [Musa acuminata AAA Group]
Length=151

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -3

Query  253  VAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            VA+GLTV+ ILENW ++KP+I++EW+E RDALIDLFG+VR+EW+DNDLS WIGAN
Sbjct  4    VADGLTVEAILENWSQLKPIIMKEWDEERDALIDLFGRVRDEWIDNDLSGWIGAN  58



>ref|XP_008458208.1| PREDICTED: uncharacterized protein LOC103497707 [Cucumis melo]
Length=269

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = -3

Query  406  FNYLESSLEIYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLTVDK  227
            F+ ++SSLE + +   Y ++     +  G E              S   ++VAEGLTV  
Sbjct  36   FDDVDSSLENWIVDQMYTVRPV---VETGYENLLLVRLLLEMRLPSIRKSSVAEGLTVHG  92

Query  226  ILENWMKIKPVIVEEWNE-NRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ILENW K+KPVI+EEW E NRDALIDLFGKVR++W+D DL+TWIGAN
Sbjct  93   ILENWSKLKPVIMEEWGEKNRDALIDLFGKVRDQWIDEDLATWIGAN  139



>ref|XP_007139823.1| hypothetical protein PHAVU_008G061600g [Phaseolus vulgaris]
 gb|ESW11817.1| hypothetical protein PHAVU_008G061600g [Phaseolus vulgaris]
Length=268

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILE W K+KP+I+EEW ENRDALIDLFGKVR+EW++ D + WIGAN
Sbjct  82   SSVAEGLTVEAILEKWFKLKPIIMEEWGENRDALIDLFGKVRDEWLEQDFAAWIGAN  138



>ref|XP_010087947.1| hypothetical protein L484_012399 [Morus notabilis]
 gb|EXB30869.1| hypothetical protein L484_012399 [Morus notabilis]
Length=163

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGLTV++IL+NW+K+KP+I+EEW E R+ LIDLFGKVR+EWM+ DL++WIGAN
Sbjct  82   SSVSEGLTVERILDNWLKLKPIIMEEWGEQREELIDLFGKVRDEWMEKDLASWIGAN  138



>ref|XP_002511878.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50547.1| conserved hypothetical protein [Ricinus communis]
Length=268

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW K+KPVI+EEW E+RD+LI LFGK+R+EWMD DL+TWI AN
Sbjct  82   SSVAEGLTVEGILENWSKLKPVIMEEWGEDRDSLIHLFGKIRDEWMDKDLATWIAAN  138



>ref|XP_006601835.1| PREDICTED: uncharacterized protein LOC100810003 isoform X1 [Glycine 
max]
Length=236

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVR+EW++ D +TWIGAN
Sbjct  50   SSVAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGAN  106



>ref|NP_001031547.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10630.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=210

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVR++W++ DL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGAN  138



>ref|NP_001239728.1| uncharacterized protein LOC100810003 [Glycine max]
 gb|ACU24371.1| unknown [Glycine max]
 gb|KHM99366.1| hypothetical protein glysoja_028823 [Glycine soja]
Length=268

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVR+EW++ D +TWIGAN
Sbjct  82   SSVAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGAN  138



>ref|XP_009384561.1| PREDICTED: uncharacterized protein LOC103972086 [Musa acuminata 
subsp. malaccensis]
Length=269

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GLTV+ ILENW ++KP+I++EW+E RDALIDLFG++R+EW+DNDLS WIGAN
Sbjct  83   SSVADGLTVEAILENWSQMKPIIMKEWDEERDALIDLFGRIRDEWIDNDLSGWIGAN  139



>ref|XP_002880212.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56471.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVR++W++ DL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWINKDLTTWIGAN  138



>ref|XP_008244645.1| PREDICTED: uncharacterized protein LOC103342773 isoform X1 [Prunus 
mume]
Length=268

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEDLTTWIGAN  138



>ref|XP_008244646.1| PREDICTED: uncharacterized protein LOC103342773 isoform X2 [Prunus 
mume]
 ref|XP_008244647.1| PREDICTED: uncharacterized protein LOC103342773 isoform X2 [Prunus 
mume]
Length=265

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVR+EWMD DL+TWIGAN
Sbjct  82   SSVAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEDLTTWIGAN  138



>ref|NP_001031546.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10629.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=263

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVR++W++ DL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGAN  138



>ref|XP_011469002.1| PREDICTED: uncharacterized protein LOC101295560 [Fragaria vesca 
subsp. vesca]
Length=266

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 5/85 (6%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++V EGLTV+ ILE W  +KPVI+EEW E+RD LIDLF KVR+EWMD+DL TWIGAN ++
Sbjct  82   SSVGEGLTVEGILEKWSDLKPVIMEEWGEDRDGLIDLFAKVRDEWMDHDLKTWIGAN-RL  140

Query  79   FFAV---LK*MTSNCIAQIASRNAR  14
            +  V   LK  TS+ I  + ++ +R
Sbjct  141  YPGVPDALK-FTSSTIYVVTTKQSR  164



>ref|NP_566060.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850443.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC62903.1| expressed protein [Arabidopsis thaliana]
 gb|AAK92725.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14973.1| expressed protein [Arabidopsis thaliana]
 gb|AAM45106.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19560.1| AT2G45990 [Arabidopsis thaliana]
 gb|AEC10627.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
 gb|AEC10628.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=268

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVR++W++ DL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGAN  138



>ref|XP_004492754.1| PREDICTED: uncharacterized protein LOC101510342 isoform X1 [Cicer 
arietinum]
Length=277

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGL V+ ILENW K+KP+I+EEW EN+DALIDLFGKVR+EW++ D + WIGAN
Sbjct  91   SSVAEGLAVEGILENWSKLKPIIMEEWGENKDALIDLFGKVRDEWLEQDFAAWIGAN  147



>ref|XP_004492755.1| PREDICTED: uncharacterized protein LOC101510342 isoform X2 [Cicer 
arietinum]
Length=268

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGL V+ ILENW K+KP+I+EEW EN+DALIDLFGKVR+EW++ D + WIGAN
Sbjct  82   SSVAEGLAVEGILENWSKLKPIIMEEWGENKDALIDLFGKVRDEWLEQDFAAWIGAN  138



>ref|XP_006295045.1| hypothetical protein CARUB_v10024113mg [Capsella rubella]
 gb|EOA27943.1| hypothetical protein CARUB_v10024113mg [Capsella rubella]
Length=193

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            + VAEGLTVD ILE W KIKPVI+E W+E++DALIDLFG+VR++W++ DL+TWIGAN
Sbjct  82   SPVAEGLTVDGILETWAKIKPVIMEAWDEDKDALIDLFGQVRDDWINKDLTTWIGAN  138



>ref|XP_010255309.1| PREDICTED: uncharacterized protein LOC104596025 isoform X2 [Nelumbo 
nucifera]
Length=268

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 66/86 (77%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VA+GLT+D+IL+NW K+KPVI+EEW+ENR++LI+LFGKVR+EW++  LS+WIGAN   
Sbjct  82   SSVADGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK   S+ I  + ++ AR
Sbjct  140  FYPGVPDALK-FASSRIYIVTTKQAR  164



>ref|XP_006397785.1| hypothetical protein EUTSA_v10001586mg [Eutrema salsugineum]
 gb|ESQ39238.1| hypothetical protein EUTSA_v10001586mg [Eutrema salsugineum]
Length=268

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE W KIKPVI+E W+E++DAL+DLFGKVR++W++ DL+TWIGAN
Sbjct  82   SSVAEGLTVDGILEGWGKIKPVIMEAWDEDKDALVDLFGKVRDDWINKDLTTWIGAN  138



>ref|XP_012083366.1| PREDICTED: uncharacterized protein LOC105642967 isoform X2 [Jatropha 
curcas]
Length=237

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNEN-RDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV++ILENW+K+KPVI+EEW EN RD LI+LFGKVR+EWM  DL  WIGAN
Sbjct  82   SSVAEGLTVERILENWLKLKPVIMEEWGENHRDDLINLFGKVRDEWMYKDLPAWIGAN  139



>ref|XP_007218810.1| hypothetical protein PRUPE_ppa009991mg [Prunus persica]
 gb|EMJ20009.1| hypothetical protein PRUPE_ppa009991mg [Prunus persica]
Length=268

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVR+EWMD  L+TWIGAN
Sbjct  82   SSVAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEGLTTWIGAN  138



>ref|XP_012083365.1| PREDICTED: uncharacterized protein LOC105642967 isoform X1 [Jatropha 
curcas]
 gb|KDP28611.1| hypothetical protein JCGZ_14382 [Jatropha curcas]
Length=269

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNEN-RDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV++ILENW+K+KPVI+EEW EN RD LI+LFGKVR+EWM  DL  WIGAN
Sbjct  82   SSVAEGLTVERILENWLKLKPVIMEEWGENHRDDLINLFGKVRDEWMYKDLPAWIGAN  139



>ref|XP_010255310.1| PREDICTED: uncharacterized protein LOC104596025 isoform X3 [Nelumbo 
nucifera]
Length=238

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 64/84 (76%), Gaps = 7/84 (8%)
 Frame = -3

Query  253  VAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQVFF  74
            VA+GLT+D+IL+NW K+KPVI+EEW+ENR++LI+LFGKVR+EW++  LS+WIGAN   F+
Sbjct  54   VADGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGANR--FY  111

Query  73   A----VLK*MTSNCIAQIASRNAR  14
                  LK   S+ I  + ++ AR
Sbjct  112  PGVPDALK-FASSRIYIVTTKQAR  134



>ref|XP_010918743.1| PREDICTED: uncharacterized protein LOC105043034 [Elaeis guineensis]
Length=269

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 3/106 (3%)
 Frame = -3

Query  406  FNYLESSLEIYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLTVDK  227
            F+ ++SSLE + +   + ++     +  G E              S   ++VA+GLTV+ 
Sbjct  37   FDGVDSSLEEWIVDQMHTLRPV---VETGYENLLLVRLLLELQMPSIRKSSVADGLTVEA  93

Query  226  ILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            IL NW ++KP+I++EWNE+RDALIDLFG+VR++WM NDLS WI AN
Sbjct  94   ILNNWSQLKPIIMKEWNEDRDALIDLFGRVRDDWMQNDLSGWISAN  139



>ref|XP_007139822.1| hypothetical protein PHAVU_008G061500g [Phaseolus vulgaris]
 gb|ESW11816.1| hypothetical protein PHAVU_008G061500g [Phaseolus vulgaris]
Length=268

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGL V+ ILENW K+KP+I+EEWNENR+ LIDLFGKVR+EW++ D + WIGAN
Sbjct  82   SSVSEGLAVEDILENWFKLKPIIMEEWNENREDLIDLFGKVRDEWLERDFTGWIGAN  138



>dbj|BAC83355.2| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG97066.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW+K+KP I+ EWNE+RD+L+DLFG +R++W++NDLS WIGAN
Sbjct  83   SSVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGAN  139



>gb|KEH23368.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
Length=216

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVR++W++ND + WI  N
Sbjct  82   SSVAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGN  138



>emb|CAN70694.1| hypothetical protein VITISV_002394 [Vitis vinifera]
Length=275

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V EGLT++ ILENW K+KPVI+EEW+E R+ L+DLFGKVR+EWM++DL+TWI AN
Sbjct  82   SSVVEGLTIEGILENWSKLKPVIMEEWDEKREPLVDLFGKVRDEWMEDDLATWIDAN  138



>ref|XP_002275801.1| PREDICTED: uncharacterized protein LOC100260183 [Vitis vinifera]
 emb|CBI40393.3| unnamed protein product [Vitis vinifera]
Length=268

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V EGLT++ ILENW K+KPVI+EEW+E R+ L+DLFGKVR+EWM++DL+TWI AN
Sbjct  82   SSVVEGLTIEGILENWSKLKPVIMEEWDEKREPLVDLFGKVRDEWMEDDLATWIDAN  138



>ref|XP_006827564.1| PREDICTED: uncharacterized protein LOC18422845 isoform X1 [Amborella 
trichopoda]
 gb|ERM94980.1| hypothetical protein AMTR_s00009p00222660 [Amborella trichopoda]
Length=289

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 7/86 (8%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VA GL++D ILENW K+KP+I+EEWNE+RD LI LFGKVR+EW++ D S WIGAN   
Sbjct  82   SSVAPGLSIDGILENWSKLKPIIMEEWNEDRDTLIGLFGKVRDEWIEKDFSGWIGANR--  139

Query  79   FFA----VLK*MTSNCIAQIASRNAR  14
            F+      LK   S+ I  + ++ +R
Sbjct  140  FYPGIADALK-FASSTIYIVTTKQSR  164



>emb|CDY18881.1| BnaC04g04690D [Brassica napus]
Length=269

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 54/58 (93%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNEN-RDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W KIKPVI+E W+E+ +DALIDLFGKVR++W++NDL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWGKIKPVIMEAWDEDDKDALIDLFGKVRDDWINNDLTTWIGAN  139



>ref|XP_011624852.1| PREDICTED: uncharacterized protein LOC18422845 isoform X2 [Amborella 
trichopoda]
Length=268

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA GL++D ILENW K+KP+I+EEWNE+RD LI LFGKVR+EW++ D S WIGAN
Sbjct  82   SSVAPGLSIDGILENWSKLKPIIMEEWNEDRDTLIGLFGKVRDEWIEKDFSGWIGAN  138



>gb|ACJ84457.1| unknown [Medicago truncatula]
 gb|AFK49628.1| unknown [Medicago truncatula]
Length=171

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ +LE+W K+KP+++EEWNENRD LIDLFGKVR++W++ND + WI  N
Sbjct  82   SSVAEGLTVEGVLEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGN  138



>ref|XP_006657631.1| PREDICTED: uncharacterized protein LOC102713007 [Oryza brachyantha]
Length=269

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW+K+KP I+ EWNE+RD+L+DLFG +R++W++NDLS WIGAN
Sbjct  83   SSVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGAN  139



>gb|AFK34805.1| unknown [Medicago truncatula]
Length=247

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVR++W++ND + WI  N
Sbjct  82   SSVAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGN  138



>gb|AFK49194.1| unknown [Lotus japonicus]
Length=270

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GLTV+ ILENW+K+KPVI+EEWNENR+ LI+LFGKVR++W++ D + WIGAN
Sbjct  84   SSVADGLTVEDILENWLKLKPVIMEEWNENREDLIELFGKVRDDWLEKDFNGWIGAN  140



>gb|KHM99365.1| hypothetical protein glysoja_028822 [Glycine soja]
Length=268

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGL V+ ILENW K+KP+I+EEWNENR+ LIDLFGKVR++W++ D + WIGAN
Sbjct  82   SSVSEGLKVEDILENWFKLKPIIMEEWNENREELIDLFGKVRDDWLERDFTGWIGAN  138



>gb|KFK37383.1| hypothetical protein AALP_AA4G250000 [Arabis alpina]
Length=268

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGL VD ILE+W KIKPVI+E W+E++DAL+DLFGKVR++W+  DL+TWIGAN
Sbjct  82   SSVAEGLNVDGILESWGKIKPVIMEAWDEDKDALVDLFGKVRDDWIKEDLTTWIGAN  138



>ref|XP_003623980.1| hypothetical protein MTR_7g077870 [Medicago truncatula]
 gb|ACJ85251.1| unknown [Medicago truncatula]
 gb|AES80198.1| hypothetical protein MTR_7g077870 [Medicago truncatula]
 gb|AFK47507.1| unknown [Medicago truncatula]
Length=268

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGL V+ ILE+W  +KP+I+EEW ENR+ALIDLFGKVR+EW++ D + WIGAN
Sbjct  82   SSVAEGLAVEGILESWSTLKPIIMEEWGENREALIDLFGKVRDEWLEQDFAAWIGAN  138



>gb|EEC76618.1| hypothetical protein OsI_14495 [Oryza sativa Indica Group]
Length=269

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW+K+KP I+ EWNE+RD+L+DLFG +R++W++NDLS WIGAN
Sbjct  83   SSVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGAN  139



>ref|NP_001059469.1| Os07g0418000 [Oryza sativa Japonica Group]
 dbj|BAC10357.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21383.1| Os07g0418000 [Oryza sativa Japonica Group]
 dbj|BAG89745.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67036.1| hypothetical protein OsJ_23973 [Oryza sativa Japonica Group]
Length=269

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW+K+KP I+ EWNE+RD+L+DLFG +R++W++NDLS WIGAN
Sbjct  83   SSVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGAN  139



>ref|XP_008801330.1| PREDICTED: uncharacterized protein LOC103715476 [Phoenix dactylifera]
Length=269

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GLT++ IL NW ++KP+I++EWNE+RDALIDLFG+VR+ WM  DLS WIGAN
Sbjct  83   SSVADGLTIEAILNNWSQLKPIIMKEWNEDRDALIDLFGRVRDNWMQTDLSGWIGAN  139



>ref|XP_003623981.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
 gb|AES80199.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
Length=268

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVR++W++ND + WI  N
Sbjct  82   SSVAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGN  138



>ref|XP_009367812.1| PREDICTED: uncharacterized protein LOC103957377 [Pyrus x bretschneideri]
Length=268

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ IL+ W ++KPVI+ EW E RDALI LFG+VR+EWMD DL TWIGAN
Sbjct  82   SSVAEGLTVEGILDKWSELKPVIMAEWGEERDALIHLFGQVRDEWMDEDLKTWIGAN  138



>ref|XP_004492759.1| PREDICTED: uncharacterized protein LOC101511624 [Cicer arietinum]
Length=268

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 52/63 (83%), Gaps = 2/63 (3%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQV  80
            ++VAEGL V+ ILENW+K+KP+++EEWNENRD LIDLFGKVR++W++ D + WI AN   
Sbjct  82   SSVAEGLIVEGILENWLKLKPIVMEEWNENRDELIDLFGKVRDDWLEKDFTGWIEANR--  139

Query  79   FFA  71
            FF 
Sbjct  140  FFP  142



>ref|XP_010670120.1| PREDICTED: uncharacterized protein LOC104887219 [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNE-NRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLT++ ILENW K+K VI+EEW+E NR+ LIDLFGK+R+EW++NDL+TWIGAN
Sbjct  82   SSVAEGLTIEGILENWPKLKAVIMEEWDEKNREVLIDLFGKIRDEWIENDLATWIGAN  139



>ref|XP_009143199.1| PREDICTED: uncharacterized protein LOC103866942 [Brassica rapa]
Length=269

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNEN-RDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD ILE+W KIKPVI+E W+E+ +DALIDLFG VR++W++NDL+TWIGAN
Sbjct  82   SSVAEGLTVDGILESWGKIKPVIMEAWDEDDKDALIDLFGSVRDDWINNDLTTWIGAN  139



>ref|XP_003568582.1| PREDICTED: uncharacterized protein LOC100823061 [Brachypodium 
distachyon]
Length=269

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V++GL+V +ILENW+K+KP I+ EWNE+RD+L+DLFG++R++W++NDL  WIGAN
Sbjct  83   SSVSDGLSVQEILENWLKLKPTIMSEWNEDRDSLVDLFGRIRDDWIENDLPGWIGAN  139



>ref|XP_008338880.1| PREDICTED: uncharacterized protein LOC103401933 [Malus domestica]
Length=268

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLT++ ILE W ++K VI+ EW E RDALI LFGKVR+EWMD DL+TWIGAN
Sbjct  73   SSVAEGLTMEGILEKWSELKQVIMAEWGEERDALIHLFGKVRDEWMDEDLTTWIGAN  129



>ref|XP_004306764.1| PREDICTED: uncharacterized protein LOC101294106 [Fragaria vesca 
subsp. vesca]
Length=268

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ ILE W  +KPVI++EW E +D L++LFGKVR+EWMD D++TWIGAN
Sbjct  82   SSVAEGLTVEGILEKWSVLKPVIMKEWGEEKDPLVNLFGKVRDEWMDQDMATWIGAN  138



>emb|CDX74783.1| BnaA05g05290D [Brassica napus]
Length=269

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 53/58 (91%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNEN-RDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTVD IL +W KIKPVI+E W+E+ +DALIDLFGKVR++W++NDL+TWIGAN
Sbjct  82   SSVAEGLTVDGILGSWGKIKPVIMEAWDEDDKDALIDLFGKVRDDWINNDLTTWIGAN  139



>ref|XP_010255308.1| PREDICTED: uncharacterized protein LOC104596025 isoform X1 [Nelumbo 
nucifera]
Length=293

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 9/143 (6%)
 Frame = -3

Query  430  HNETPLISFNYLESSLEIYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATV  251
            H   P++   Y    L    ++ R P    S+     ++K + S    + G         
Sbjct  52   HVVRPVVETGYENVLLVRLLLEIRMPTIRKSSVGIILMQKFHFSVFSEIKGNHL--LPRG  109

Query  250  AEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQVFFA  71
             +GLT+D+IL+NW K+KPVI+EEW+ENR++LI+LFGKVR+EW++  LS+WIGAN   F+ 
Sbjct  110  GDGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGANR--FYP  167

Query  70   ----VLK*MTSNCIAQIASRNAR  14
                 LK   S+ I  + ++ AR
Sbjct  168  GVPDALK-FASSRIYIVTTKQAR  189



>ref|XP_008343405.1| PREDICTED: uncharacterized protein LOC103406175 [Malus domestica]
Length=306

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 3/106 (3%)
 Frame = -3

Query  406  FNYLESSLEIYTMKCRYPMKEASNNLHKGVEKQNSSASHHVNGQSST*YATVAEGLTVDK  227
            FN ++S+LE + ++  Y ++     +  G E              S   ++VA GLTV  
Sbjct  74   FNGVDSALEDWVLEQMYIVRPV---VETGYENLLLVRLLLEMRIPSIRKSSVAXGLTVXG  130

Query  226  ILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            IL+ W ++KPVI+ EW E RDALI LFGKVR+EWMD DL TWIGAN
Sbjct  131  ILDKWSELKPVIMAEWGEERDALIHLFGKVRDEWMDEDLKTWIGAN  176



>ref|XP_004984348.1| PREDICTED: uncharacterized protein LOC101783107 [Setaria italica]
Length=337

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW K+KP++++EW E+R++L+DLFG+VR++W++NDLS WIGAN
Sbjct  151  SSVADGLSIQEILENWFKLKPILMDEWQEDRESLVDLFGRVRDDWIENDLSGWIGAN  207



>ref|XP_008344005.1| PREDICTED: uncharacterized protein LOC103406759 [Malus domestica]
Length=302

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA GLTV  IL+ W ++KPVI+ EW E RDALI LFGKVR+EWMD DL TWIGAN
Sbjct  116  SSVAXGLTVXGILDKWSELKPVIMAEWGEERDALIHLFGKVRDEWMDEDLKTWIGAN  172



>ref|NP_001276321.1| uncharacterized protein LOC100809469 [Glycine max]
 gb|ACU19689.1| unknown [Glycine max]
Length=268

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGL V+ ILENW K+KP+I+EEWNENR+ LIDLFGKV ++W++ D + WIGAN
Sbjct  82   SSVSEGLKVEDILENWFKLKPIIMEEWNENREELIDLFGKVGDDWLERDFTGWIGAN  138



>ref|XP_004492756.1| PREDICTED: uncharacterized protein LOC101510881 isoform X1 [Cicer 
arietinum]
 ref|XP_004492757.1| PREDICTED: uncharacterized protein LOC101510881 isoform X2 [Cicer 
arietinum]
 ref|XP_004492758.1| PREDICTED: uncharacterized protein LOC101510881 isoform X3 [Cicer 
arietinum]
Length=268

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLT + ILENW+K+KP+++EEWNEN+D LIDLFGKVR++W++ D   WI +N
Sbjct  82   SSVAEGLTAEGILENWLKLKPILMEEWNENKDDLIDLFGKVRDDWLEQDFPGWIESN  138



>ref|XP_006428290.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
 gb|ESR41530.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
Length=95

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
              V EGLT++ IL+NW KIK VI+++W+EN DAL  LFGKVR+EWMD DL+TW GAN
Sbjct  14   CVVFEGLTMEGILKNWSKIKLVIMKDWSENIDALFHLFGKVRDEWMDKDLTTWTGAN  70



>gb|EPS59432.1| hypothetical protein M569_15374 [Genlisea aurea]
Length=210

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V+EGL V++ILENW  IKPVI+ EW+E+++ALIDLFG++R+EW++ND ++WI AN
Sbjct  82   SSVSEGLVVNQILENWAGIKPVIMAEWDEDKEALIDLFGEIRDEWIENDFASWISAN  138



>ref|XP_002461895.1| hypothetical protein SORBIDRAFT_02g009970 [Sorghum bicolor]
 gb|EER98416.1| hypothetical protein SORBIDRAFT_02g009970 [Sorghum bicolor]
Length=336

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW+K+KP +++EW E+R++L+DLFG+VR++W++ND S WIGAN
Sbjct  150  SSVADGLSIQEILENWLKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGAN  206



>ref|XP_006428288.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
 gb|ESR41528.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
Length=101

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
              V EGLT++ IL+NW KIK VI+++W+EN DAL  LFGKVR+EWMD DL+TW GAN
Sbjct  14   CVVFEGLTMEGILKNWSKIKLVIMKDWSENIDALFHLFGKVRDEWMDKDLTTWTGAN  70



>ref|XP_006480381.1| PREDICTED: uncharacterized protein LOC102607955 isoform X1 [Citrus 
sinensis]
Length=105

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
              V EGLT++ IL+NW KIK VI+++W+EN DAL  LFGKVR+EWMD DL+TW GAN
Sbjct  14   CVVFEGLTMEGILKNWSKIKLVIMKDWSENIDALFHLFGKVRDEWMDKDLTTWTGAN  70



>ref|NP_001143648.1| uncharacterized protein LOC100276370 [Zea mays]
 gb|ACG33757.1| hypothetical protein [Zea mays]
Length=336

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW K+KP +++EW E+R++L+DLFG+VR++W++ND S WIGAN
Sbjct  150  SSVADGLSIQEILENWSKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGAN  206



>tpg|DAA39436.1| TPA: hypothetical protein ZEAMMB73_910853 [Zea mays]
Length=336

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW K+KP +++EW E+R++L+DLFG+VR++W++ND S WIGAN
Sbjct  150  SSVADGLSIQEILENWSKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGAN  206



>gb|ABR16780.1| unknown [Picea sitchensis]
Length=268

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V  GLTV+ ILENW K+KPVI+ EW E+ + L++LFGKVR+EW+++DLS+WIGAN
Sbjct  82   SSVVPGLTVEGILENWSKLKPVIMMEWGESSEELVELFGKVRDEWLEHDLSSWIGAN  138



>dbj|BAJ92002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +ILENW K+ P +++EW E+R++L+DLFG+VR++W++NDLS WIGAN
Sbjct  84   SSVADGLSIQEILENWSKLLPTLMDEWQEDRESLVDLFGRVRDDWLENDLSGWIGAN  140



>gb|ABK26606.1| unknown [Picea sitchensis]
Length=281

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V  GLTV+ ILENW K+KPVI+ EW E+ + L++LFGKVR+EW+++DLS+WIGAN
Sbjct  82   SSVVPGLTVEGILENWSKLKPVIMMEWGESSEELVELFGKVRDEWLEHDLSSWIGAN  138



>gb|EMT00704.1| hypothetical protein F775_08758 [Aegilops tauschii]
Length=270

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +IL+NW K+ P +++EW E+R++L+DLFG+VR++W++NDLS WIGAN
Sbjct  84   SSVADGLSIQEILDNWSKLLPTLMDEWQEDRESLVDLFGRVRDDWLENDLSGWIGAN  140



>gb|EMS45488.1| hypothetical protein TRIUR3_03694 [Triticum urartu]
Length=216

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VA+GL++ +IL+NW K+ P +++EW E+R++L+DLFG VR++W++NDLS WIGAN
Sbjct  30   SSVADGLSIQQILDNWSKLLPTLMDEWQEDRESLVDLFGCVRDDWLENDLSGWIGAN  86



>ref|XP_004306768.1| PREDICTED: uncharacterized protein LOC101295853 [Fragaria vesca 
subsp. vesca]
Length=275

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ I+ENW ++K +I++EW E++D+L++L+GKVR+EW D DL TWIGAN
Sbjct  82   SSVAEGLTVEGIVENWSELKNLILKEWGEDKDSLVNLYGKVRDEWKDQDLGTWIGAN  138



>gb|KHN29346.1| hypothetical protein glysoja_005070 [Glycine soja]
Length=143

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWM  122
            ++V+EGLTV+ ILENW K+KP+I+EEWNENR+ LIDLFGKVR++W+
Sbjct  82   SSVSEGLTVEDILENWFKLKPIIMEEWNENREELIDLFGKVRDDWL  127



>ref|XP_002968931.1| hypothetical protein SELMODRAFT_90693 [Selaginella moellendorffii]
 gb|EFJ30047.1| hypothetical protein SELMODRAFT_90693 [Selaginella moellendorffii]
Length=272

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNE-NRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V  GLTV+ +LENW K+KPV+++EW E +RD L++LFGKVR+EW+  DL TWI AN
Sbjct  85   SSVVNGLTVEGVLENWEKLKPVLMKEWGEASRDELVELFGKVRDEWISKDLGTWISAN  142



>ref|XP_006421478.1| hypothetical protein CICLE_v10006592mg [Citrus clementina]
 gb|ESR34718.1| hypothetical protein CICLE_v10006592mg [Citrus clementina]
Length=73

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  223  LENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++NW KIK VI++EW+E+RDALI+LFGKVR+EWMD +L+TWIG N
Sbjct  1    MKNWFKIKSVIMQEWSESRDALIELFGKVRDEWMDTNLTTWIGDN  45



>ref|XP_006428289.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
 gb|ESR41529.1| hypothetical protein CICLE_v10013186mg [Citrus clementina]
Length=80

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -3

Query  235  VDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++ IL+NW KIK VI+++W+EN DAL  LFGKVR+EWMD DL+TW GAN
Sbjct  1    MEGILKNWSKIKLVIMKDWSENIDALFHLFGKVRDEWMDKDLTTWTGAN  49



>ref|XP_002989978.1| hypothetical protein SELMODRAFT_428440 [Selaginella moellendorffii]
 gb|EFJ08991.1| hypothetical protein SELMODRAFT_428440 [Selaginella moellendorffii]
Length=272

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 46/58 (79%), Gaps = 1/58 (2%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNE-NRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++V  GLTV+ +LENW K+KPV+++EW E +RD L++LFG VR+EW+  DL TWI AN
Sbjct  85   SSVVNGLTVEGVLENWEKLKPVLMKEWGEASRDELVELFGNVRDEWISKDLGTWISAN  142



>ref|XP_007052235.1| TRAF-like family protein [Theobroma cacao]
 gb|EOX96392.1| TRAF-like family protein [Theobroma cacao]
Length=333

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -3

Query  262  YATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQ  83
            Y  + EGLTV+ ILENW K+KPVI+EEWNENR ALI L  ++    MD D +TWIGA+ Q
Sbjct  263  YKKITEGLTVEGILENWSKLKPVIMEEWNENRVALIYLLERL---GMDKDWATWIGADSQ  319

Query  82   VFFA  71
              +A
Sbjct  320  SLWA  323



>gb|KJB22335.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
 gb|KJB22337.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=164

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 7/63 (11%)
 Frame = -3

Query  190  VEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQVFFA----VLK*MTSNCIAQIASR  23
            +EEW+ENRDALIDLFGKVR+EWMDNDL+TWIGAN   F+      LK  +S+ I  + ++
Sbjct  1    MEEWDENRDALIDLFGKVRDEWMDNDLATWIGANR--FYPGVPDALK-FSSSTIYIVTTK  57

Query  22   NAR  14
             +R
Sbjct  58   QSR  60



>ref|XP_001759804.1| predicted protein [Physcomitrella patens]
 gb|EDQ75308.1| predicted protein [Physcomitrella patens]
Length=269

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 59/85 (69%), Gaps = 8/85 (9%)
 Frame = -3

Query  253  VAEGLTVDKILENW-MKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGANXQVF  77
            VA  L+VD IL +W   IKPV+++EW+EN++ L+DLFGKVR++W+++DL  WIGAN   F
Sbjct  84   VAGKLSVDDILADWEHGIKPVLMKEWSENKEELVDLFGKVRDDWLEHDLRGWIGANR--F  141

Query  76   FA----VLK*MTSNCIAQIASRNAR  14
            +      LK  +S+ +  + ++ AR
Sbjct  142  YPGTADALK-FSSSTLFIVTTKQAR  165



>ref|XP_001771402.1| predicted protein [Physcomitrella patens]
 gb|EDQ63792.1| predicted protein, partial [Physcomitrella patens]
Length=247

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -3

Query  259  ATVAEGLTVDKILENW-MKIKPVIVEEWNE-NRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAE L+V+ IL +W   IKPV+++EWNE N++ L++L+GKVR+EWM++D   WIGAN
Sbjct  59   SSVAEKLSVEDILVDWEHGIKPVVMKEWNESNKEELVELYGKVRDEWMEHDFHGWIGAN  117



>ref|XP_004295150.1| PREDICTED: uncharacterized protein LOC101305350 [Fragaria vesca 
subsp. vesca]
Length=283

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++VAEGLTV+ I+ENW ++K ++  EW E++++L +LF KVR+EW   DL TWIGAN
Sbjct  95   SSVAEGLTVEGIVENWSELKILLRNEWGEDKESLENLFRKVRDEWKGQDLGTWIGAN  151



>ref|XP_006432614.1| hypothetical protein CICLE_v10003222mg, partial [Citrus clementina]
 gb|ESR45854.1| hypothetical protein CICLE_v10003222mg, partial [Citrus clementina]
Length=155

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  253  VAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWM  122
            V EGLTV+ IL+NW KIKP+IV++W+EN DA ++LFGKVR   +
Sbjct  24   VFEGLTVEGILKNWSKIKPMIVKDWSENIDARLNLFGKVRGSQL  67



>ref|XP_006494209.1| PREDICTED: uncharacterized protein LOC102628513 isoform X1 [Citrus 
sinensis]
Length=122

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  259  ATVAEGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNE  128
            + V EGLTV+ IL+NW K+KP+IV++W+EN DA ++LFGKVR  
Sbjct  9    SLVFEGLTVEGILKNWSKLKPMIVKDWSENIDAHLNLFGKVRGS  52



>gb|ACF83654.1| unknown [Zea mays]
Length=164

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  190  VEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            ++EW E+R++L+DLFG+VR++W++ND S WIGAN
Sbjct  1    MDEWQEDRESLVDLFGRVRDDWIENDFSGWIGAN  34



>ref|XP_003057547.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59192.1| predicted protein [Micromonas pusilla CCMP1545]
Length=282

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  GLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            G +VD+IL +W  + P ++E WN +R +++  +G +R++WM+ DL+ W+  N
Sbjct  86   GYSVDEILASWGALMPPLMERWNLDRASMVSGYGAIRDDWMEADLAGWLAPN  137



>ref|XP_001698105.1| hypothetical protein CHLREDRAFT_151387 [Chlamydomonas reinhardtii]
 gb|EDO99690.1| predicted protein [Chlamydomonas reinhardtii]
Length=293

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  247  EGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            EG++VD +L +W  + P  + EW   R  +++LFG+VR++W+  DL+ W+  N
Sbjct  107  EGVSVDDMLSSWEHLLPAKMAEWGLQRGDMVELFGRVRDDWIAADLAGWLAPN  159



>ref|XP_002946102.1| hypothetical protein VOLCADRAFT_101579 [Volvox carteri f. nagariensis]
 gb|EFJ53097.1| hypothetical protein VOLCADRAFT_101579 [Volvox carteri f. nagariensis]
Length=285

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  247  EGLTVDKILENWMKIKPVIVEEWNENRDALIDLFGKVRNEWMDNDLSTWIGAN  89
            EG++VD++L  W  + P  + EW  NR  +++LFG+VR++W+  DL  W+  N
Sbjct  84   EGVSVDEMLATWETMLPSRMAEWGLNRGEMVELFGQVRDDWIAADLDGWLAPN  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2049935769300