BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6833

Length=835
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631294.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    270   2e-80   Nicotiana tomentosiformis
ref|XP_009631293.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    270   2e-80   Nicotiana tomentosiformis
ref|XP_009774162.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    269   2e-80   Nicotiana sylvestris
ref|XP_009631292.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    270   2e-80   Nicotiana tomentosiformis
ref|XP_009774163.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    269   2e-80   Nicotiana sylvestris
gb|KHN10097.1|  Acylamino-acid-releasing enzyme                         267   3e-79   Glycine soja [wild soybean]
ref|XP_008796065.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    266   3e-79   
ref|XP_006420083.1|  hypothetical protein CICLE_v10004325mg             266   3e-79   Citrus clementina [clementine]
gb|KDO53937.1|  hypothetical protein CISIN_1g003363mg                   265   4e-79   Citrus sinensis [apfelsine]
gb|KDO53935.1|  hypothetical protein CISIN_1g003363mg                   266   5e-79   Citrus sinensis [apfelsine]
ref|XP_010069182.1|  PREDICTED: acylamino-acid-releasing enzyme i...    265   6e-79   Eucalyptus grandis [rose gum]
ref|XP_010069181.1|  PREDICTED: acylamino-acid-releasing enzyme i...    265   6e-79   
ref|XP_006420084.1|  hypothetical protein CICLE_v10004325mg             266   7e-79   Citrus clementina [clementine]
ref|XP_010069180.1|  PREDICTED: acylamino-acid-releasing enzyme i...    265   7e-79   Eucalyptus grandis [rose gum]
ref|XP_006356049.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    265   9e-79   
gb|KDO53933.1|  hypothetical protein CISIN_1g003363mg                   266   1e-78   Citrus sinensis [apfelsine]
ref|XP_010069179.1|  PREDICTED: acylamino-acid-releasing enzyme i...    266   1e-78   Eucalyptus grandis [rose gum]
ref|XP_006489494.1|  PREDICTED: acylamino-acid-releasing enzyme-like    265   1e-78   Citrus sinensis [apfelsine]
ref|XP_006356048.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    265   3e-78   Solanum tuberosum [potatoes]
ref|XP_006588524.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    265   3e-78   Glycine max [soybeans]
ref|XP_003536827.2|  PREDICTED: acylamino-acid-releasing enzyme-l...    265   3e-78   Glycine max [soybeans]
gb|KJB38264.1|  hypothetical protein B456_006G245500                    258   7e-78   Gossypium raimondii
ref|XP_007225244.1|  hypothetical protein PRUPE_ppa001729mg             263   7e-78   
ref|XP_008224197.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    262   1e-77   
ref|XP_010932862.1|  PREDICTED: acylamino-acid-releasing enzyme i...    261   1e-77   
ref|XP_010932861.1|  PREDICTED: acylamino-acid-releasing enzyme i...    262   2e-77   Elaeis guineensis
ref|XP_007145931.1|  hypothetical protein PHAVU_007G279900g             262   2e-77   Phaseolus vulgaris [French bean]
ref|XP_010317399.1|  PREDICTED: acylamino-acid-releasing enzyme i...    261   3e-77   Solanum lycopersicum
ref|XP_008224196.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    261   4e-77   Prunus mume [ume]
gb|EYU33017.1|  hypothetical protein MIMGU_mgv1a001397mg                261   5e-77   Erythranthe guttata [common monkey flower]
gb|EYU33016.1|  hypothetical protein MIMGU_mgv1a001397mg                261   5e-77   Erythranthe guttata [common monkey flower]
dbj|BAJ95985.1|  predicted protein                                      254   6e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012069746.1|  PREDICTED: acylamino-acid-releasing enzyme         261   7e-77   Jatropha curcas
gb|KJB38265.1|  hypothetical protein B456_006G245500                    259   8e-77   Gossypium raimondii
ref|XP_004234027.2|  PREDICTED: acylamino-acid-releasing enzyme i...    261   8e-77   Solanum lycopersicum
gb|KJB38266.1|  hypothetical protein B456_006G245500                    259   1e-76   Gossypium raimondii
ref|XP_009600933.1|  PREDICTED: acylamino-acid-releasing enzyme-like    259   1e-76   Nicotiana tomentosiformis
ref|XP_009348996.1|  PREDICTED: acylamino-acid-releasing enzyme-like    258   2e-76   
ref|XP_010069183.1|  PREDICTED: acylamino-acid-releasing enzyme-like    258   2e-76   Eucalyptus grandis [rose gum]
ref|XP_008449292.1|  PREDICTED: acylamino-acid-releasing enzyme i...    259   2e-76   
ref|XP_008449291.1|  PREDICTED: acylamino-acid-releasing enzyme i...    259   2e-76   Cucumis melo [Oriental melon]
gb|KJB38268.1|  hypothetical protein B456_006G245500                    259   2e-76   Gossypium raimondii
ref|XP_002517031.1|  acylamino-acid-releasing enzyme, putative          258   4e-76   
ref|XP_010091250.1|  Acylamino-acid-releasing enzyme                    244   5e-76   
ref|XP_006838890.2|  PREDICTED: acylamino-acid-releasing enzyme         258   6e-76   
ref|XP_010326712.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    257   7e-76   Solanum lycopersicum
gb|KGN61646.1|  hypothetical protein Csa_2G200940                       257   9e-76   Cucumis sativus [cucumbers]
ref|XP_010326710.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    257   9e-76   Solanum lycopersicum
ref|XP_010326709.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    257   1e-75   Solanum lycopersicum
ref|XP_003637575.1|  Acylamino-acid-releasing enzyme                    253   1e-75   
ref|XP_010649982.1|  PREDICTED: acylamino-acid-releasing enzyme i...    257   1e-75   Vitis vinifera
gb|ERN01459.1|  hypothetical protein AMTR_s00002p00268330               258   1e-75   Amborella trichopoda
ref|XP_006362176.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    256   1e-75   
ref|XP_002284013.2|  PREDICTED: acylamino-acid-releasing enzyme i...    257   1e-75   Vitis vinifera
ref|XP_011649169.1|  PREDICTED: acylamino-acid-releasing enzyme         257   1e-75   Cucumis sativus [cucumbers]
ref|XP_006362175.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    256   2e-75   Solanum tuberosum [potatoes]
emb|CDO99144.1|  unnamed protein product                                257   3e-75   Coffea canephora [robusta coffee]
ref|XP_006362173.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   3e-75   
ref|XP_006362171.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   3e-75   
gb|KEH27832.1|  acylamino-acid-releasing enzyme-like protein, put...    255   4e-75   Medicago truncatula
ref|XP_003613900.1|  Acylamino-acid-releasing enzyme                    255   4e-75   
ref|XP_009773635.1|  PREDICTED: acylamino-acid-releasing enzyme-like    255   4e-75   Nicotiana sylvestris
ref|XP_004498001.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   8e-75   Cicer arietinum [garbanzo]
ref|XP_008341037.1|  PREDICTED: acylamino-acid-releasing enzyme-like    254   8e-75   
gb|AES96858.2|  acylamino-acid-releasing enzyme-like protein, put...    255   8e-75   Medicago truncatula
ref|XP_004498000.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   8e-75   Cicer arietinum [garbanzo]
ref|XP_003613901.1|  Acylamino-acid-releasing enzyme                    255   8e-75   Medicago truncatula
ref|XP_004498003.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   9e-75   Cicer arietinum [garbanzo]
ref|XP_004498002.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   9e-75   Cicer arietinum [garbanzo]
dbj|BAJ94082.1|  predicted protein                                      254   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004497998.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    255   1e-74   
ref|XP_007034935.1|  Acylaminoacyl-peptidase-related isoform 2          254   1e-74   
ref|XP_010326708.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    253   1e-74   Solanum lycopersicum
ref|XP_010246335.1|  PREDICTED: acylamino-acid-releasing enzyme i...    254   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_004247631.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    253   1e-74   Solanum lycopersicum
ref|XP_008224200.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    251   2e-74   
ref|XP_011463572.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    258   3e-74   Fragaria vesca subsp. vesca
ref|XP_007034934.1|  Acylaminoacyl-peptidase-related isoform 1          254   3e-74   
ref|XP_010246334.1|  PREDICTED: acylamino-acid-releasing enzyme i...    253   4e-74   Nelumbo nucifera [Indian lotus]
ref|XP_009337282.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    252   4e-74   Pyrus x bretschneideri [bai li]
ref|XP_008353311.1|  PREDICTED: acylamino-acid-releasing enzyme-like    246   6e-74   
ref|XP_002312565.2|  hypothetical protein POPTR_0008s16030g             252   9e-74   
ref|XP_009337281.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    252   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_009773640.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    250   2e-73   Nicotiana sylvestris
ref|XP_008224199.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    251   2e-73   Prunus mume [ume]
ref|XP_009773636.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    251   2e-73   Nicotiana sylvestris
ref|XP_009773638.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    250   2e-73   Nicotiana sylvestris
ref|XP_009773639.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    250   2e-73   Nicotiana sylvestris
ref|XP_009773637.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    250   2e-73   Nicotiana sylvestris
ref|XP_011027451.1|  PREDICTED: acylamino-acid-releasing enzyme         251   4e-73   Populus euphratica
ref|XP_010234726.1|  PREDICTED: acylamino-acid-releasing enzyme i...    249   5e-73   Brachypodium distachyon [annual false brome]
ref|XP_009600932.1|  PREDICTED: acylamino-acid-releasing enzyme-like    249   8e-73   
ref|XP_003573923.1|  PREDICTED: acylamino-acid-releasing enzyme i...    249   9e-73   Brachypodium distachyon [annual false brome]
ref|XP_010690382.1|  PREDICTED: acylamino-acid-releasing enzyme-like    249   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009381275.1|  PREDICTED: acylamino-acid-releasing enzyme         247   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983184.1|  PREDICTED: acylamino-acid-releasing enzyme-like    246   2e-71   Setaria italica
gb|EPS67862.1|  hypothetical protein M569_06906                         245   2e-71   Genlisea aurea
ref|XP_008679989.1|  PREDICTED: LOC100285393 isoform X1                 245   2e-71   Zea mays [maize]
ref|XP_011467695.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    245   2e-71   Fragaria vesca subsp. vesca
ref|XP_008679983.1|  PREDICTED: LOC100285393 isoform X2                 245   3e-71   
ref|NP_001151758.1|  LOC100285393                                       244   4e-71   Zea mays [maize]
ref|XP_011091094.1|  PREDICTED: acylamino-acid-releasing enzyme-like    244   1e-70   Sesamum indicum [beniseed]
gb|KEH41014.1|  acylamino-acid-releasing enzyme, putative               247   2e-70   Medicago truncatula
ref|XP_011091099.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    240   1e-69   Sesamum indicum [beniseed]
ref|XP_011091095.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    240   2e-69   Sesamum indicum [beniseed]
ref|XP_008368386.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    239   5e-69   
ref|XP_006661776.1|  PREDICTED: acylamino-acid-releasing enzyme-like    238   7e-69   
ref|NP_001064602.1|  Os10g0415600                                       238   8e-69   
gb|ABB47613.1|  prolyl oligopeptidase family protein, expressed         238   1e-68   Oryza sativa Japonica Group [Japonica rice]
gb|AES96860.2|  acylamino-acid-releasing enzyme-like protein, put...    236   4e-68   Medicago truncatula
ref|XP_003613902.1|  Acylamino-acid-releasing enzyme                    236   5e-68   
ref|XP_007145932.1|  hypothetical protein PHAVU_007G280000g             236   5e-68   Phaseolus vulgaris [French bean]
gb|EEE50962.1|  hypothetical protein OsJ_31521                          233   2e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011467699.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    233   4e-67   Fragaria vesca subsp. vesca
ref|XP_011467689.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    233   5e-67   Fragaria vesca subsp. vesca
gb|ABB47614.1|  prolyl oligopeptidase family protein, expressed         233   7e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064603.1|  Os10g0415800                                       233   8e-67   
gb|EAY78482.1|  hypothetical protein OsI_33574                          233   9e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_010551702.1|  PREDICTED: acylamino-acid-releasing enzyme         232   1e-66   
ref|XP_003535932.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    231   2e-66   Glycine max [soybeans]
ref|XP_010440446.1|  PREDICTED: acylamino-acid-releasing enzyme-like    232   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010450023.1|  PREDICTED: acylamino-acid-releasing enzyme-like    232   2e-66   Camelina sativa [gold-of-pleasure]
ref|NP_193193.2|  acylamino acid-releasing enzyme                       231   4e-66   
ref|XP_002467246.1|  hypothetical protein SORBIDRAFT_01g021960          231   5e-66   Sorghum bicolor [broomcorn]
ref|XP_002870305.1|  hypothetical protein ARALYDRAFT_915409             230   7e-66   
gb|KFK39589.1|  hypothetical protein AALP_AA3G264000                    231   9e-66   Arabis alpina [alpine rockcress]
ref|XP_010435108.1|  PREDICTED: acylamino-acid-releasing enzyme         230   9e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010234727.1|  PREDICTED: acylamino-acid-releasing enzyme-like    229   3e-65   Brachypodium distachyon [annual false brome]
ref|XP_010680736.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    227   4e-65   
ref|XP_010680735.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    227   8e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009773641.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    226   2e-64   Nicotiana sylvestris
emb|CDY08304.1|  BnaA05g13150D                                          226   3e-64   Brassica napus [oilseed rape]
emb|CDY06476.1|  BnaC06g11680D                                          226   3e-64   
ref|XP_001786039.1|  predicted protein                                  225   4e-64   
ref|XP_006414693.1|  hypothetical protein EUTSA_v10024477mg             225   5e-64   
ref|XP_006285247.1|  hypothetical protein CARUB_v10006608mg             226   5e-64   Capsella rubella
ref|XP_006297056.1|  hypothetical protein CARUB_v10013057mg             224   5e-64   Capsella rubella
ref|XP_009144694.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    224   9e-64   Brassica rapa
ref|XP_009144692.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    224   9e-64   Brassica rapa
ref|XP_006279108.1|  hypothetical protein CARUB_v10012695mg             224   1e-63   
ref|XP_004983186.1|  PREDICTED: acylamino-acid-releasing enzyme-like    223   2e-63   Setaria italica
ref|NP_001147818.1|  LOC100281428                                       223   3e-63   Zea mays [maize]
ref|XP_008643608.1|  PREDICTED: LOC100281428 isoform X1                 223   3e-63   Zea mays [maize]
ref|XP_011467693.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    223   3e-63   Fragaria vesca subsp. vesca
ref|XP_008643614.1|  PREDICTED: LOC100281428 isoform X2                 223   3e-63   Zea mays [maize]
emb|CDY53734.1|  BnaA08g30180D                                          223   4e-63   Brassica napus [oilseed rape]
emb|CDY36882.1|  BnaC08g09650D                                          222   8e-63   Brassica napus [oilseed rape]
ref|XP_009107785.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    221   1e-62   Brassica rapa
ref|XP_009107786.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    221   2e-62   Brassica rapa
ref|XP_001767800.1|  predicted protein                                  221   2e-62   
ref|XP_004497999.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    221   2e-62   
ref|XP_002978109.1|  hypothetical protein SELMODRAFT_268154             219   6e-62   
ref|XP_002966633.1|  hypothetical protein SELMODRAFT_168303             219   7e-62   Selaginella moellendorffii
dbj|BAJ86841.1|  predicted protein                                      218   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009148621.1|  PREDICTED: acylamino-acid-releasing enzyme-like    213   8e-60   Brassica rapa
emb|CDY16282.1|  BnaC01g23170D                                          213   9e-60   Brassica napus [oilseed rape]
emb|CDY29743.1|  BnaA01g19230D                                          213   1e-59   Brassica napus [oilseed rape]
gb|EMS51145.1|  Acylamino-acid-releasing enzyme                         213   1e-59   Triticum urartu
tpg|DAA49965.1|  TPA: hypothetical protein ZEAMMB73_427246              186   3e-55   
ref|XP_007225868.1|  hypothetical protein PRUPE_ppa011753mg             185   6e-54   
ref|XP_008643616.1|  PREDICTED: LOC100281428 isoform X4                 197   7e-54   Zea mays [maize]
gb|EMT10968.1|  Acylamino-acid-releasing enzyme                         194   7e-53   
ref|XP_006297055.1|  hypothetical protein CARUB_v10013057mg             187   9e-51   
gb|KDO53934.1|  hypothetical protein CISIN_1g003363mg                   179   6e-49   Citrus sinensis [apfelsine]
ref|XP_008643615.1|  PREDICTED: LOC100281428 isoform X3                 177   8e-47   Zea mays [maize]
ref|XP_007034936.1|  Acylaminoacyl-peptidase-related isoform 3          172   5e-46   
ref|XP_007034937.1|  Acylaminoacyl-peptidase-related isoform 4          172   7e-46   
ref|XP_001700898.1|  acylaminoacyl-peptidase                            163   1e-41   Chlamydomonas reinhardtii
ref|XP_002506400.1|  predicted protein                                  147   7e-39   Micromonas commoda
gb|KCW57444.1|  hypothetical protein EUGRSUZ_H00222                     145   8e-39   Eucalyptus grandis [rose gum]
ref|XP_005645226.1|  alpha/beta-hydrolase                               154   1e-38   Coccomyxa subellipsoidea C-169
ref|XP_003063428.1|  predicted protein                                  152   1e-37   Micromonas pusilla CCMP1545
gb|KJB38267.1|  hypothetical protein B456_006G245500                    140   9e-37   Gossypium raimondii
ref|XP_001632627.1|  predicted protein                                  147   2e-36   Nematostella vectensis
ref|XP_002181396.1|  predicted protein                                  139   4e-36   Phaeodactylum tricornutum CCAP 1055/1
emb|CBJ49173.1|  conserved unknown protein                              145   2e-35   Ectocarpus siliculosus
ref|XP_002291357.1|  hypothetical protein THAPSDRAFT_262750             140   4e-35   Thalassiosira pseudonana CCMP1335
ref|XP_007034939.1|  Acylaminoacyl-peptidase-related isoform 6          135   5e-35   
ref|XP_002958853.1|  hypothetical protein VOLCADRAFT_100173             144   5e-35   Volvox carteri f. nagariensis
gb|ABQ22534.1|  acylamino acid-releasing enzyme-like protein            135   1e-34   Callithrix jacchus [common marmoset]
ref|XP_007034938.1|  Acylaminoacyl-peptidase-related isoform 5          134   2e-34   
gb|AAH34199.1|  Apeh protein                                            135   3e-34   Mus musculus [mouse]
gb|ABQ22787.1|  acylamino acid-releasing enzyme-like protein            134   3e-34   Callithrix jacchus [common marmoset]
gb|EJK69297.1|  hypothetical protein THAOC_09459                        141   5e-34   Thalassiosira oceanica
ref|XP_011668031.1|  PREDICTED: acylamino-acid-releasing enzyme i...    139   2e-33   Strongylocentrotus purpuratus [purple urchin]
ref|XP_007420713.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    138   3e-33   Python bivittatus
ref|XP_005730746.1|  PREDICTED: acylamino-acid-releasing enzyme-like    138   4e-33   Pundamilia nyererei
ref|XP_008569783.1|  PREDICTED: acylamino-acid-releasing enzyme         138   5e-33   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002111936.1|  hypothetical protein TRIADDRAFT_24080              136   6e-33   Trichoplax adhaerens
ref|XP_010588098.1|  PREDICTED: acylamino-acid-releasing enzyme i...    137   8e-33   Loxodonta africana [African bush elephant]
gb|AFW68758.1|  hypothetical protein ZEAMMB73_676318                    138   8e-33   
ref|XP_010588097.1|  PREDICTED: acylamino-acid-releasing enzyme i...    137   9e-33   Loxodonta africana [African bush elephant]
ref|XP_003409701.1|  PREDICTED: acylamino-acid-releasing enzyme i...    137   9e-33   Loxodonta africana [African bush elephant]
ref|XP_010588099.1|  PREDICTED: acylamino-acid-releasing enzyme i...    137   9e-33   Loxodonta africana [African bush elephant]
ref|XP_010091255.1|  hypothetical protein L484_010282                   127   1e-32   
ref|XP_010588096.1|  PREDICTED: acylamino-acid-releasing enzyme i...    137   1e-32   Loxodonta africana [African bush elephant]
ref|XP_006785463.1|  PREDICTED: acylamino-acid-releasing enzyme-like    137   1e-32   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005937909.1|  PREDICTED: acylamino-acid-releasing enzyme-like    137   1e-32   Haplochromis burtoni
ref|XP_004554076.1|  PREDICTED: acylamino-acid-releasing enzyme-like    137   1e-32   Maylandia zebra
ref|XP_011531963.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   1e-32   Homo sapiens [man]
ref|XP_003963327.2|  PREDICTED: acylamino-acid-releasing enzyme-like    137   1e-32   
ref|XP_004451929.1|  PREDICTED: acylamino-acid-releasing enzyme i...    136   2e-32   Dasypus novemcinctus
ref|XP_003444889.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    136   2e-32   Oreochromis niloticus
gb|EDL21267.1|  acylpeptide hydrolase, isoform CRA_b                    134   2e-32   Mus musculus [mouse]
ref|XP_008970507.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   2e-32   Pan paniscus [bonobo]
ref|XP_011620093.1|  PREDICTED: acylamino-acid-releasing enzyme         136   2e-32   
ref|XP_006511786.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   3e-32   Mus musculus [mouse]
ref|XP_005265155.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   3e-32   Homo sapiens [man]
ref|XP_005478404.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    136   3e-32   
ref|XP_004451927.1|  PREDICTED: acylamino-acid-releasing enzyme i...    136   3e-32   
gb|AAH26594.1|  Apeh protein                                            134   3e-32   Mus musculus [mouse]
ref|XP_011889121.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   3e-32   Cercocebus atys
ref|XP_009049577.1|  hypothetical protein LOTGIDRAFT_201138             135   3e-32   Lottia gigantea
ref|XP_005265154.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Homo sapiens [man]
ref|XP_004715221.1|  PREDICTED: acylamino-acid-releasing enzyme         135   4e-32   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010770546.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   4e-32   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003894462.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Papio anubis [baboon]
ref|XP_004034203.1|  PREDICTED: acylamino-acid-releasing enzyme         135   4e-32   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_011836281.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Mandrillus leucophaeus
ref|XP_011889120.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Cercocebus atys
ref|XP_011794461.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Colobus angolensis palliatus
ref|XP_010367973.1|  PREDICTED: acylamino-acid-releasing enzyme         135   4e-32   Rhinopithecus roxellana
ref|NP_001248664.1|  acylamino-acid-releasing enzyme                    135   4e-32   Macaca mulatta [rhesus macaque]
ref|XP_001165665.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   4e-32   Pan troglodytes
gb|AAF37321.1|AF141383_1  oxidized protein hydrolase                    135   5e-32   Homo sapiens [man]
ref|XP_005410263.1|  PREDICTED: acylamino-acid-releasing enzyme         135   5e-32   Chinchilla lanigera
ref|NP_001631.3|  acylamino-acid-releasing enzyme                       135   5e-32   Homo sapiens [man]
ref|XP_003257122.1|  PREDICTED: acylamino-acid-releasing enzyme         135   5e-32   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_002813789.1|  PREDICTED: acylamino-acid-releasing enzyme         135   5e-32   
ref|XP_008061380.1|  PREDICTED: acylamino-acid-releasing enzyme         135   5e-32   
ref|XP_002936520.1|  PREDICTED: acylamino-acid-releasing enzyme         135   5e-32   Xenopus tropicalis [western clawed frog]
dbj|BAA07476.1|  acylamino acid-releasing enzyme                        135   5e-32   Homo sapiens [man]
ref|XP_008153804.1|  PREDICTED: acylamino-acid-releasing enzyme         135   6e-32   Eptesicus fuscus
gb|EHH62250.1|  hypothetical protein EGM_20501                          135   6e-32   Macaca fascicularis [crab eating macaque]
ref|XP_002611296.1|  hypothetical protein BRAFLDRAFT_210907             135   7e-32   Branchiostoma floridae
gb|EDL21269.1|  acylpeptide hydrolase, isoform CRA_d                    135   7e-32   Mus musculus [mouse]
ref|XP_004581523.1|  PREDICTED: acylamino-acid-releasing enzyme         135   7e-32   Ochotona princeps [southern American pika]
gb|AAH25494.1|  Acylpeptide hydrolase                                   134   7e-32   Mus musculus [mouse]
ref|XP_005347945.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   8e-32   
ref|XP_004625158.1|  PREDICTED: acylamino-acid-releasing enzyme         134   8e-32   Octodon degus
ref|XP_011531961.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   8e-32   
gb|EHH16361.1|  hypothetical protein EGK_11632                          135   8e-32   Macaca mulatta [rhesus macaque]
ref|XP_004664297.1|  PREDICTED: acylamino-acid-releasing enzyme         134   8e-32   Jaculus jaculus
ref|NP_036632.1|  acylamino-acid-releasing enzyme                       134   8e-32   Rattus norvegicus [brown rat]
gb|EDL77191.1|  acylpeptide hydrolase, isoform CRA_a                    134   8e-32   Rattus norvegicus [brown rat]
ref|XP_003476500.1|  PREDICTED: acylamino-acid-releasing enzyme         134   8e-32   Cavia porcellus [guinea pig]
ref|NP_666338.2|  acylamino-acid-releasing enzyme                       134   9e-32   Mus musculus [mouse]
ref|XP_008422058.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   9e-32   Poecilia reticulata
ref|XP_010850157.1|  PREDICTED: acylamino-acid-releasing enzyme         134   9e-32   Bison bison bison
ref|XP_007953537.1|  PREDICTED: acylamino-acid-releasing enzyme         134   9e-32   Orycteropus afer afer
ref|XP_011531960.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   9e-32   Homo sapiens [man]
ref|XP_008422057.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   Poecilia reticulata
ref|XP_005347944.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   Microtus ochrogaster [prairie voles]
ref|XP_010345463.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Saimiri boliviensis boliviensis
ref|XP_008764698.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   
ref|XP_002758397.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Callithrix jacchus [common marmoset]
ref|XP_007982436.1|  PREDICTED: acylamino-acid-releasing enzyme         135   1e-31   Chlorocebus sabaeus
ref|XP_009443780.1|  PREDICTED: acylamino-acid-releasing enzyme i...    135   1e-31   
ref|XP_006873660.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Chrysochloris asiatica
ref|XP_010795012.1|  PREDICTED: acylamino-acid-releasing enzyme-like    131   1e-31   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008851394.1|  PREDICTED: acylamino-acid-releasing enzyme i...    133   1e-31   
emb|CDQ87236.1|  unnamed protein product                                134   1e-31   Oncorhynchus mykiss
ref|XP_002713238.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003800641.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Otolemur garnettii
ref|XP_003500396.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Cricetulus griseus [Chinese hamsters]
ref|XP_011531959.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   
ref|XP_007577878.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Poecilia formosa
ref|XP_008970506.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   
ref|XP_011531958.1|  PREDICTED: acylamino-acid-releasing enzyme i...    134   1e-31   
ref|XP_005074976.1|  PREDICTED: acylamino-acid-releasing enzyme         134   1e-31   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005222857.1|  PREDICTED: acylamino-acid-releasing enzyme i...    133   1e-31   Bos taurus [bovine]
ref|XP_005111786.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    132   2e-31   
ref|XP_011373731.1|  PREDICTED: acylamino-acid-releasing enzyme         133   2e-31   Pteropus vampyrus
ref|XP_004419764.1|  PREDICTED: acylamino-acid-releasing enzyme         133   2e-31   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004368593.1|  PREDICTED: acylamino-acid-releasing enzyme         133   2e-31   Trichechus manatus latirostris
ref|XP_004995752.1|  hypothetical protein PTSG_03166                    133   2e-31   Salpingoeca rosetta
ref|XP_010816012.1|  PREDICTED: acylamino-acid-releasing enzyme i...    133   2e-31   
ref|XP_005800228.1|  PREDICTED: acylamino-acid-releasing enzyme-like    133   3e-31   
ref|XP_011955447.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   3e-31   
ref|XP_005326983.1|  PREDICTED: acylamino-acid-releasing enzyme         133   3e-31   
ref|XP_005172559.1|  PREDICTED: acylamino-acid-releasing enzyme-like    126   3e-31   
ref|XP_006785770.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    133   3e-31   
ref|NP_001076900.1|  acylamino-acid-releasing enzyme                    133   3e-31   
ref|XP_006744597.1|  PREDICTED: acylamino-acid-releasing enzyme         133   3e-31   
ref|XP_006785769.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    133   3e-31   
ref|XP_006053336.1|  PREDICTED: acylamino-acid-releasing enzyme         133   3e-31   
ref|XP_005892155.1|  PREDICTED: acylamino-acid-releasing enzyme         133   3e-31   
ref|XP_005669617.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   3e-31   
ref|XP_009679069.1|  PREDICTED: acylamino-acid-releasing enzyme-like    132   3e-31   
ref|XP_006892964.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   4e-31   
gb|ELR58966.1|  Acylamino-acid-releasing enzyme                         132   4e-31   
ref|NP_001025756.1|  acylamino-acid-releasing enzyme                    132   4e-31   
ref|XP_008851392.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   4e-31   
ref|XP_006892965.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   4e-31   
ref|XP_007168788.1|  PREDICTED: acylamino-acid-releasing enzyme         132   4e-31   
ref|XP_007527315.1|  PREDICTED: acylamino-acid-releasing enzyme         132   4e-31   
ref|XP_006909161.1|  PREDICTED: acylamino-acid-releasing enzyme         132   4e-31   
ref|XP_005696163.1|  PREDICTED: acylamino-acid-releasing enzyme         132   4e-31   
ref|XP_002920586.1|  PREDICTED: acylamino-acid-releasing enzyme         132   5e-31   
ref|XP_004018506.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   5e-31   
ref|XP_007888659.1|  PREDICTED: acylamino-acid-releasing enzyme         132   5e-31   
gb|EFB13927.1|  hypothetical protein PANDA_009344                       132   5e-31   
ref|XP_005914685.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    132   5e-31   
ref|XP_004558946.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    132   5e-31   
ref|XP_004558945.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    132   5e-31   
ref|XP_005969402.1|  PREDICTED: acylamino-acid-releasing enzyme         132   5e-31   
ref|XP_004760696.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   6e-31   
ref|XP_004615301.1|  PREDICTED: acylamino-acid-releasing enzyme         132   6e-31   
ref|XP_005914686.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    132   6e-31   
ref|XP_010613863.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   6e-31   
ref|XP_003361437.1|  PREDICTED: acylamino-acid-releasing enzyme-like    132   6e-31   
ref|XP_008497252.1|  PREDICTED: acylamino-acid-releasing enzyme-like    132   6e-31   
gb|KFP04839.1|  Acylamino-acid-releasing enzyme                         132   6e-31   
ref|XP_007129913.1|  PREDICTED: acylamino-acid-releasing enzyme         132   6e-31   
ref|XP_533826.2|  PREDICTED: acylamino-acid-releasing enzyme isof...    132   6e-31   
ref|XP_007446273.1|  PREDICTED: acylamino-acid-releasing enzyme         132   6e-31   
ref|XP_008522204.1|  PREDICTED: acylamino-acid-releasing enzyme         132   7e-31   
ref|XP_001497560.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   7e-31   
gb|AAB36056.1|  acylamino acid-releasing enzyme, AARE {EC 3.4.19.1}     132   7e-31   
ref|NP_999088.1|  acylamino-acid-releasing enzyme                       132   7e-31   
ref|XP_004820135.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   7e-31   
ref|XP_005600718.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   7e-31   
ref|XP_010740543.1|  PREDICTED: acylamino-acid-releasing enzyme         132   7e-31   
ref|XP_010613862.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   7e-31   
ref|XP_005632596.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   8e-31   
ref|XP_010613860.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   8e-31   
ref|XP_010976698.1|  PREDICTED: acylamino-acid-releasing enzyme         132   8e-31   
ref|XP_006174179.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   8e-31   
ref|XP_004760693.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   9e-31   
ref|XP_006196369.1|  PREDICTED: acylamino-acid-releasing enzyme         132   9e-31   
ref|XP_006978393.1|  PREDICTED: acylamino-acid-releasing enzyme i...    132   9e-31   
ref|XP_004676216.1|  PREDICTED: acylamino-acid-releasing enzyme         131   9e-31   
ref|XP_006025072.1|  PREDICTED: acylamino-acid-releasing enzyme         131   9e-31   
ref|XP_010716655.1|  PREDICTED: acylamino-acid-releasing enzyme         132   1e-30   
ref|XP_010967478.1|  PREDICTED: acylamino-acid-releasing enzyme i...    131   1e-30   
emb|CAF93359.1|  unnamed protein product                                130   1e-30   
ref|XP_006263827.1|  PREDICTED: acylamino-acid-releasing enzyme         131   1e-30   
ref|XP_005732521.1|  PREDICTED: acylamino-acid-releasing enzyme-like    131   1e-30   
ref|XP_003982279.1|  PREDICTED: acylamino-acid-releasing enzyme         131   1e-30   
ref|XP_009089477.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    131   1e-30   
ref|XP_007661263.1|  PREDICTED: acylamino-acid-releasing enzyme         130   1e-30   
ref|XP_007088761.1|  PREDICTED: acylamino-acid-releasing enzyme         130   1e-30   
ref|XP_004284001.1|  PREDICTED: acylamino-acid-releasing enzyme         130   2e-30   
ref|XP_004399303.1|  PREDICTED: acylamino-acid-releasing enzyme         130   2e-30   
gb|ERE75630.1|  protein bassoon                                         132   2e-30   
gb|ERE75631.1|  protein bassoon                                         132   2e-30   
gb|ERE75629.1|  protein bassoon                                         132   3e-30   
ref|XP_002190584.2|  PREDICTED: acylamino-acid-releasing enzyme-like    129   3e-30   
gb|KIY91224.1|  hypothetical protein MNEG_16740                         121   3e-30   
gb|EHB14810.1|  Acylamino-acid-releasing enzyme                         130   3e-30   
ref|XP_005522348.1|  PREDICTED: acylamino-acid-releasing enzyme-like    130   3e-30   
ref|XP_004903548.1|  PREDICTED: acylamino-acid-releasing enzyme         130   3e-30   
gb|ELU02553.1|  hypothetical protein CAPTEDRAFT_154305                  130   3e-30   
ref|XP_008304137.1|  PREDICTED: acylamino-acid-releasing enzyme-like    129   4e-30   
ref|XP_006171014.1|  PREDICTED: acylamino-acid-releasing enzyme         129   5e-30   
ref|XP_008922123.1|  PREDICTED: acylamino-acid-releasing enzyme-like    129   5e-30   
ref|XP_010894150.1|  PREDICTED: acylamino-acid-releasing enzyme i...    128   5e-30   
ref|XP_003885957.1|  Peptidase, S9A/B/C family, catalytic domain ...    130   6e-30   
ref|XP_005478039.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    129   6e-30   
ref|XP_005478040.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    129   6e-30   
ref|XP_007237055.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    129   7e-30   
ref|XP_007237054.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    129   7e-30   
ref|XP_005821030.1|  hypothetical protein GUITHDRAFT_119792             129   8e-30   
ref|XP_010745092.1|  PREDICTED: acylamino-acid-releasing enzyme-like    129   9e-30   
ref|XP_011475471.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    129   9e-30   
ref|XP_010894149.1|  PREDICTED: acylamino-acid-releasing enzyme i...    128   1e-29   
gb|KFO18589.1|  Protein bassoon                                         130   1e-29   
ref|XP_009644081.1|  PREDICTED: acylamino-acid-releasing enzyme-like    128   1e-29   
gb|KFP10009.1|  Acylamino-acid-releasing enzyme                         128   1e-29   
ref|XP_002121171.1|  PREDICTED: acylamino-acid-releasing enzyme-like    128   1e-29   
emb|CDQ86626.1|  unnamed protein product                                128   1e-29   
ref|XP_005229997.1|  PREDICTED: acylamino-acid-releasing enzyme-like    128   2e-29   
gb|EKC27323.1|  Acylamino-acid-releasing enzyme                         127   2e-29   
ref|XP_010559921.1|  PREDICTED: acylamino-acid-releasing enzyme-like    128   2e-29   
ref|XP_011428927.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    126   2e-29   
ref|XP_005279717.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    128   2e-29   
ref|XP_011428926.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    126   2e-29   
ref|XP_007239567.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   2e-29   
ref|XP_006120793.1|  PREDICTED: acylamino-acid-releasing enzyme         127   2e-29   
gb|EKC29067.1|  Acylamino-acid-releasing enzyme                         126   2e-29   
ref|XP_005052973.1|  PREDICTED: acylamino-acid-releasing enzyme         127   2e-29   
ref|XP_011668030.1|  PREDICTED: acylamino-acid-releasing enzyme         124   2e-29   
ref|XP_011412139.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    127   3e-29   
ref|XP_011412141.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    127   3e-29   
ref|XP_005485658.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   3e-29   
ref|XP_006003443.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   3e-29   
ref|XP_003762340.1|  PREDICTED: acylamino-acid-releasing enzyme         127   4e-29   
ref|XP_008883739.1|  acylaminoacyl-peptidase, putative                  127   4e-29   
ref|XP_003217604.1|  PREDICTED: acylamino-acid-releasing enzyme i...    127   4e-29   
ref|XP_008293423.1|  PREDICTED: acylamino-acid-releasing enzyme i...    127   4e-29   
ref|XP_008293424.1|  PREDICTED: acylamino-acid-releasing enzyme i...    127   4e-29   
ref|XP_005422543.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   4e-29   
ref|XP_008293422.1|  PREDICTED: acylamino-acid-releasing enzyme i...    127   4e-29   
ref|XP_011593653.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   4e-29   
ref|XP_005444509.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   5e-29   
ref|XP_008630505.1|  PREDICTED: protein bassoon-like                    128   5e-29   
dbj|BAM18313.1|  unknown unsecreted protein                             120   6e-29   
ref|XP_006631208.1|  PREDICTED: acylamino-acid-releasing enzyme-like    127   7e-29   
ref|XP_010388621.1|  PREDICTED: protein bassoon                         127   8e-29   
ref|XP_009475110.1|  PREDICTED: acylamino-acid-releasing enzyme-like    125   9e-29   
ref|XP_010874219.1|  PREDICTED: acylamino-acid-releasing enzyme-like    126   9e-29   
ref|XP_009905940.1|  PREDICTED: acylamino-acid-releasing enzyme-like    125   9e-29   
ref|XP_008412064.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    125   9e-29   
gb|KFV73803.1|  Acylamino-acid-releasing enzyme                         125   9e-29   
ref|XP_008412063.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    126   9e-29   
ref|XP_005811291.1|  PREDICTED: acylamino-acid-releasing enzyme-like    125   1e-28   
gb|KFG48037.1|  putative acylaminoacyl-peptidase                        125   1e-28   
gb|KFG64553.1|  putative acylaminoacyl-peptidase                        125   1e-28   
ref|XP_011475146.1|  PREDICTED: acylamino-acid-releasing enzyme i...    125   1e-28   
gb|EPR63621.1|  putative acylaminoacyl-peptidase                        126   1e-28   
gb|KFG53961.1|  putative acylaminoacyl-peptidase                        125   1e-28   
ref|XP_011475145.1|  PREDICTED: acylamino-acid-releasing enzyme i...    125   1e-28   
gb|KFH16154.1|  putative acylaminoacyl-peptidase                        126   1e-28   
ref|XP_002367067.1|  acylamino-acid-releasing enzyme, putative          126   1e-28   
gb|KFH12394.1|  putative acylaminoacyl-peptidase                        125   1e-28   
gb|EMP27807.1|  Acylamino-acid-releasing enzyme                         125   1e-28   
ref|XP_005167120.1|  PREDICTED: acylamino-acid-releasing enzyme i...    125   1e-28   
ref|XP_007068354.1|  PREDICTED: acylamino-acid-releasing enzyme         125   1e-28   
gb|ELV09643.1|  Protein bassoon                                         127   2e-28   
emb|CDI81805.1|  acylamino-acid-releasing enzyme, putative              125   2e-28   
ref|NP_001035437.1|  acylamino-acid-releasing enzyme                    125   2e-28   
gb|KIH54392.1|  hypothetical protein ANCDUO_15463                       117   2e-28   
ref|XP_003740299.1|  PREDICTED: acylamino-acid-releasing enzyme-like    122   2e-28   
ref|XP_005512450.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    124   3e-28   
ref|XP_011836280.1|  PREDICTED: acylamino-acid-releasing enzyme i...    124   3e-28   
ref|XP_009199023.1|  PREDICTED: acylamino-acid-releasing enzyme i...    124   3e-28   
ref|XP_007541134.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    124   3e-28   
ref|NP_942570.1|  acylamino-acid-releasing enzyme                       124   3e-28   
ref|XP_007541132.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    124   3e-28   
ref|XP_011794460.1|  PREDICTED: acylamino-acid-releasing enzyme i...    124   3e-28   
ref|XP_001378111.1|  PREDICTED: acylamino-acid-releasing enzyme         124   3e-28   
ref|XP_005167119.2|  PREDICTED: acylamino-acid-releasing enzyme i...    125   3e-28   
emb|CAG07332.1|  unnamed protein product                                124   4e-28   
gb|AAH48895.2|  Acylpeptide hydrolase                                   124   5e-28   
gb|AIX09831.1|  N-acylaminoacyl-peptide hydrolase                       124   5e-28   
ref|XP_008316496.1|  PREDICTED: acylamino-acid-releasing enzyme-like    124   5e-28   
gb|AIX09832.1|  N-acylaminoacyl-peptide hydrolase                       123   6e-28   
ref|XP_009302626.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    122   7e-28   
ref|XP_005111787.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    121   7e-28   
gb|AHB23291.1|  N-acylaminoacyl-peptide hydrolase                       123   8e-28   
ref|XP_004921997.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    123   9e-28   
ref|XP_001944079.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    122   2e-27   
ref|XP_008316948.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    121   3e-27   
ref|XP_009279560.1|  PREDICTED: protein bassoon-like                    123   3e-27   
gb|ETE73342.1|  Acylamino-acid-releasing enzyme                         121   7e-27   
gb|KFD46259.1|  hypothetical protein M513_12877                         121   7e-27   
emb|CDJ87230.1|  Peptidase S9 domain containing protein                 118   8e-27   
ref|XP_011557751.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    119   8e-27   
ref|XP_009995259.1|  PREDICTED: acylamino-acid-releasing enzyme         120   9e-27   
ref|XP_011557750.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    120   1e-26   
ref|XP_011557746.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    119   1e-26   
ref|XP_003746631.1|  PREDICTED: acylamino-acid-releasing enzyme-like    120   1e-26   
ref|XP_008187007.1|  PREDICTED: acylamino-acid-releasing enzyme-like    117   1e-26   
gb|AHB23290.1|  N-acylaminoacyl-peptide hydrolase                       119   1e-26   
gb|ETN69231.1|  peptidase, S9A/B/C family, catalytic domain protein     115   1e-26   
ref|WP_028833326.1|  hypothetical protein                               119   1e-26   
ref|XP_011141861.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    119   2e-26   
emb|CAA33040.1|  acyl-peptide hydrolase                                 119   2e-26   
ref|XP_011339163.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    119   2e-26   
gb|KHN84987.1|  Acylamino-acid-releasing enzyme                         119   3e-26   
ref|XP_001943383.1|  PREDICTED: acylamino-acid-releasing enzyme-like    118   3e-26   
ref|XP_006003447.1|  PREDICTED: acylamino-acid-releasing enzyme-like    117   4e-26   
gb|EAW64997.1|  N-acylaminoacyl-peptide hydrolase, isoform CRA_c        117   4e-26   
emb|CDJ87904.1|  Peptidase S9 domain containing protein                 119   4e-26   
ref|XP_008702002.1|  PREDICTED: LOW QUALITY PROTEIN: acylamino-ac...    117   5e-26   
gb|KFD67538.1|  hypothetical protein M514_12877                         117   6e-26   
emb|CBY13899.1|  unnamed protein product                                115   9e-26   
ref|XP_970931.1|  PREDICTED: acylamino-acid-releasing enzyme            117   9e-26   
ref|XP_004760694.1|  PREDICTED: acylamino-acid-releasing enzyme i...    117   1e-25   
emb|CDW56712.1|  Peptidase S9 domain containing protein                 116   1e-25   
ref|XP_004760695.1|  PREDICTED: acylamino-acid-releasing enzyme i...    117   1e-25   
gb|EMC83978.1|  Acylamino-acid-releasing enzyme                         115   1e-25   
ref|XP_002670276.1|  predicted protein                                  117   1e-25   
ref|XP_004760690.1|  PREDICTED: acylamino-acid-releasing enzyme i...    117   1e-25   
ref|XP_008103242.1|  PREDICTED: acylamino-acid-releasing enzyme-like    117   1e-25   
ref|XP_004760689.1|  PREDICTED: acylamino-acid-releasing enzyme i...    117   1e-25   
ref|XP_008851393.1|  PREDICTED: acylamino-acid-releasing enzyme i...    116   1e-25   
ref|XP_004760691.1|  PREDICTED: acylamino-acid-releasing enzyme i...    117   2e-25   
dbj|GAM25796.1|  hypothetical protein SAMD00019534_089710               116   2e-25   
ref|XP_002166996.2|  PREDICTED: acylamino-acid-releasing enzyme-like    116   2e-25   
gb|KHN87661.1|  Acylamino-acid-releasing enzyme                         116   2e-25   
gb|KFU89090.1|  Acylamino-acid-releasing enzyme                         115   3e-25   
emb|CDH93070.1|  DPF-5, isoform b                                       115   3e-25   
ref|XP_011593758.1|  PREDICTED: acylamino-acid-releasing enzyme         115   3e-25   
pir||T33751  hypothetical protein R11E3.8 - Caenorhabditis elegans      115   6e-25
gb|EJW85550.1|  hypothetical protein WUBG_03538                         113   6e-25   
ref|NP_500647.2|  Protein DPF-5                                         115   6e-25   
ref|XP_003247213.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    114   7e-25   
ref|XP_009026061.1|  hypothetical protein HELRODRAFT_193470             112   7e-25   
ref|XP_003293639.1|  hypothetical protein DICPUDRAFT_51071              114   8e-25   
emb|CAP30773.2|  Protein CBR-DPF-5                                      114   9e-25   
ref|XP_002632759.1|  C. briggsae CBR-DPF-5 protein                      114   1e-24   
gb|EGT42991.1|  CBN-DPF-5 protein                                       114   1e-24   
gb|EGT41838.1|  hypothetical protein CAEBREN_22629                      114   1e-24   
ref|XP_003140830.1|  hypothetical protein LOAG_05245                    112   1e-24   
ref|XP_011701690.1|  PREDICTED: acylamino-acid-releasing enzyme-l...    114   1e-24   
ref|XP_008178814.1|  PREDICTED: acylamino-acid-releasing enzyme-like    109   1e-24   
gb|EYB98767.1|  hypothetical protein Y032_0128g1432                     114   1e-24   
ref|XP_002411708.1|  acylamino-acid-releasing enzyme, putative          113   2e-24   
gb|EYB98768.1|  hypothetical protein Y032_0128g1432                     114   2e-24   



>ref|XP_009631294.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Nicotiana 
tomentosiformis]
Length=783

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG  SFTEA S
Sbjct  637  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGDEGKSSFTEATS  696

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL +FY KSPI+H+SKV+TPTL+LLGAKDLRVP+STGLQYARALKEKGVEVKVI FPE
Sbjct  697  VEHLESFYRKSPISHVSKVRTPTLVLLGAKDLRVPMSTGLQYARALKEKGVEVKVIVFPE  756

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKKYC
Sbjct  757  DTHAIDRPQSDFESFLNIGVWFKKYC  782



>ref|XP_009631293.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Nicotiana 
tomentosiformis]
Length=806

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG  SFTEA S
Sbjct  660  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGDEGKSSFTEATS  719

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL +FY KSPI+H+SKV+TPTL+LLGAKDLRVP+STGLQYARALKEKGVEVKVI FPE
Sbjct  720  VEHLESFYRKSPISHVSKVRTPTLVLLGAKDLRVPMSTGLQYARALKEKGVEVKVIVFPE  779

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKKYC
Sbjct  780  DTHAIDRPQSDFESFLNIGVWFKKYC  805



>ref|XP_009774162.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Nicotiana 
sylvestris]
Length=770

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG   FTEA S
Sbjct  624  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGDEGKSIFTEATS  683

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL AFY KSPI+H+SKVKTPTL+LLGAKDLRVP+STGLQYARALKEKGVEVKVI FPE
Sbjct  684  VEHLDAFYRKSPISHVSKVKTPTLVLLGAKDLRVPMSTGLQYARALKEKGVEVKVIVFPE  743

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKKYC
Sbjct  744  DTHAIDRPQSDFESFLNIGVWFKKYC  769



>ref|XP_009631292.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Nicotiana 
tomentosiformis]
Length=807

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG  SFTEA S
Sbjct  661  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGDEGKSSFTEATS  720

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL +FY KSPI+H+SKV+TPTL+LLGAKDLRVP+STGLQYARALKEKGVEVKVI FPE
Sbjct  721  VEHLESFYRKSPISHVSKVRTPTLVLLGAKDLRVPMSTGLQYARALKEKGVEVKVIVFPE  780

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKKYC
Sbjct  781  DTHAIDRPQSDFESFLNIGVWFKKYC  806



>ref|XP_009774163.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Nicotiana 
sylvestris]
Length=769

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG   FTEA S
Sbjct  623  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGDEGKSIFTEATS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL AFY KSPI+H+SKVKTPTL+LLGAKDLRVP+STGLQYARALKEKGVEVKVI FPE
Sbjct  683  VEHLDAFYRKSPISHVSKVKTPTLVLLGAKDLRVPMSTGLQYARALKEKGVEVKVIVFPE  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKKYC
Sbjct  743  DTHAIDRPQSDFESFLNIGVWFKKYC  768



>gb|KHN10097.1| Acylamino-acid-releasing enzyme [Glycine soja]
Length=826

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWCYVET+G++G   FTEAPS
Sbjct  680  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGRDKFTEAPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARAL+EKGV+VKVI FP 
Sbjct  740  AEDLTLFYSKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALREKGVQVKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFES+LNI +WF KYC
Sbjct  800  DVHGIERPQSDFESYLNIAMWFNKYC  825



>ref|XP_008796065.1| PREDICTED: LOW QUALITY PROTEIN: acylamino-acid-releasing enzyme 
[Phoenix dactylifera]
Length=782

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F  AA RNPVCNL+LM+GTTDIPDWCYVE FGS+G   F+EAPS
Sbjct  636  HGGFLTTHLIGQAPDRFVVAAVRNPVCNLSLMLGTTDIPDWCYVEAFGSDGKSYFSEAPS  695

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E+L+ FYSKSPIAHISKVKTP L LLGA+DLRVPVS GLQYAR L+EKGVEVKVI FPE
Sbjct  696  AEYLSLFYSKSPIAHISKVKTPVLFLLGAQDLRVPVSNGLQYARTLREKGVEVKVIVFPE  755

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIGVWFKKYC
Sbjct  756  DVHGIERPQSDFESFLNIGVWFKKYC  781



>ref|XP_006420083.1| hypothetical protein CICLE_v10004325mg [Citrus clementina]
 gb|ESR33323.1| hypothetical protein CICLE_v10004325mg [Citrus clementina]
Length=771

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  625  HGGFLTTHLIGQAPDKFVAAAARNPVCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  684

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  685  VEDLTHFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  744

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  745  DVHGIERPQSDFESFLNIGLWFKKYC  770



>gb|KDO53937.1| hypothetical protein CISIN_1g003363mg [Citrus sinensis]
Length=715

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNP+CNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  569  HGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  628

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  629  VEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  688

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  689  DVHGIERPQSDFESFLNIGLWFKKYC  714



>gb|KDO53935.1| hypothetical protein CISIN_1g003363mg [Citrus sinensis]
 gb|KDO53936.1| hypothetical protein CISIN_1g003363mg [Citrus sinensis]
Length=771

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNP+CNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  625  HGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  684

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  685  VEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  744

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  745  DVHGIERPQSDFESFLNIGLWFKKYC  770



>ref|XP_010069182.1| PREDICTED: acylamino-acid-releasing enzyme isoform X4 [Eucalyptus 
grandis]
Length=755

 Score =   265 bits (677),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL LMVGTTDIPDWCYVE+FGSEG   FTEAPS
Sbjct  609  HGGFLTTHLIGQAPDKFIAAATRNPVCNLGLMVGTTDIPDWCYVESFGSEGKNHFTEAPS  668

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL+ FYSKSPI+H+ KVKTPTL LL AKDLRVP S GLQYARAL+EKGVE KVI FP 
Sbjct  669  AEHLSLFYSKSPISHLHKVKTPTLFLLSAKDLRVPFSNGLQYARALREKGVEHKVIVFPH  728

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIGVWFKKYC
Sbjct  729  DVHGIDRPQSDFESFLNIGVWFKKYC  754



>ref|XP_010069181.1| PREDICTED: acylamino-acid-releasing enzyme isoform X3 [Eucalyptus 
grandis]
Length=772

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL LMVGTTDIPDWCYVE+FGSEG   FTEAPS
Sbjct  626  HGGFLTTHLIGQAPDKFIAAATRNPVCNLGLMVGTTDIPDWCYVESFGSEGKNHFTEAPS  685

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL+ FYSKSPI+H+ KVKTPTL LL AKDLRVP S GLQYARAL+EKGVE KVI FP 
Sbjct  686  AEHLSLFYSKSPISHLHKVKTPTLFLLSAKDLRVPFSNGLQYARALREKGVEHKVIVFPH  745

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIGVWFKKYC
Sbjct  746  DVHGIDRPQSDFESFLNIGVWFKKYC  771



>ref|XP_006420084.1| hypothetical protein CICLE_v10004325mg [Citrus clementina]
 gb|ESR33324.1| hypothetical protein CICLE_v10004325mg [Citrus clementina]
Length=826

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  680  HGGFLTTHLIGQAPDKFVAAAARNPVCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  740  VEDLTHFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  800  DVHGIERPQSDFESFLNIGLWFKKYC  825



>ref|XP_010069180.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Eucalyptus 
grandis]
Length=779

 Score =   265 bits (678),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL LMVGTTDIPDWCYVE+FGSEG   FTEAPS
Sbjct  633  HGGFLTTHLIGQAPDKFIAAATRNPVCNLGLMVGTTDIPDWCYVESFGSEGKNHFTEAPS  692

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL+ FYSKSPI+H+ KVKTPTL LL AKDLRVP S GLQYARAL+EKGVE KVI FP 
Sbjct  693  AEHLSLFYSKSPISHLHKVKTPTLFLLSAKDLRVPFSNGLQYARALREKGVEHKVIVFPH  752

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIGVWFKKYC
Sbjct  753  DVHGIDRPQSDFESFLNIGVWFKKYC  778



>ref|XP_006356049.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
tuberosum]
Length=770

 Score =   265 bits (677),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG  +FTEA S
Sbjct  623  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGEEGKTNFTEATS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEK-GVEVKVISFP  397
            SEHL AFY KSPI H+SKV+TPTL LLGAKDLRVP+STGLQYARALKEK GVEVKVI FP
Sbjct  683  SEHLDAFYRKSPILHVSKVRTPTLFLLGAKDLRVPMSTGLQYARALKEKGGVEVKVIMFP  742

Query  396  EDVHGIERPQSDFESFLNIGVWFKKYC  316
            ED H ++RPQSDFESFLNIGVWFKKYC
Sbjct  743  EDTHALDRPQSDFESFLNIGVWFKKYC  769



>gb|KDO53933.1| hypothetical protein CISIN_1g003363mg [Citrus sinensis]
Length=826

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNP+CNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  680  HGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  740  VEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  800  DVHGIERPQSDFESFLNIGLWFKKYC  825



>ref|XP_010069179.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Eucalyptus 
grandis]
 gb|KCW57443.1| hypothetical protein EUGRSUZ_H00222 [Eucalyptus grandis]
Length=825

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL LMVGTTDIPDWCYVE+FGSEG   FTEAPS
Sbjct  679  HGGFLTTHLIGQAPDKFIAAATRNPVCNLGLMVGTTDIPDWCYVESFGSEGKNHFTEAPS  738

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL+ FYSKSPI+H+ KVKTPTL LL AKDLRVP S GLQYARAL+EKGVE KVI FP 
Sbjct  739  AEHLSLFYSKSPISHLHKVKTPTLFLLSAKDLRVPFSNGLQYARALREKGVEHKVIVFPH  798

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIGVWFKKYC
Sbjct  799  DVHGIDRPQSDFESFLNIGVWFKKYC  824



>ref|XP_006489494.1| PREDICTED: acylamino-acid-releasing enzyme-like [Citrus sinensis]
Length=826

 Score =   265 bits (678),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNP+CNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  680  HGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQYARAL+EKGVE KVI FP 
Sbjct  740  VEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQYARALREKGVETKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIG+WFKKYC
Sbjct  800  DVHGIERPQSDFESFLNIGLWFKKYC  825



>ref|XP_006356048.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
tuberosum]
Length=829

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 133/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG EG  +FTEA S
Sbjct  682  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGEEGKTNFTEATS  741

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEK-GVEVKVISFP  397
            SEHL AFY KSPI H+SKV+TPTL LLGAKDLRVP+STGLQYARALKEK GVEVKVI FP
Sbjct  742  SEHLDAFYRKSPILHVSKVRTPTLFLLGAKDLRVPMSTGLQYARALKEKGGVEVKVIMFP  801

Query  396  EDVHGIERPQSDFESFLNIGVWFKKYC  316
            ED H ++RPQSDFESFLNIGVWFKKYC
Sbjct  802  EDTHALDRPQSDFESFLNIGVWFKKYC  828



>ref|XP_006588524.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Glycine 
max]
Length=827

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWCYVET+G++G   FTEAPS
Sbjct  681  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGRDKFTEAPS  740

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARAL+EKG +VKVI FP 
Sbjct  741  AEDLTLFYSKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALREKGGQVKVIVFPN  800

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFES+LNI +WF KYC
Sbjct  801  DVHGIERPQSDFESYLNIAMWFNKYC  826



>ref|XP_003536827.2| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Glycine 
max]
Length=826

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWCYVET+G++G   FTEAPS
Sbjct  680  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGRDKFTEAPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARAL+EKG +VKVI FP 
Sbjct  740  AEDLTLFYSKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALREKGGQVKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFES+LNI +WF KYC
Sbjct  800  DVHGIERPQSDFESYLNIAMWFNKYC  825



>gb|KJB38264.1| hypothetical protein B456_006G245500 [Gossypium raimondii]
Length=573

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL+ MV TTDIPDWCYVE++GS+G   FTEAPS
Sbjct  427  HGGFLTTHLIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPS  486

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  FYSKSPI HISKVK PT+ LLGA+DLRVPVS GLQYARALKE+GVE K+I FP 
Sbjct  487  AEHLTHFYSKSPILHISKVKAPTIFLLGAQDLRVPVSGGLQYARALKERGVETKIILFPN  546

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIGVWFKKYC
Sbjct  547  DIHAIERPQSDFESFLNIGVWFKKYC  572



>ref|XP_007225244.1| hypothetical protein PRUPE_ppa001729mg [Prunus persica]
 gb|EMJ26443.1| hypothetical protein PRUPE_ppa001729mg [Prunus persica]
Length=773

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLALMVGTTDIPDW YVE +GSEG  SFT+APS
Sbjct  627  HGGFLTTHLIGQAPDKFVAAAARNPVCNLALMVGTTDIPDWIYVEAYGSEGKNSFTDAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F SKSPIAH+SKVKTPTL LLGA+DLRVPVSTGLQYARALKE+GV VKVI FP 
Sbjct  687  AEHLTLFQSKSPIAHVSKVKTPTLFLLGAQDLRVPVSTGLQYARALKERGVPVKVIVFPN  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D H IERPQSDFESFLNIGVWFKKY +
Sbjct  747  DTHAIERPQSDFESFLNIGVWFKKYLS  773



>ref|XP_008224197.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Prunus 
mume]
Length=773

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLALMVGTTDIPDW YVE +GSEG  SFT+APS
Sbjct  627  HGGFLTTHLIGQAPDKFVAAAARNPVCNLALMVGTTDIPDWIYVEAYGSEGKNSFTDAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F SKSPIAH+SKVKTPTL LLGA+DLRVPVSTGLQYARA+KEKGV VK+I FP 
Sbjct  687  AEHLTLFQSKSPIAHVSKVKTPTLFLLGAQDLRVPVSTGLQYARAMKEKGVPVKIIVFPN  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D H IERPQSDFESFLNIGVWFKKY +
Sbjct  747  DTHAIERPQSDFESFLNIGVWFKKYLS  773



>ref|XP_010932862.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Elaeis 
guineensis]
Length=756

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+THLIGQAP++F  AA RNPVCNL+LM+GTTDIPDWCYVE FGSEG   F+EAPS
Sbjct  610  HGGFLSTHLIGQAPDRFVVAAVRNPVCNLSLMLGTTDIPDWCYVEAFGSEGKDYFSEAPS  669

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E+L  FY+KSPI+H+SKVK P L LLGA+DLRVPVS GLQYARAL+EKGVEVKVI FPE
Sbjct  670  AEYLKLFYNKSPISHLSKVKAPVLFLLGAQDLRVPVSNGLQYARALREKGVEVKVIVFPE  729

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIGVWFKKYC
Sbjct  730  DVHGIERPQSDFESFLNIGVWFKKYC  755



>ref|XP_010932861.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Elaeis 
guineensis]
Length=782

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+THLIGQAP++F  AA RNPVCNL+LM+GTTDIPDWCYVE FGSEG   F+EAPS
Sbjct  636  HGGFLSTHLIGQAPDRFVVAAVRNPVCNLSLMLGTTDIPDWCYVEAFGSEGKDYFSEAPS  695

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E+L  FY+KSPI+H+SKVK P L LLGA+DLRVPVS GLQYARAL+EKGVEVKVI FPE
Sbjct  696  AEYLKLFYNKSPISHLSKVKAPVLFLLGAQDLRVPVSNGLQYARALREKGVEVKVIVFPE  755

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIGVWFKKYC
Sbjct  756  DVHGIERPQSDFESFLNIGVWFKKYC  781



>ref|XP_007145931.1| hypothetical protein PHAVU_007G279900g [Phaseolus vulgaris]
 gb|ESW17925.1| hypothetical protein PHAVU_007G279900g [Phaseolus vulgaris]
Length=825

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWCYVET+G++G   FTEAPS
Sbjct  679  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGKDKFTEAPS  738

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPI+H+SK KTPTL LLGA+DLRVP+STGLQYARAL+EKGV  KVI FP 
Sbjct  739  AEDLTLFYSKSPISHLSKAKTPTLFLLGAQDLRVPISTGLQYARALREKGVPTKVIVFPN  798

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFES+LNI +WF KYC
Sbjct  799  DVHGIERPQSDFESYLNIAIWFNKYC  824



>ref|XP_010317399.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Solanum 
lycopersicum]
Length=770

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG  G  +FTEA S
Sbjct  623  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGENGKTNFTEATS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEK-GVEVKVISFP  397
            SEHL AFY KSPI H+SKV+TPTL LLGAKDLRVP+STGLQYARALKEK GVEVKVI FP
Sbjct  683  SEHLDAFYRKSPILHVSKVRTPTLFLLGAKDLRVPMSTGLQYARALKEKGGVEVKVIMFP  742

Query  396  EDVHGIERPQSDFESFLNIGVWFKKYC  316
            ED H ++RPQSDFESFLNIGVWFKK+C
Sbjct  743  EDTHALDRPQSDFESFLNIGVWFKKHC  769



>ref|XP_008224196.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Prunus 
mume]
Length=829

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLALMVGTTDIPDW YVE +GSEG  SFT+APS
Sbjct  683  HGGFLTTHLIGQAPDKFVAAAARNPVCNLALMVGTTDIPDWIYVEAYGSEGKNSFTDAPS  742

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F SKSPIAH+SKVKTPTL LLGA+DLRVPVSTGLQYARA+KEKGV VK+I FP 
Sbjct  743  AEHLTLFQSKSPIAHVSKVKTPTLFLLGAQDLRVPVSTGLQYARAMKEKGVPVKIIVFPN  802

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D H IERPQSDFESFLNIGVWFKKY +
Sbjct  803  DTHAIERPQSDFESFLNIGVWFKKYLS  829



>gb|EYU33017.1| hypothetical protein MIMGU_mgv1a001397mg [Erythranthe guttata]
Length=825

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGT+DIPDWCY E +G EG   +TEAPS
Sbjct  679  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTSDIPDWCYFEAYGIEGKSMYTEAPS  738

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E LA  YSKSPI HISKVKTPTL LLGAKDLRVPVS G+QYARALKEKGVE KVI FP 
Sbjct  739  DEQLALLYSKSPIYHISKVKTPTLFLLGAKDLRVPVSNGIQYARALKEKGVENKVIVFPN  798

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIG+WFKKYC
Sbjct  799  DVHGIDRPQSDFESFLNIGLWFKKYC  824



>gb|EYU33016.1| hypothetical protein MIMGU_mgv1a001397mg [Erythranthe guttata]
Length=826

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGT+DIPDWCY E +G EG   +TEAPS
Sbjct  680  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTSDIPDWCYFEAYGIEGKSMYTEAPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E LA  YSKSPI HISKVKTPTL LLGAKDLRVPVS G+QYARALKEKGVE KVI FP 
Sbjct  740  DEQLALLYSKSPIYHISKVKTPTLFLLGAKDLRVPVSNGIQYARALKEKGVENKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIG+WFKKYC
Sbjct  800  DVHGIDRPQSDFESFLNIGLWFKKYC  825



>dbj|BAJ95985.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE F AAAARNPVCNL LMVGTTDIPDWCY+E +G EG   FTE+P 
Sbjct  359  HGGFLTTHLIGQAPETFVAAAARNPVCNLQLMVGTTDIPDWCYLEVYGKEGKTCFTESPL  418

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ L  FY KSPI+HISKVKTPTL LLGAKDLRVPVS GLQYARALKE+GV+ K+I FPE
Sbjct  419  ADTLTQFYQKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARALKERGVDTKIIVFPE  478

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+HG+++PQSDFESFLNIGVWFKKY +
Sbjct  479  DIHGLDKPQSDFESFLNIGVWFKKYMS  505



>ref|XP_012069746.1| PREDICTED: acylamino-acid-releasing enzyme [Jatropha curcas]
 gb|KDP40266.1| hypothetical protein JCGZ_02264 [Jatropha curcas]
Length=828

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLA MVGTTDIPDWCYVET+G++G   FTEAPS
Sbjct  682  HGGFLTTHLIGQAPDKFVAAAARNPVCNLASMVGTTDIPDWCYVETYGTKGKNKFTEAPS  741

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E LA F+SKSPI+HI+KVK PT+ L+GA+DLRVP+S GLQYARALKE+GV+VK+I FP 
Sbjct  742  VEDLALFHSKSPISHIAKVKAPTIFLIGAQDLRVPMSNGLQYARALKERGVDVKIIMFPN  801

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIGVWFKKYC
Sbjct  802  DVHGIERPQSDFESFLNIGVWFKKYC  827



>gb|KJB38265.1| hypothetical protein B456_006G245500 [Gossypium raimondii]
Length=713

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL+ MV TTDIPDWCYVE++GS+G   FTEAPS
Sbjct  567  HGGFLTTHLIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPS  626

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  FYSKSPI HISKVK PT+ LLGA+DLRVPVS GLQYARALKE+GVE K+I FP 
Sbjct  627  AEHLTHFYSKSPILHISKVKAPTIFLLGAQDLRVPVSGGLQYARALKERGVETKIILFPN  686

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIGVWFKKYC
Sbjct  687  DIHAIERPQSDFESFLNIGVWFKKYC  712



>ref|XP_004234027.2| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Solanum 
lycopersicum]
Length=829

 Score =   261 bits (666),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNPVCNLALMVGT+DIPDWCY ETFG  G  +FTEA S
Sbjct  682  HGGFLTTHLIGQAPDKFAAAVARNPVCNLALMVGTSDIPDWCYAETFGENGKTNFTEATS  741

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEK-GVEVKVISFP  397
            SEHL AFY KSPI H+SKV+TPTL LLGAKDLRVP+STGLQYARALKEK GVEVKVI FP
Sbjct  742  SEHLDAFYRKSPILHVSKVRTPTLFLLGAKDLRVPMSTGLQYARALKEKGGVEVKVIMFP  801

Query  396  EDVHGIERPQSDFESFLNIGVWFKKYC  316
            ED H ++RPQSDFESFLNIGVWFKK+C
Sbjct  802  EDTHALDRPQSDFESFLNIGVWFKKHC  828



>gb|KJB38266.1| hypothetical protein B456_006G245500 [Gossypium raimondii]
Length=729

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL+ MV TTDIPDWCYVE++GS+G   FTEAPS
Sbjct  583  HGGFLTTHLIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPS  642

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  FYSKSPI HISKVK PT+ LLGA+DLRVPVS GLQYARALKE+GVE K+I FP 
Sbjct  643  AEHLTHFYSKSPILHISKVKAPTIFLLGAQDLRVPVSGGLQYARALKERGVETKIILFPN  702

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIGVWFKKYC
Sbjct  703  DIHAIERPQSDFESFLNIGVWFKKYC  728



>ref|XP_009600933.1| PREDICTED: acylamino-acid-releasing enzyme-like [Nicotiana tomentosiformis]
Length=768

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG +G L + EAPS
Sbjct  622  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGKQGKLMYAEAPS  681

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPI+HISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  682  SEHLAVFHSKSPISHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGTEVKVLVFPE  741

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKK+C
Sbjct  742  DNHAIDRPQSDFESFLNIGVWFKKHC  767



>ref|XP_009348996.1| PREDICTED: acylamino-acid-releasing enzyme-like [Pyrus x bretschneideri]
Length=772

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF  AA RNP CNLALM+GTTDIPDWCYVE +GSEG  ++TEAPS
Sbjct  626  HGGFLTTHLIGQAPDKFVVAAGRNPACNLALMIGTTDIPDWCYVEAYGSEGRNNYTEAPS  685

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   +SKSPI+H+SKVKTPTL LLGA+DLRVPVSTG QYARALKEKGV VKVI FP+
Sbjct  686  AEHLTLLHSKSPISHVSKVKTPTLFLLGAQDLRVPVSTGFQYARALKEKGVPVKVIVFPQ  745

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D HGIE+PQSDFESFLNIGVWFKKY +
Sbjct  746  DTHGIEKPQSDFESFLNIGVWFKKYLS  772



>ref|XP_010069183.1| PREDICTED: acylamino-acid-releasing enzyme-like [Eucalyptus grandis]
 gb|KCW57442.1| hypothetical protein EUGRSUZ_H00221 [Eucalyptus grandis]
Length=763

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AA ARNPVCNLALMVGTTDIPDWCYV ++G EG   FTEAPS
Sbjct  617  HGGFLTTHLIGQAPDKFCAAVARNPVCNLALMVGTTDIPDWCYVISYGIEGKNIFTEAPS  676

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL+  YSKSPI+HI KVKTPTL LLGA+DLRVPVSTGLQYARAL+E+GV+ KVI FP 
Sbjct  677  DEHLSLLYSKSPISHIHKVKTPTLFLLGAQDLRVPVSTGLQYARALRERGVDCKVILFPH  736

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQS+FESFLN+GVWFKKYC
Sbjct  737  DVHGIKRPQSNFESFLNVGVWFKKYC  762



>ref|XP_008449292.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Cucumis 
melo]
Length=822

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F AAAARNPVCNLALMVGT+DIPDWCYVE +G EG   +TEAPS
Sbjct  676  HGGFLTTHLIGQAPDRFVAAAARNPVCNLALMVGTSDIPDWCYVECYGKEGKNHYTEAPS  735

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   Y+KSPI H+SKVKTPT+ LLGAKDLRVP S GLQYARAL+EKGVEVKVI FP+
Sbjct  736  AEHLTHLYNKSPILHVSKVKTPTIFLLGAKDLRVPFSNGLQYARALREKGVEVKVIMFPD  795

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH I+RPQSDFESFLNIGVWF+KYC
Sbjct  796  DVHPIDRPQSDFESFLNIGVWFRKYC  821



>ref|XP_008449291.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Cucumis 
melo]
Length=823

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F AAAARNPVCNLALMVGT+DIPDWCYVE +G EG   +TEAPS
Sbjct  677  HGGFLTTHLIGQAPDRFVAAAARNPVCNLALMVGTSDIPDWCYVECYGKEGKNHYTEAPS  736

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   Y+KSPI H+SKVKTPT+ LLGAKDLRVP S GLQYARAL+EKGVEVKVI FP+
Sbjct  737  AEHLTHLYNKSPILHVSKVKTPTIFLLGAKDLRVPFSNGLQYARALREKGVEVKVIMFPD  796

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH I+RPQSDFESFLNIGVWF+KYC
Sbjct  797  DVHPIDRPQSDFESFLNIGVWFRKYC  822



>gb|KJB38268.1| hypothetical protein B456_006G245500 [Gossypium raimondii]
Length=830

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL+ MV TTDIPDWCYVE++GS+G   FTEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPS  743

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  FYSKSPI HISKVK PT+ LLGA+DLRVPVS GLQYARALKE+GVE K+I FP 
Sbjct  744  AEHLTHFYSKSPILHISKVKAPTIFLLGAQDLRVPVSGGLQYARALKERGVETKIILFPN  803

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIGVWFKKYC
Sbjct  804  DIHAIERPQSDFESFLNIGVWFKKYC  829



>ref|XP_002517031.1| acylamino-acid-releasing enzyme, putative [Ricinus communis]
 gb|EEF45194.1| acylamino-acid-releasing enzyme, putative [Ricinus communis]
Length=771

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ+P KF AAAARNPVCNLA MVGTTDIPDWCYVE +G+ G   FTEAPS
Sbjct  625  HGGFLTTHLIGQSPHKFVAAAARNPVCNLASMVGTTDIPDWCYVEAYGTGGKSKFTEAPS  684

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ LA F+SKSPI+HISKVK PT+ L+GA+DLRVP+S GLQYARALKEKGVEVK++ FP+
Sbjct  685  ADDLALFHSKSPISHISKVKAPTIFLIGAQDLRVPMSNGLQYARALKEKGVEVKILLFPD  744

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFLNIGVWFKKYC
Sbjct  745  DVHGIERPQSDFESFLNIGVWFKKYC  770



>ref|XP_010091250.1| Acylamino-acid-releasing enzyme [Morus notabilis]
 gb|EXB44171.1| Acylamino-acid-releasing enzyme [Morus notabilis]
Length=260

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDW Y ET+GS G  SFTEAPS
Sbjct  114  HGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWAYFETYGSLGKNSFTEAPS  173

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L AF+ KSPI+H+SKVKTP L L+GA+DLRVP S GLQY RALKE+G  VK I FP 
Sbjct  174  AEDLIAFHKKSPISHLSKVKTPILFLVGAQDLRVPFSNGLQYVRALKERGGNVKTIMFPN  233

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIGVWFKKYC
Sbjct  234  DVHGIDRPQSDFESFLNIGVWFKKYC  259



>ref|XP_006838890.2| PREDICTED: acylamino-acid-releasing enzyme [Amborella trichopoda]
 ref|XP_011621616.1| PREDICTED: acylamino-acid-releasing enzyme [Amborella trichopoda]
Length=777

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F  AA RNPVCN+ALM+GTTDIPDWCYVET+GS G   FTEAPS
Sbjct  631  HGGFLTTHLIGQAPDRFCVAAVRNPVCNIALMIGTTDIPDWCYVETYGSAGNSFFTEAPS  690

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL+ FY+KSPI+HISKVK P L LLGA+DLRVPVS G+QYARALKEKGV VK I FP 
Sbjct  691  LEHLSVFYNKSPISHISKVKVPVLFLLGAQDLRVPVSNGIQYARALKEKGVPVKTIVFPN  750

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIG+WFKKYC
Sbjct  751  DVHGIDRPQSDFESFLNIGLWFKKYC  776



>ref|XP_010326712.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010326713.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010326714.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Solanum 
lycopersicum]
Length=767

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG  G   +TEAPS
Sbjct  621  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGHLGKSMYTEAPS  680

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPIAHISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  681  SEHLAVFHSKSPIAHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGSEVKVLVFPE  740

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKK+C
Sbjct  741  DNHAIDRPQSDFESFLNIGVWFKKHC  766



>gb|KGN61646.1| hypothetical protein Csa_2G200940 [Cucumis sativus]
Length=773

 Score =   257 bits (656),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F AAAARNPVCNLALMVGT+DIPDWCYVE +G EG   +TEAPS
Sbjct  627  HGGFLTTHLIGQAPDRFVAAAARNPVCNLALMVGTSDIPDWCYVECYGREGKNYYTEAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++HL   Y+KSPI H+SKVKTPT+ LLGAKDLRVP S GLQYARALKEKGVEVK+I FP+
Sbjct  687  ADHLTHLYNKSPILHVSKVKTPTIFLLGAKDLRVPFSNGLQYARALKEKGVEVKIIMFPD  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H I+RPQSDFESFLNIGVWF+KYC
Sbjct  747  DIHPIDRPQSDFESFLNIGVWFRKYC  772



>ref|XP_010326710.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326711.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
lycopersicum]
Length=781

 Score =   257 bits (657),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG  G   +TEAPS
Sbjct  635  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGHLGKSMYTEAPS  694

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPIAHISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  695  SEHLAVFHSKSPIAHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGSEVKVLVFPE  754

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKK+C
Sbjct  755  DNHAIDRPQSDFESFLNIGVWFKKHC  780



>ref|XP_010326709.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
lycopersicum]
Length=778

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG  G   +TEAPS
Sbjct  632  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGHLGKSMYTEAPS  691

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPIAHISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  692  SEHLAVFHSKSPIAHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGSEVKVLVFPE  751

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKK+C
Sbjct  752  DNHAIDRPQSDFESFLNIGVWFKKHC  777



>ref|XP_003637575.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
Length=607

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC++E++G++G    TEAPS
Sbjct  461  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFLESYGTKGRDRITEAPS  520

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKT T+ LLGA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  521  AEDLTLFYSKSPIAHLSKVKTTTVFLLGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  580

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  581  DVHGIERPQSDFESFLSIAAWFNKYC  606



>ref|XP_010649982.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Vitis 
vinifera]
Length=773

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLT+HLIGQAP+KFA AA RNPVCNLALMVGTTDIPDWC+VE +GS+G  SFTEAPS
Sbjct  627  HGGFLTSHLIGQAPDKFAVAAVRNPVCNLALMVGTTDIPDWCFVEAYGSQGKNSFTEAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L   +SKSP++HI KVKTPTL LLGA+DLRVPVS GL YAR LKEKGVEVKVI FP 
Sbjct  687  AEQLTLLHSKSPVSHIHKVKTPTLFLLGAQDLRVPVSNGLHYARELKEKGVEVKVIIFPN  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH IERPQSDFESFLNIGVWFKKYC
Sbjct  747  DVHAIERPQSDFESFLNIGVWFKKYC  772



>gb|ERN01459.1| hypothetical protein AMTR_s00002p00268330 [Amborella trichopoda]
Length=828

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F  AA RNPVCN+ALM+GTTDIPDWCYVET+GS G   FTEAPS
Sbjct  682  HGGFLTTHLIGQAPDRFCVAAVRNPVCNIALMIGTTDIPDWCYVETYGSAGNSFFTEAPS  741

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL+ FY+KSPI+HISKVK P L LLGA+DLRVPVS G+QYARALKEKGV VK I FP 
Sbjct  742  LEHLSVFYNKSPISHISKVKVPVLFLLGAQDLRVPVSNGIQYARALKEKGVPVKTIVFPN  801

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIG+WFKKYC
Sbjct  802  DVHGIDRPQSDFESFLNIGLWFKKYC  827



>ref|XP_006362176.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
tuberosum]
Length=769

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG  G   +TEAPS
Sbjct  623  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGHLGKSMYTEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPIAHISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  683  SEHLAVFHSKSPIAHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGTEVKVLVFPE  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIG+WFKK+C
Sbjct  743  DNHAIDRPQSDFESFLNIGMWFKKHC  768



>ref|XP_002284013.2| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Vitis 
vinifera]
 emb|CBI26348.3| unnamed protein product [Vitis vinifera]
Length=822

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLT+HLIGQAP+KFA AA RNPVCNLALMVGTTDIPDWC+VE +GS+G  SFTEAPS
Sbjct  676  HGGFLTSHLIGQAPDKFAVAAVRNPVCNLALMVGTTDIPDWCFVEAYGSQGKNSFTEAPS  735

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L   +SKSP++HI KVKTPTL LLGA+DLRVPVS GL YAR LKEKGVEVKVI FP 
Sbjct  736  AEQLTLLHSKSPVSHIHKVKTPTLFLLGAQDLRVPVSNGLHYARELKEKGVEVKVIIFPN  795

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH IERPQSDFESFLNIGVWFKKYC
Sbjct  796  DVHAIERPQSDFESFLNIGVWFKKYC  821



>ref|XP_011649169.1| PREDICTED: acylamino-acid-releasing enzyme [Cucumis sativus]
Length=824

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP++F AAAARNPVCNLALMVGT+DIPDWCYVE +G EG   +TEAPS
Sbjct  678  HGGFLTTHLIGQAPDRFVAAAARNPVCNLALMVGTSDIPDWCYVECYGREGKNYYTEAPS  737

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++HL   Y+KSPI H+SKVKTPT+ LLGAKDLRVP S GLQYARALKEKGVEVK+I FP+
Sbjct  738  ADHLTHLYNKSPILHVSKVKTPTIFLLGAKDLRVPFSNGLQYARALKEKGVEVKIIMFPD  797

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H I+RPQSDFESFLNIGVWF+KYC
Sbjct  798  DIHPIDRPQSDFESFLNIGVWFRKYC  823



>ref|XP_006362175.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
tuberosum]
Length=801

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG  G   +TEAPS
Sbjct  655  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGHLGKSMYTEAPS  714

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPIAHISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ FPE
Sbjct  715  SEHLAVFHSKSPIAHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGTEVKVLVFPE  774

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIG+WFKK+C
Sbjct  775  DNHAIDRPQSDFESFLNIGMWFKKHC  800



>emb|CDO99144.1| unnamed protein product [Coffea canephora]
Length=853

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAA ARNP CNL+LMVGTTDIPDW YVE+FGSEG   FTE  S
Sbjct  707  HGGFLTTHLIGQAPDKFAAACARNPACNLSLMVGTTDIPDWVYVESFGSEGKSIFTEVAS  766

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E+L AFY+KSP++ ISKV+TPTL+LLGAKDLRVPVS G+QYARALKE+G EVKVI FPE
Sbjct  767  PENLTAFYNKSPVSRISKVETPTLLLLGAKDLRVPVSNGIQYARALKERGREVKVIVFPE  826

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D HG+ERPQSDFES+LNIGVWFKKYC+
Sbjct  827  DAHGLERPQSDFESYLNIGVWFKKYCS  853



>ref|XP_006362173.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Solanum 
tuberosum]
Length=767

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN A+MVGTTDIPDWCY E FGSE   SFT A
Sbjct  619  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFAIMVGTTDIPDWCYFEAFGSEAKSSFTAA  678

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVKTPTLMLLG KDLRVP++ GLQYARALKEKGVEVKV+ F
Sbjct  679  PSAEHLALFYDKSPISHVSKVKTPTLMLLGVKDLRVPITDGLQYARALKEKGVEVKVMMF  738

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLNIGVWFKKYC+
Sbjct  739  PDDIHELDRPRTDFESFLNIGVWFKKYCS  767



>ref|XP_006362171.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362172.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
tuberosum]
Length=768

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN A+MVGTTDIPDWCY E FGSE   SFT A
Sbjct  620  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFAIMVGTTDIPDWCYFEAFGSEAKSSFTAA  679

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVKTPTLMLLG KDLRVP++ GLQYARALKEKGVEVKV+ F
Sbjct  680  PSAEHLALFYDKSPISHVSKVKTPTLMLLGVKDLRVPITDGLQYARALKEKGVEVKVMMF  739

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLNIGVWFKKYC+
Sbjct  740  PDDIHELDRPRTDFESFLNIGVWFKKYCS  768



>gb|KEH27832.1| acylamino-acid-releasing enzyme-like protein, putative [Medicago 
truncatula]
Length=769

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNL LMVGTTDIPDWC+VE++G+ G    TEAPS
Sbjct  623  HGGFLTTHLIGQAPEKFVAAAARNPVCNLELMVGTTDIPDWCFVESYGTNGRDRITEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  683  AEDLTLFYSKSPIAHLSKVKTPTVFLLGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFL+I  WF KYC
Sbjct  743  DVHGIDRPQSDFESFLSIAAWFNKYC  768



>ref|XP_003613900.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
Length=768

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNL LMVGTTDIPDWC+VE++G+ G    TEAPS
Sbjct  622  HGGFLTTHLIGQAPEKFVAAAARNPVCNLELMVGTTDIPDWCFVESYGTNGRDRITEAPS  681

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  682  AEDLTLFYSKSPIAHLSKVKTPTVFLLGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  741

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFL+I  WF KYC
Sbjct  742  DVHGIDRPQSDFESFLSIAAWFNKYC  767



>ref|XP_009773635.1| PREDICTED: acylamino-acid-releasing enzyme-like [Nicotiana sylvestris]
Length=768

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNPVC+L LMVGT DIPDWCY ETFG +G   +TEAPS
Sbjct  622  HGGFLTTHLIGQAPDKFAAAATRNPVCSLPLMVGTADIPDWCYAETFGKQGKSMYTEAPS  681

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SEHLA F+SKSPI+HISKVKTP L LLGAKDLRVP+ TGLQYARALKEKG EVKV+ F E
Sbjct  682  SEHLAVFHSKSPISHISKVKTPILFLLGAKDLRVPICTGLQYARALKEKGTEVKVLVFRE  741

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I+RPQSDFESFLNIGVWFKK+C
Sbjct  742  DNHAIDRPQSDFESFLNIGVWFKKHC  767



>ref|XP_004498001.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X4 [Cicer 
arietinum]
Length=825

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  679  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  738

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  739  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  798

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  799  DVHGIERPQSDFESFLSIAAWFNKYC  824



>ref|XP_008341037.1| PREDICTED: acylamino-acid-releasing enzyme-like [Malus domestica]
Length=772

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF  AA RNP CNLALM+GTTDIPDWCYVE +GSEG  ++TEAPS
Sbjct  626  HGGFLTTHLIGQAPDKFVVAAXRNPXCNLALMIGTTDIPDWCYVEAYGSEGRNNYTEAPS  685

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   +SKSPI+H+SKVKTP L LLGA+DLRVP STG QYARALKEKGV VKVI FP+
Sbjct  686  AEHLTLXHSKSPISHVSKVKTPXLFLLGAQDLRVPXSTGXQYARALKEKGVPVKVIVFPQ  745

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D HGIERPQSDFESFLNIGVWFKKY
Sbjct  746  DTHGIERPQSDFESFLNIGVWFKKY  770



>gb|AES96858.2| acylamino-acid-releasing enzyme-like protein, putative [Medicago 
truncatula]
Length=833

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNL LMVGTTDIPDWC+VE++G+ G    TEAPS
Sbjct  687  HGGFLTTHLIGQAPEKFVAAAARNPVCNLELMVGTTDIPDWCFVESYGTNGRDRITEAPS  746

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  747  AEDLTLFYSKSPIAHLSKVKTPTVFLLGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  806

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFL+I  WF KYC
Sbjct  807  DVHGIDRPQSDFESFLSIAAWFNKYC  832



>ref|XP_004498000.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Cicer 
arietinum]
Length=826

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  680  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  740  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  800  DVHGIERPQSDFESFLSIAAWFNKYC  825



>ref|XP_003613901.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
 gb|AES96859.1| acylamino-acid-releasing enzyme-like protein, putative [Medicago 
truncatula]
Length=832

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNL LMVGTTDIPDWC+VE++G+ G    TEAPS
Sbjct  686  HGGFLTTHLIGQAPEKFVAAAARNPVCNLELMVGTTDIPDWCFVESYGTNGRDRITEAPS  745

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  746  AEDLTLFYSKSPIAHLSKVKTPTVFLLGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  805

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFL+I  WF KYC
Sbjct  806  DVHGIDRPQSDFESFLSIAAWFNKYC  831



>ref|XP_004498003.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X6 [Cicer 
arietinum]
Length=822

 Score =   255 bits (651),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  676  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  735

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  736  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  795

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  796  DVHGIERPQSDFESFLSIAAWFNKYC  821



>ref|XP_004498002.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X5 [Cicer 
arietinum]
Length=823

 Score =   255 bits (651),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  677  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  736

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  737  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  796

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  797  DVHGIERPQSDFESFLSIAAWFNKYC  822



>dbj|BAJ94082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE F AAAARNPVCNL LMVGTTDIPDWCY+E +G EG   FTE+P 
Sbjct  625  HGGFLTTHLIGQAPETFVAAAARNPVCNLQLMVGTTDIPDWCYLEVYGKEGKTCFTESPL  684

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ L  FY KSPI+HISKVKTPTL LLGAKDLRVPVS GLQYARALKE+GV+ K+I FPE
Sbjct  685  ADTLTQFYQKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARALKERGVDTKIIVFPE  744

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+HG+++PQSDFESFLNIGVWFKKY +
Sbjct  745  DIHGLDKPQSDFESFLNIGVWFKKYMS  771



>ref|XP_004497998.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Cicer 
arietinum]
Length=852

 Score =   255 bits (652),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  706  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  765

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  766  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  825

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGIERPQSDFESFL+I  WF KYC
Sbjct  826  DVHGIERPQSDFESFLSIAAWFNKYC  851



>ref|XP_007034935.1| Acylaminoacyl-peptidase-related isoform 2 [Theobroma cacao]
 gb|EOY05861.1| Acylaminoacyl-peptidase-related isoform 2 [Theobroma cacao]
Length=769

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  623  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   Y+KSPI+HISKVK PTL LLGA+DLRVPVS GLQY+RALKE+GVE KVI FP 
Sbjct  683  AEHLTHLYNKSPISHISKVKAPTLFLLGAQDLRVPVSNGLQYSRALKERGVETKVIMFPN  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIG+WFK+YC
Sbjct  743  DIHAIERPQSDFESFLNIGMWFKRYC  768



>ref|XP_010326708.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Solanum 
lycopersicum]
Length=767

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN ALMVGTTDIPDWCY E FGSE   SFT A
Sbjct  619  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFALMVGTTDIPDWCYFEAFGSEAKSSFTAA  678

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA F++KSPI+H+SKVKTPTLMLLGAKDLRVP++ GLQYARALKEKGVEVKV+ F
Sbjct  679  PSAEHLALFFNKSPISHVSKVKTPTLMLLGAKDLRVPITDGLQYARALKEKGVEVKVMRF  738

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLNIG+WFKK+C+
Sbjct  739  PDDIHELDRPRTDFESFLNIGLWFKKHCS  767



>ref|XP_010246335.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246336.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246337.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246338.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246339.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Nelumbo 
nucifera]
Length=780

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ P++FAAAAARNPVCNLALM GTTDIPDWC+VE  G+EG   FTEAP 
Sbjct  634  HGGFLTTHLIGQEPDRFAAAAARNPVCNLALMTGTTDIPDWCFVEACGTEGKNYFTEAPL  693

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EH+  FYSKSP++++SKVKTPTL LLGA+DLRVPVS GLQYARALKEKG +VK+I FP 
Sbjct  694  VEHINLFYSKSPVSYLSKVKTPTLFLLGAQDLRVPVSNGLQYARALKEKGTKVKIIVFPN  753

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH I+RPQSDFESFLNIGVWFKKYC
Sbjct  754  DVHAIDRPQSDFESFLNIGVWFKKYC  779



>ref|XP_004247631.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326707.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Solanum 
lycopersicum]
Length=768

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN ALMVGTTDIPDWCY E FGSE   SFT A
Sbjct  620  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFALMVGTTDIPDWCYFEAFGSEAKSSFTAA  679

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA F++KSPI+H+SKVKTPTLMLLGAKDLRVP++ GLQYARALKEKGVEVKV+ F
Sbjct  680  PSAEHLALFFNKSPISHVSKVKTPTLMLLGAKDLRVPITDGLQYARALKEKGVEVKVMRF  739

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLNIG+WFKK+C+
Sbjct  740  PDDIHELDRPRTDFESFLNIGLWFKKHCS  768



>ref|XP_008224200.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Prunus 
mume]
Length=654

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNP CNLALMVGTTDIPDWCYVE +GSEG  +FTEAPS
Sbjct  508  HGGFLTTHLIGQAPDKFAAAATRNPACNLALMVGTTDIPDWCYVEAYGSEGKNTFTEAPS  567

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F+ KSPI+H SKVKTPTL LLGA+D+R+P  TGLQYA+ALK KGV VKVI FP 
Sbjct  568  AEHLTLFHRKSPISHSSKVKTPTLFLLGAQDIRLPFFTGLQYAQALKAKGVPVKVIVFPN  627

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D H IERPQSDFESFLNIGVWFKKY +
Sbjct  628  DTHAIERPQSDFESFLNIGVWFKKYLS  654



>ref|XP_011463572.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101311565 
[Fragaria vesca subsp. vesca]
Length=1509

 Score =   258 bits (660),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -2

Query  753   HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
             HGGFLTTHLIGQAPEKFAAA ARNPVCNLALMVGTTDIPDWCYVE +GSEG   ++EAPS
Sbjct  1363  HGGFLTTHLIGQAPEKFAAACARNPVCNLALMVGTTDIPDWCYVEAYGSEGKNIYSEAPS  1422

Query  573   SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             +E LA F+SKSPI+HI KVKTPTL LLGA+DLRVP+STGLQYARALK+KGV VKVI FP 
Sbjct  1423  AEDLALFHSKSPISHILKVKTPTLFLLGAQDLRVPISTGLQYARALKDKGVAVKVIMFPN  1482

Query  393   DVHGIERPQSDFESFLNIGVWFKKY  319
             D+H I+RPQSDFESFLNIGVWFKKY
Sbjct  1483  DIHPIDRPQSDFESFLNIGVWFKKY  1507



>ref|XP_007034934.1| Acylaminoacyl-peptidase-related isoform 1 [Theobroma cacao]
 gb|EOY05860.1| Acylaminoacyl-peptidase-related isoform 1 [Theobroma cacao]
Length=830

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  743

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   Y+KSPI+HISKVK PTL LLGA+DLRVPVS GLQY+RALKE+GVE KVI FP 
Sbjct  744  AEHLTHLYNKSPISHISKVKAPTLFLLGAQDLRVPVSNGLQYSRALKERGVETKVIMFPN  803

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H IERPQSDFESFLNIG+WFK+YC
Sbjct  804  DIHAIERPQSDFESFLNIGMWFKRYC  829



>ref|XP_010246334.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Nelumbo 
nucifera]
Length=831

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ P++FAAAAARNPVCNLALM GTTDIPDWC+VE  G+EG   FTEAP 
Sbjct  685  HGGFLTTHLIGQEPDRFAAAAARNPVCNLALMTGTTDIPDWCFVEACGTEGKNYFTEAPL  744

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EH+  FYSKSP++++SKVKTPTL LLGA+DLRVPVS GLQYARALKEKG +VK+I FP 
Sbjct  745  VEHINLFYSKSPVSYLSKVKTPTLFLLGAQDLRVPVSNGLQYARALKEKGTKVKIIVFPN  804

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH I+RPQSDFESFLNIGVWFKKYC
Sbjct  805  DVHAIDRPQSDFESFLNIGVWFKKYC  830



>ref|XP_009337282.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009337283.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009337284.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Pyrus 
x bretschneideri]
Length=772

 Score =   252 bits (644),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFA AAA NPVCNLALMVGTTDIPDWCYV  +GSEG   +TEAPS
Sbjct  626  HGGFLTTHLIGQAPDKFAVAAAMNPVCNLALMVGTTDIPDWCYVVAYGSEGKNYYTEAPS  685

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   +SKSPI+H+SKVKTPTL LLGA+DLRVPVSTG QYARALKEKGV VK+I FP 
Sbjct  686  AEHLTLMHSKSPISHVSKVKTPTLFLLGAQDLRVPVSTGFQYARALKEKGVPVKIIVFPH  745

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            DVH I+RPQSDFESFLNIGVWFKK+ +
Sbjct  746  DVHAIKRPQSDFESFLNIGVWFKKHLS  772



>ref|XP_008353311.1| PREDICTED: acylamino-acid-releasing enzyme-like [Malus domestica]
Length=490

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ PEKF  AA RNP CNLALMVGTTDIPDWCYVE +GSEG  SFTEAPS
Sbjct  334  HGGFLTTHLIGQEPEKFVVAATRNPACNLALMVGTTDIPDWCYVEAYGSEGKNSFTEAPS  393

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F+  SPI+H+SKVKTPTL LLGA+D+R+P+S G QY+RALKEKGV VKVI FP 
Sbjct  394  AEHLTLFHRMSPISHVSKVKTPTLFLLGAQDIRLPISIGFQYSRALKEKGVPVKVIVFPH  453

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D H I+RPQSDFE FLNIGVWFKKY
Sbjct  454  DNHAIDRPQSDFEXFLNIGVWFKKY  478



>ref|XP_002312565.2| hypothetical protein POPTR_0008s16030g [Populus trichocarpa]
 gb|EEE89932.2| hypothetical protein POPTR_0008s16030g [Populus trichocarpa]
Length=831

 Score =   252 bits (644),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL  MVG TDIPDWCYVET+G EG   FTEAPS
Sbjct  685  HGGFLTTHLIGQAPDKFVAAAARNPVCNLVSMVGITDIPDWCYVETYGVEGKTKFTEAPS  744

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E LA F+SKSPI+HISKVKTPT+ +LGA+DLRVP+S GLQYARALKEKGVEVK++ FP 
Sbjct  745  AEDLALFHSKSPISHISKVKTPTIFVLGAQDLRVPLSNGLQYARALKEKGVEVKILVFPN  804

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH IERPQSD E FLNI VWF KYC
Sbjct  805  DVHAIERPQSDHEGFLNIAVWFNKYC  830



>ref|XP_009337281.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Pyrus 
x bretschneideri]
Length=836

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFA AAA NPVCNLALMVGTTDIPDWCYV  +GSEG   +TEAPS
Sbjct  690  HGGFLTTHLIGQAPDKFAVAAAMNPVCNLALMVGTTDIPDWCYVVAYGSEGKNYYTEAPS  749

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL   +SKSPI+H+SKVKTPTL LLGA+DLRVPVSTG QYARALKEKGV VK+I FP 
Sbjct  750  AEHLTLMHSKSPISHVSKVKTPTLFLLGAQDLRVPVSTGFQYARALKEKGVPVKIIVFPH  809

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            DVH I+RPQSDFESFLNIGVWFKK+ +
Sbjct  810  DVHAIKRPQSDFESFLNIGVWFKKHLS  836



>ref|XP_009773640.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X5 [Nicotiana 
sylvestris]
Length=754

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT A
Sbjct  606  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAA  665

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ F
Sbjct  666  PSAEHLALFYDKSPISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMF  725

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLN+GVWFKKYC+
Sbjct  726  PDDIHELDRPRTDFESFLNVGVWFKKYCS  754



>ref|XP_008224199.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Prunus 
mume]
Length=773

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAA RNP CNLALMVGTTDIPDWCYVE +GSEG  +FTEAPS
Sbjct  627  HGGFLTTHLIGQAPDKFAAAATRNPACNLALMVGTTDIPDWCYVEAYGSEGKNTFTEAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHL  F+ KSPI+H SKVKTPTL LLGA+D+R+P  TGLQYA+ALK KGV VKVI FP 
Sbjct  687  AEHLTLFHRKSPISHSSKVKTPTLFLLGAQDIRLPFFTGLQYAQALKAKGVPVKVIVFPN  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D H IERPQSDFESFLNIGVWFKKY +
Sbjct  747  DTHAIERPQSDFESFLNIGVWFKKYLS  773



>ref|XP_009773636.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Nicotiana 
sylvestris]
Length=775

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT A
Sbjct  627  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAA  686

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ F
Sbjct  687  PSAEHLALFYDKSPISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMF  746

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLN+GVWFKKYC+
Sbjct  747  PDDIHELDRPRTDFESFLNVGVWFKKYCS  775



>ref|XP_009773638.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Nicotiana 
sylvestris]
Length=770

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT A
Sbjct  622  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAA  681

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ F
Sbjct  682  PSAEHLALFYDKSPISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMF  741

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLN+GVWFKKYC+
Sbjct  742  PDDIHELDRPRTDFESFLNVGVWFKKYCS  770



>ref|XP_009773639.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X4 [Nicotiana 
sylvestris]
Length=763

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT A
Sbjct  615  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAA  674

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ F
Sbjct  675  PSAEHLALFYDKSPISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMF  734

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLN+GVWFKKYC+
Sbjct  735  PDDIHELDRPRTDFESFLNVGVWFKKYCS  763



>ref|XP_009773637.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Nicotiana 
sylvestris]
Length=773

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT A
Sbjct  625  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAA  684

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ F
Sbjct  685  PSAEHLALFYDKSPISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMF  744

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLN+GVWFKKYC+
Sbjct  745  PDDIHELDRPRTDFESFLNVGVWFKKYCS  773



>ref|XP_011027451.1| PREDICTED: acylamino-acid-releasing enzyme [Populus euphratica]
Length=831

 Score =   251 bits (640),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWCYVET+G EG   FTEAPS
Sbjct  685  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCYVETYGVEGKTKFTEAPS  744

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E LA F+SKSPI+HISKVKTP + +LGA+DLRVP+S GLQYARALKEKGVEVK++ FP 
Sbjct  745  AEDLALFHSKSPISHISKVKTPIIFVLGAQDLRVPLSNGLQYARALKEKGVEVKILMFPN  804

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVH IERPQSD+E  LNI VWF KYC
Sbjct  805  DVHAIERPQSDYEGLLNIAVWFNKYC  830



>ref|XP_010234726.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Brachypodium 
distachyon]
Length=775

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE F AAAARNPVCNL+LMVGTTDIP+WC++E +G EG   FTE+PS
Sbjct  628  HGGFLTTHLIGQAPETFVAAAARNPVCNLSLMVGTTDIPEWCFLEMYGKEGKNCFTESPS  687

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E LA FY KSPI+HISKVKTPTL LLGAKDLRVPVS GLQYAR +KE+G+E K+I FPE
Sbjct  688  AETLAQFYEKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARTMKERGLETKIIVFPE  747

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D HG+++PQ+D+ESFLNIGVWFKKY +
Sbjct  748  DNHGLDKPQADYESFLNIGVWFKKYMS  774



>ref|XP_009600932.1| PREDICTED: acylamino-acid-releasing enzyme-like [Nicotiana tomentosiformis]
Length=768

 Score =   249 bits (636),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCNL LMVGTTDIPDWCY E FGSE   +FT A
Sbjct  620  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNLGLMVGTTDIPDWCYFEAFGSEAKSTFTAA  679

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+EHLA FY KSPI+H+SKVK PTLMLLGA+DLRVP++ GLQYARALKE G EVKV+ F
Sbjct  680  PSAEHLALFYDKSPISHVSKVKAPTLMLLGAQDLRVPITDGLQYARALKENGAEVKVMMF  739

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H ++RP++DFESFLNIGVWF+KYC+
Sbjct  740  PDDIHELDRPRTDFESFLNIGVWFEKYCS  768



>ref|XP_003573923.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Brachypodium 
distachyon]
Length=827

 Score =   249 bits (637),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE F AAAARNPVCNL+LMVGTTDIP+WC++E +G EG   FTE+PS
Sbjct  680  HGGFLTTHLIGQAPETFVAAAARNPVCNLSLMVGTTDIPEWCFLEMYGKEGKNCFTESPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E LA FY KSPI+HISKVKTPTL LLGAKDLRVPVS GLQYAR +KE+G+E K+I FPE
Sbjct  740  AETLAQFYEKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARTMKERGLETKIIVFPE  799

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D HG+++PQ+D+ESFLNIGVWFKKY +
Sbjct  800  DNHGLDKPQADYESFLNIGVWFKKYMS  826



>ref|XP_010690382.1| PREDICTED: acylamino-acid-releasing enzyme-like [Beta vulgaris 
subsp. vulgaris]
Length=832

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE+FAAAAARNPVCNLALMVGT+DIPDWC+VET+G EG   FT AP+
Sbjct  686  HGGFLTTHLIGQAPERFAAAAARNPVCNLALMVGTSDIPDWCFVETYGIEGQAKFTNAPT  745

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHL+  Y KSPIAHI+KVKTPTL L+GA+DLRVP S GLQYA+ALKE+GVE+K+I FPE
Sbjct  746  KEHLSVLYDKSPIAHINKVKTPTLFLIGAQDLRVPSSNGLQYAQALKERGVEMKIIVFPE  805

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H I++PQSDFESFLNIGVWFKKYC
Sbjct  806  DTHAIDKPQSDFESFLNIGVWFKKYC  831



>ref|XP_009381275.1| PREDICTED: acylamino-acid-releasing enzyme [Musa acuminata subsp. 
malaccensis]
Length=841

 Score =   247 bits (630),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHL+GQAP++F  AAARNPVCNL+LMVGTTDIPDWCY E  G EG   F+EAPS
Sbjct  695  HGGFLTTHLVGQAPDRFVVAAARNPVCNLSLMVGTTDIPDWCYTEACGKEGKNFFSEAPS  754

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L+ FY+KSPI+HI KVK P L LLGA+DLRVP+S GLQYARAL+EKGV+VKV+ FPE
Sbjct  755  AEQLSLFYNKSPISHILKVKVPILFLLGAQDLRVPMSNGLQYARALREKGVDVKVLVFPE  814

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            DVHGI+RPQSDFESFLNIGVWFKK+
Sbjct  815  DVHGIDRPQSDFESFLNIGVWFKKH  839



>ref|XP_004983184.1| PREDICTED: acylamino-acid-releasing enzyme-like [Setaria italica]
Length=831

 Score =   246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+ F AAAARNPVCNL LMVGTTDIPDWC+VE +G EG   F+E+PS
Sbjct  684  HGGFLTTHLIGQAPDTFVAAAARNPVCNLQLMVGTTDIPDWCFVEIYGKEGKKYFSESPS  743

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HISKVKTPTL LLGA+DLRVPVS GLQYARALKE+G+E K I FPE
Sbjct  744  VDDLCQFHQKSPISHISKVKTPTLFLLGAQDLRVPVSNGLQYARALKERGIESKTIVFPE  803

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+HGI++PQSDFESFLNIGVWFKK+ +
Sbjct  804  DIHGIDKPQSDFESFLNIGVWFKKHLS  830



>gb|EPS67862.1| hypothetical protein M569_06906, partial [Genlisea aurea]
Length=764

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KFAAAAARNPVCN++LM+GT+DIPDWC+ E +G  G   FTEAPS
Sbjct  618  HGGFLTTHLIGQAPDKFAAAAARNPVCNMSLMLGTSDIPDWCFFEAYGRNGKEMFTEAPS  677

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++H++  +SKSPIAHISKVKTPTL LLGA+DLRVPVS GLQYARALKE+GVE KVI FP+
Sbjct  678  ADHISLLHSKSPIAHISKVKTPTLFLLGAQDLRVPVSNGLQYARALKERGVETKVIVFPK  737

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            DVHGI+RPQSDFESFLNIG+WF K+C
Sbjct  738  DVHGIDRPQSDFESFLNIGMWFNKHC  763



>ref|XP_008679989.1| PREDICTED: LOC100285393 isoform X1 [Zea mays]
Length=774

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+ F AAAARNPVCNL+LMVGT+DIPDWC+VE +G EG   F+E+PS
Sbjct  627  HGGFLTTHLIGQAPDTFVAAAARNPVCNLSLMVGTSDIPDWCFVEIYGKEGKKYFSESPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HI+KVKTPTL LLGA+DLRVPVS GLQYARALKE+G+E K I FPE
Sbjct  687  VDDLCQFHQKSPISHIAKVKTPTLFLLGAQDLRVPVSNGLQYARALKERGIETKTIVFPE  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D+HGI++PQSDFESFLNIGVWFKK+
Sbjct  747  DIHGIDKPQSDFESFLNIGVWFKKH  771



>ref|XP_011467695.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X3 [Fragaria 
vesca subsp. vesca]
Length=773

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAA RNP CNLALMVGTTDIPDWCYVE +G+EG   +TEAPS
Sbjct  627  HGGFLTTHLIGQAPEKFFAAATRNPACNLALMVGTTDIPDWCYVEAYGTEGKNRYTEAPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +EHLA F+ KSPI+HISK KTP L LLGA+D+R+P+ +GLQYA+ LKEKGV VKVI FP 
Sbjct  687  AEHLALFHCKSPISHISKAKTPILFLLGAQDIRLPICSGLQYAQGLKEKGVTVKVIVFPN  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D H I+RPQSDFESFLNIGVWFK+Y
Sbjct  747  DNHPIDRPQSDFESFLNIGVWFKRY  771



>ref|XP_008679983.1| PREDICTED: LOC100285393 isoform X2 [Zea mays]
Length=826

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+ F AAAARNPVCNL+LMVGT+DIPDWC+VE +G EG   F+E+PS
Sbjct  679  HGGFLTTHLIGQAPDTFVAAAARNPVCNLSLMVGTSDIPDWCFVEIYGKEGKKYFSESPS  738

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HI+KVKTPTL LLGA+DLRVPVS GLQYARALKE+G+E K I FPE
Sbjct  739  VDDLCQFHQKSPISHIAKVKTPTLFLLGAQDLRVPVSNGLQYARALKERGIETKTIVFPE  798

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D+HGI++PQSDFESFLNIGVWFKK+
Sbjct  799  DIHGIDKPQSDFESFLNIGVWFKKH  823



>ref|NP_001151758.1| LOC100285393 [Zea mays]
 gb|ACG44240.1| acylamino-acid-releasing enzyme [Zea mays]
Length=774

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+ F AAAARNPVCNL+LMVGT+DIPDWC+VE +G EG   F+E+PS
Sbjct  627  HGGFLTTHLIGQAPDTFVAAAARNPVCNLSLMVGTSDIPDWCFVEIYGKEGKKYFSESPS  686

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HI+KVKTPTL LLGA+DLRVPVS GLQYARALKE+G+E K I FPE
Sbjct  687  VDDLCQFHQKSPISHIAKVKTPTLFLLGAQDLRVPVSNGLQYARALKERGIETKTIIFPE  746

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D+HGI++PQSDFESFLNIGVWFKK+
Sbjct  747  DIHGIDKPQSDFESFLNIGVWFKKH  771



>ref|XP_011091094.1| PREDICTED: acylamino-acid-releasing enzyme-like [Sesamum indicum]
Length=828

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE+FAAAAARNPVCNL+LMVGTTDIPDWCY E +GSEG   FTE+PS
Sbjct  682  HGGFLTTHLIGQAPERFAAAAARNPVCNLSLMVGTTDIPDWCYFEAYGSEGKSIFTESPS  741

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             EHLA FYSKSPI+HISKV       LGA+DLRVPVS G+QYARALKEKGVE KVI FP 
Sbjct  742  PEHLALFYSKSPISHISKVXXXXXXXLGAQDLRVPVSNGIQYARALKEKGVETKVIVFPH  801

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+HGI+RPQSDFESFLNI VWF KYC
Sbjct  802  DIHGIDRPQSDFESFLNIAVWFNKYC  827



>gb|KEH41014.1| acylamino-acid-releasing enzyme, putative [Medicago truncatula]
Length=1347

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC++E++G++G    TEAPS
Sbjct  461  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFLESYGTKGRDRITEAPS  520

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FYSKSPIAH+SKVKT T+ L+GA+DLRVP+STGLQYARALKEKGV VKVI FP 
Sbjct  521  AEDLTLFYSKSPIAHLSKVKTTTVFLIGAQDLRVPISTGLQYARALKEKGVPVKVILFPN  580

Query  393  DVHGIERPQSDFESFLNIGVWFKK  322
            DVHGIERPQSDFESFL+I  WF  
Sbjct  581  DVHGIERPQSDFESFLSIAAWFNN  604



>ref|XP_011091099.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Sesamum 
indicum]
Length=767

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN ALMVGT+DIPDWC+ E +GSEG   FTE+
Sbjct  619  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFALMVGTSDIPDWCFFEVYGSEGKSIFTES  678

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
             S+E+LA F+SKSPI+H+SKVKTPTL LLGA+DLRVP+  G+QYARALKE GVE KVI F
Sbjct  679  SSAENLALFHSKSPISHVSKVKTPTLFLLGARDLRVPIYDGIQYARALKENGVETKVIMF  738

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
            P DVH I+RPQSDFESFL IG WFKKYC
Sbjct  739  PNDVHAIKRPQSDFESFLTIGAWFKKYC  766



>ref|XP_011091095.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091096.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091097.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Sesamum 
indicum]
 ref|XP_011091098.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Sesamum 
indicum]
Length=768

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KFAAAAARNPVCN ALMVGT+DIPDWC+ E +GSEG   FTE+
Sbjct  620  ISHGGFLTTHLIGQAPDKFAAAAARNPVCNFALMVGTSDIPDWCFFEVYGSEGKSIFTES  679

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
             S+E+LA F+SKSPI+H+SKVKTPTL LLGA+DLRVP+  G+QYARALKE GVE KVI F
Sbjct  680  SSAENLALFHSKSPISHVSKVKTPTLFLLGARDLRVPIYDGIQYARALKENGVETKVIMF  739

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
            P DVH I+RPQSDFESFL IG WFKKYC
Sbjct  740  PNDVHAIKRPQSDFESFLTIGAWFKKYC  767



>ref|XP_008368386.1| PREDICTED: LOW QUALITY PROTEIN: acylamino-acid-releasing enzyme-like 
[Malus domestica]
Length=788

 Score =   239 bits (610),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 5/152 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ PEKF  AA RNP CNLALMVGTTDIPDWCYVE +GSEG  SFTEAPS
Sbjct  637  HGGFLTTHLIGQEPEKFVVAATRNPACNLALMVGTTDIPDWCYVEAYGSEGKNSFTEAPS  696

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQ-----YARALKEKGVEVKV  409
            +EHL  F+  SPI+H+SKVKTPTL LLGA+D+R+P+S G +     Y+RALKEKGV VKV
Sbjct  697  AEHLTLFHRMSPISHVSKVKTPTLFLLGAQDIRLPISIGCKXDNTFYSRALKEKGVPVKV  756

Query  408  ISFPEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            I FP D H I+RPQSDFE FLNIGVWFKKY +
Sbjct  757  IXFPHDNHAIDRPQSDFEXFLNIGVWFKKYLS  788



>ref|XP_006661776.1| PREDICTED: acylamino-acid-releasing enzyme-like [Oryza brachyantha]
Length=776

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+ F AA ARNPVCNL+LMVGTTDIPDWC+VE +G EG   F+E PS
Sbjct  629  HGGFLTTHLIGQAPDTFVAAVARNPVCNLSLMVGTTDIPDWCFVEIYGKEGKNYFSEYPS  688

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HISKV TPTL LLGA+DLRVP+S GLQYARALKE+GVE K+I FPE
Sbjct  689  VDDLCQFHQKSPISHISKVSTPTLFLLGAQDLRVPISNGLQYARALKERGVETKIIVFPE  748

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+H +++PQ DFESFLNIGVWFKK+ +
Sbjct  749  DMHSLDKPQCDFESFLNIGVWFKKHMS  775



>ref|NP_001064602.1| Os10g0415600 [Oryza sativa Japonica Group]
 dbj|BAF26516.1| Os10g0415600 [Oryza sativa Japonica Group]
 gb|EEC66944.1| hypothetical protein OsI_33573 [Oryza sativa Indica Group]
Length=775

 Score =   238 bits (607),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP  F AAAARNPVCNL+LMVGTTDIP+WC+VE +G EG   F+E PS
Sbjct  628  HGGFLTTHLIGQAPGTFVAAAARNPVCNLSLMVGTTDIPEWCFVEIYGKEGKNCFSEYPS  687

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HISKV TPTL LLGA+DLRVPVS GLQYAR LKE GVE K+I FPE
Sbjct  688  FDDLCQFHQKSPISHISKVSTPTLFLLGAQDLRVPVSNGLQYARTLKEMGVETKIIVFPE  747

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+HG+++PQSDFESFLNIGVWFKK+ +
Sbjct  748  DMHGLDKPQSDFESFLNIGVWFKKHMS  774



>gb|ABB47613.1| prolyl oligopeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EEE50961.1| hypothetical protein OsJ_31520 [Oryza sativa Japonica Group]
Length=839

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP  F AAAARNPVCNL+LMVGTTDIP+WC+VE +G EG   F+E PS
Sbjct  692  HGGFLTTHLIGQAPGTFVAAAARNPVCNLSLMVGTTDIPEWCFVEIYGKEGKNCFSEYPS  751

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L  F+ KSPI+HISKV TPTL LLGA+DLRVPVS GLQYAR LKE GVE K+I FPE
Sbjct  752  FDDLCQFHQKSPISHISKVSTPTLFLLGAQDLRVPVSNGLQYARTLKEMGVETKIIVFPE  811

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT  313
            D+HG+++PQSDFESFLNIGVWFKK+ +
Sbjct  812  DMHGLDKPQSDFESFLNIGVWFKKHMS  838



>gb|AES96860.2| acylamino-acid-releasing enzyme-like protein, putative [Medicago 
truncatula]
Length=767

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAPEKF AAAA NPVCNLA+MVGTTDIPDWCYVE FG+     F+EA
Sbjct  619  ISHGGFLTTHLIGQAPEKFVAAAAINPVCNLAMMVGTTDIPDWCYVEAFGTTARDCFSEA  678

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+E L  FYSKSPI+H+SKVK PTL LLG +DLRVP   GLQYARALKEKGV+VK+I F
Sbjct  679  PSAEDLTLFYSKSPISHVSKVKAPTLFLLGGQDLRVPKFDGLQYARALKEKGVDVKIIMF  738

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
              DVH ++RPQS++E  LNIGVWF KYC
Sbjct  739  QNDVHALKRPQSEWECILNIGVWFNKYC  766



>ref|XP_003613902.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
Length=810

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAPEKF AAAA NPVCNLA+MVGTTDIPDWCYVE FG+     F+EA
Sbjct  662  ISHGGFLTTHLIGQAPEKFVAAAAINPVCNLAMMVGTTDIPDWCYVEAFGTTARDCFSEA  721

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS+E L  FYSKSPI+H+SKVK PTL LLG +DLRVP   GLQYARALKEKGV+VK+I F
Sbjct  722  PSAEDLTLFYSKSPISHVSKVKAPTLFLLGGQDLRVPKFDGLQYARALKEKGVDVKIIMF  781

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
              DVH ++RPQS++E  LNIGVWF KYC
Sbjct  782  QNDVHALKRPQSEWECILNIGVWFNKYC  809



>ref|XP_007145932.1| hypothetical protein PHAVU_007G280000g [Phaseolus vulgaris]
 gb|ESW17926.1| hypothetical protein PHAVU_007G280000g [Phaseolus vulgaris]
Length=769

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KF AAAA NPVCNLALM+GTTDIPDWCYVE  G++    FTE 
Sbjct  610  ISHGGFLTTHLIGQAPDKFVAAAAINPVCNLALMIGTTDIPDWCYVEACGTKARNCFTEP  669

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS E L  FY KSPI+H+SKVK PTL LLGA+D+RVP   GLQY RALKEKGV+VK+I F
Sbjct  670  PSPEDLTLFYRKSPISHVSKVKAPTLFLLGAQDVRVPNFDGLQYGRALKEKGVDVKIIMF  729

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
              DVH ++RPQSDFESFLNIGVWF KYC
Sbjct  730  ENDVHALKRPQSDFESFLNIGVWFNKYC  757



>gb|EEE50962.1| hypothetical protein OsJ_31521 [Oryza sativa Japonica Group]
Length=675

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY    GSEG    +E+
Sbjct  519  ISHGGFLTTHLIGQAPDRFMVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEGRQHASES  578

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSPIAHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G E++++ F
Sbjct  579  PSPDHLRLFYQKSPIAHISKVKAPLLMLLGGADLRVPISNGLQYARALRERGGEIRIMMF  638

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H I  PQSDFESFLNIGVWFKK+ +
Sbjct  639  PDDIHEINIPQSDFESFLNIGVWFKKHLS  667



>ref|XP_011467699.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X4 [Fragaria 
vesca subsp. vesca]
Length=738

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 126/165 (76%), Gaps = 20/165 (12%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALM--------------------VGTTDIPD  634
            HGGFLTTHLIGQAPEKF AAA RNP CNLALM                    VGTTDIPD
Sbjct  572  HGGFLTTHLIGQAPEKFFAAATRNPACNLALMAPEKFFAAATRNPACNLALMVGTTDIPD  631

Query  633  WCYVETFGSEGILSFTEAPSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGL  454
            WCYVE +G+EG   +TEAPS+EHLA F+ KSPI+HISK KTP L LLGA+D+R+P+ +GL
Sbjct  632  WCYVEAYGTEGKNRYTEAPSAEHLALFHCKSPISHISKAKTPILFLLGAQDIRLPICSGL  691

Query  453  QYARALKEKGVEVKVISFPEDVHGIERPQSDFESFLNIGVWFKKY  319
            QYA+ LKEKGV VKVI FP D H I+RPQSDFESFLNIGVWFK+Y
Sbjct  692  QYAQGLKEKGVTVKVIVFPNDNHPIDRPQSDFESFLNIGVWFKRY  736



>ref|XP_011467689.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=793

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 126/165 (76%), Gaps = 20/165 (12%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALM--------------------VGTTDIPD  634
            HGGFLTTHLIGQAPEKF AAA RNP CNLALM                    VGTTDIPD
Sbjct  627  HGGFLTTHLIGQAPEKFFAAATRNPACNLALMAPEKFFAAATRNPACNLALMVGTTDIPD  686

Query  633  WCYVETFGSEGILSFTEAPSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGL  454
            WCYVE +G+EG   +TEAPS+EHLA F+ KSPI+HISK KTP L LLGA+D+R+P+ +GL
Sbjct  687  WCYVEAYGTEGKNRYTEAPSAEHLALFHCKSPISHISKAKTPILFLLGAQDIRLPICSGL  746

Query  453  QYARALKEKGVEVKVISFPEDVHGIERPQSDFESFLNIGVWFKKY  319
            QYA+ LKEKGV VKVI FP D H I+RPQSDFESFLNIGVWFK+Y
Sbjct  747  QYAQGLKEKGVTVKVIVFPNDNHPIDRPQSDFESFLNIGVWFKRY  791



>gb|ABB47614.1| prolyl oligopeptidase family protein, expressed [Oryza sativa 
Japonica Group]
Length=772

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY    GSEG    +E+
Sbjct  616  ISHGGFLTTHLIGQAPDRFMVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEGRQHASES  675

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSPIAHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G E++++ F
Sbjct  676  PSPDHLRLFYQKSPIAHISKVKAPLLMLLGGADLRVPISNGLQYARALRERGGEIRIMMF  735

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H I  PQSDFESFLNIGVWFKK+ +
Sbjct  736  PDDIHEINIPQSDFESFLNIGVWFKKHLS  764



>ref|NP_001064603.1| Os10g0415800 [Oryza sativa Japonica Group]
 dbj|BAF26517.1| Os10g0415800, partial [Oryza sativa Japonica Group]
Length=782

 Score =   233 bits (594),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY    GSEG    +E+
Sbjct  626  ISHGGFLTTHLIGQAPDRFMVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEGRQHASES  685

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSPIAHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G E++++ F
Sbjct  686  PSPDHLRLFYQKSPIAHISKVKAPLLMLLGGADLRVPISNGLQYARALRERGGEIRIMMF  745

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H I  PQSDFESFLNIGVWFKK+ +
Sbjct  746  PDDIHEINIPQSDFESFLNIGVWFKKHLS  774



>gb|EAY78482.1| hypothetical protein OsI_33574 [Oryza sativa Indica Group]
Length=801

 Score =   233 bits (594),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY    GSEG    +E+
Sbjct  645  ISHGGFLTTHLIGQAPDRFMVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEGRQHASES  704

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSPIAHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G E++++ F
Sbjct  705  PSPDHLRLFYQKSPIAHISKVKAPLLMLLGGADLRVPISNGLQYARALRERGGEIRIMMF  764

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            P+D+H I  PQSDFESFLNIGVWFKK+ +
Sbjct  765  PDDIHEINIPQSDFESFLNIGVWFKKHLS  793



>ref|XP_010551702.1| PREDICTED: acylamino-acid-releasing enzyme [Tarenaya hassleriana]
Length=767

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AA ARNPVCN+A MVG +DIPDWC+ E +G+     FTEAPS
Sbjct  623  HGGFLTTHLIGQAPDKFVAAVARNPVCNIASMVGISDIPDWCFFEAYGNRN--HFTEAPS  680

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L+ F+  SPI+H+SKVKTPTL LLGA+DLRVPVS GLQYARALKEK VEVKV+ FP+
Sbjct  681  PEDLSHFHQMSPISHLSKVKTPTLFLLGAQDLRVPVSNGLQYARALKEKEVEVKVLFFPD  740

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+DFESFLNIGVWFKKYC
Sbjct  741  DNHPLDRPQTDFESFLNIGVWFKKYC  766



>ref|XP_003535932.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Glycine 
max]
 ref|XP_006588523.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Glycine 
max]
 gb|KHN10099.1| Acylamino-acid-releasing enzyme [Glycine soja]
Length=758

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP+KF AAAA NPVCNLALM+GTTDIPDWCYVE  G+     FTE 
Sbjct  610  ISHGGFLTTHLIGQAPDKFVAAAAINPVCNLALMIGTTDIPDWCYVEACGTIAKNCFTEP  669

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS++ L  F SKSPI+H+SKVK PTL LLGA+D+RVP+  GLQYARALKEKGVEVK+I F
Sbjct  670  PSADDLTLFQSKSPISHVSKVKAPTLFLLGAQDIRVPIFDGLQYARALKEKGVEVKIIMF  729

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKYC  316
              DVH ++RPQSD E FL+IGVWF KYC
Sbjct  730  QNDVHALKRPQSDLECFLHIGVWFNKYC  757



>ref|XP_010440446.1| PREDICTED: acylamino-acid-releasing enzyme-like [Camelina sativa]
Length=819

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLA MVG TDIPDWC+VE +G +    +TEAPS
Sbjct  674  HGGFLTTHLIGQAPDKFVAAAARNPVCNLASMVGITDIPDWCFVEAYGDQ--THYTEAPS  731

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L+ F+  SPI+HISKVKTPTL LLG +DLRVP+S G QY RALKEKGVEVKV+ FP 
Sbjct  732  PEDLSRFHQMSPISHISKVKTPTLFLLGTQDLRVPISNGFQYVRALKEKGVEVKVLVFPN  791

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+DFESFLNI VWF KYC
Sbjct  792  DNHPLDRPQTDFESFLNIAVWFNKYC  817



>ref|XP_010450023.1| PREDICTED: acylamino-acid-releasing enzyme-like [Camelina sativa]
Length=818

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLA MVG TDIPDWC+VE +G +    +TEAPS
Sbjct  673  HGGFLTTHLIGQAPDKFVAAAARNPVCNLASMVGITDIPDWCFVEAYGDQ--THYTEAPS  730

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L+ F+  SPI+HISKVKTPTL LLG +DLRVP+S G QY RALKEKGVEVKV+ FP 
Sbjct  731  PEDLSRFHQMSPISHISKVKTPTLFLLGTQDLRVPISNGFQYVRALKEKGVEVKVLVFPN  790

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+DFESFLNI VWF KYC
Sbjct  791  DNHPLDRPQTDFESFLNIAVWFNKYC  816



>ref|NP_193193.2| acylamino acid-releasing enzyme [Arabidopsis thaliana]
 pir||JC8016 acylaminoacyl-peptidase (EC 3.4.19.1) - Arabidopsis thaliana
 dbj|BAC76411.1| acylamino acid-releasing enzyme [Arabidopsis thaliana]
 gb|AEE83461.1| acylamino acid-releasing enzyme [Arabidopsis thaliana]
Length=764

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TEAPS
Sbjct  619  HGGFLTTHLIGQAPDKFVAAAARNPVCNMASMVGITDIPDWCFFEAYGDQS--HYTEAPS  676

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L+ F+  SPI+HISKVKTPTL LLG KDLRVP+S G QY RALKEKGVEVKV+ FP 
Sbjct  677  AEDLSRFHQMSPISHISKVKTPTLFLLGTKDLRVPISNGFQYVRALKEKGVEVKVLVFPN  736

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  737  DNHPLDRPQTDYESFLNIAVWFNKYC  762



>ref|XP_002467246.1| hypothetical protein SORBIDRAFT_01g021960 [Sorghum bicolor]
 gb|EER94244.1| hypothetical protein SORBIDRAFT_01g021960 [Sorghum bicolor]
Length=774

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY+   G+E     +EA
Sbjct  623  ISHGGFLTTHLIGQAPDRFVVAAARNPVCNLSLMIGTTDIPDWCYIVACGTEAKQYASEA  682

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PSS HL  FY KSPIAHISKVK P LMLLG  DLRVP S GLQYAR L+E+G EVK++ F
Sbjct  683  PSSNHLHLFYQKSPIAHISKVKAPLLMLLGGADLRVPASNGLQYARGLRERGGEVKIMMF  742

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  743  PEDIHEINLPRSDFESFLNIGVWFKKH  769



>ref|XP_002870305.1| hypothetical protein ARALYDRAFT_915409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46564.1| hypothetical protein ARALYDRAFT_915409 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TEAPS
Sbjct  618  HGGFLTTHLIGQAPNKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQN--HYTEAPS  675

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            SE L+ F+  SPIAHISK KTPTL LLG++DLRVP+S G QY RALKEKGVEVKV++FP 
Sbjct  676  SEDLSRFHQISPIAHISKAKTPTLFLLGSQDLRVPISNGFQYVRALKEKGVEVKVLAFPN  735

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  736  DNHPLDRPQTDYESFLNIAVWFNKYC  761



>gb|KFK39589.1| hypothetical protein AALP_AA3G264000 [Arabis alpina]
Length=865

 Score =   231 bits (588),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQAP+KF AA ARNPVCNLALMVG +DIPDWC+ E +G   + +FTEAPS
Sbjct  720  HGGFLATHLIGQAPDKFVAAVARNPVCNLALMVGISDIPDWCFFEAYGD--LNNFTEAPS  777

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ L+ F+  SPI+++SKVKTPTL LLGAKDLRVP+S GLQYARALKEKGVEVKV+ FP 
Sbjct  778  ADDLSRFHQMSPISYVSKVKTPTLFLLGAKDLRVPMSNGLQYARALKEKGVEVKVLVFPN  837

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+ FESFLNIG WFKKYC
Sbjct  838  DSHPLDRPQTTFESFLNIGCWFKKYC  863



>ref|XP_010435108.1| PREDICTED: acylamino-acid-releasing enzyme [Camelina sativa]
Length=818

 Score =   230 bits (587),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNLA MVG TDIPDWC+VE +G +    +TEAPS
Sbjct  673  HGGFLTTHLIGQAPDKFVAAAARNPVCNLASMVGITDIPDWCFVEAYGDQ--THYTEAPS  730

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E L  F+  SPI+HISKVKTPTL LLG +DLRVP+S G QY RALKEKGVEVKV+ FP 
Sbjct  731  PEDLFRFHQMSPISHISKVKTPTLFLLGTQDLRVPISNGFQYVRALKEKGVEVKVLVFPN  790

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+DFESFLNI VWF KYC
Sbjct  791  DNHPLDRPQTDFESFLNIAVWFNKYC  816



>ref|XP_010234727.1| PREDICTED: acylamino-acid-releasing enzyme-like [Brachypodium 
distachyon]
 ref|XP_010234728.1| PREDICTED: acylamino-acid-releasing enzyme-like [Brachypodium 
distachyon]
 ref|XP_010234729.1| PREDICTED: acylamino-acid-releasing enzyme-like [Brachypodium 
distachyon]
Length=778

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFL THLIGQAP++FA AAARNPVCNL+LM+GTTDIPDWCY    GSE  +  +E 
Sbjct  630  ISHGGFLATHLIGQAPDRFAVAAARNPVCNLSLMIGTTDIPDWCYAVACGSEAKIDASET  689

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSP+AHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G E+K++ F
Sbjct  690  PSLDHLRLFYQKSPVAHISKVKVPLLMLLGGADLRVPISNGLQYARALRERGGEIKIMLF  749

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
             ED+H I  PQSDFESFLNIGVWFKK+
Sbjct  750  SEDIHEINIPQSDFESFLNIGVWFKKH  776



>ref|XP_010680736.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=710

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+ HLIGQAPE F+ AA  NPVCN ALMVGTTDIPDWC++   GS+G    TEAPS
Sbjct  564  HGGFLSAHLIGQAPEIFSVAAVSNPVCNFALMVGTTDIPDWCFINAHGSDGKAYMTEAPS  623

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E+L  FY KSPI+H+ KVK PTL LLGA+DLRVPV  GLQYARALKE+G+EVK+I FP+
Sbjct  624  KENLNVFYDKSPISHVHKVKAPTLFLLGAQDLRVPVPDGLQYARALKERGIEVKIIMFPD  683

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H I RP+S+FES+LN+ +WFK+YC
Sbjct  684  DIHEISRPRSEFESYLNVAMWFKEYC  709



>ref|XP_010680735.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=765

 Score =   227 bits (579),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+ HLIGQAPE F+ AA  NPVCN ALMVGTTDIPDWC++   GS+G    TEAPS
Sbjct  619  HGGFLSAHLIGQAPEIFSVAAVSNPVCNFALMVGTTDIPDWCFINAHGSDGKAYMTEAPS  678

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E+L  FY KSPI+H+ KVK PTL LLGA+DLRVPV  GLQYARALKE+G+EVK+I FP+
Sbjct  679  KENLNVFYDKSPISHVHKVKAPTLFLLGAQDLRVPVPDGLQYARALKERGIEVKIIMFPD  738

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D+H I RP+S+FES+LN+ +WFK+YC
Sbjct  739  DIHEISRPRSEFESYLNVAMWFKEYC  764



>ref|XP_009773641.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X6 [Nicotiana 
sylvestris]
Length=734

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -2

Query  720  QAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPSSEHLAAFYSKS  541
            QAP+KFAAAAARNPVCNLALMVGTTDIPDWCY E FGSE I +FT APS+EHLA FY KS
Sbjct  599  QAPDKFAAAAARNPVCNLALMVGTTDIPDWCYFEAFGSEAISNFTAAPSAEHLALFYDKS  658

Query  540  PIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPEDVHGIERPQSD  361
            PI+H+SKVK PTLM+LGA+DLRVP++ GLQYA+ALKE G EVKV+ FP+D+H ++RP++D
Sbjct  659  PISHVSKVKAPTLMVLGAQDLRVPITDGLQYAQALKENGAEVKVMMFPDDIHELDRPRTD  718

Query  360  FESFLNIGVWFKKYCT  313
            FESFLN+GVWFKKYC+
Sbjct  719  FESFLNVGVWFKKYCS  734



>emb|CDY08304.1| BnaA05g13150D [Brassica napus]
Length=769

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCNLA MVG TDIPDWC+ E +G      +TEAPS
Sbjct  624  HGGFLTTHLIGQAPNKFVAAAARNPVCNLASMVGITDIPDWCFFEAYGDR--THYTEAPS  681

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G+QY RALKEKGVEVKV+ FP 
Sbjct  682  PEDMSRFHQMSPISHISKVKTPTLFLLGTMDLRVPISNGIQYVRALKEKGVEVKVLVFPN  741

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  742  DNHPLDRPQTDYESFLNIAVWFNKYC  767



>emb|CDY06476.1| BnaC06g11680D [Brassica napus]
Length=824

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCNLA MVG TDIPDWC+ E +G      +TEAPS
Sbjct  679  HGGFLTTHLIGQAPNKFVAAAARNPVCNLASMVGITDIPDWCFFEAYGDR--TRYTEAPS  736

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G+QY RALKEKGVEVKV+ FP 
Sbjct  737  PEDMSRFHQMSPISHISKVKTPTLFLLGTMDLRVPISNGIQYVRALKEKGVEVKVLVFPN  796

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  797  DNHPLDRPQTDYESFLNIAVWFNKYC  822



>ref|XP_001786039.1| predicted protein [Physcomitrella patens]
 gb|EDQ49150.1| predicted protein, partial [Physcomitrella patens]
Length=766

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQAP++FA   ARNPVCN++ MVG TDIPDWCYVE FG +G+ +++EAPS
Sbjct  621  HGGFLATHLIGQAPDRFATGIARNPVCNVSSMVGITDIPDWCYVEAFGKDGLSNYSEAPS  680

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L+  Y  SPIAHIS VK PTL LLGA+D RVPVS G QY +AL+ +G EVKVI FPE
Sbjct  681  VKDLSVLYQISPIAHISNVKVPTLFLLGAQDRRVPVSNGFQYVQALRARGQEVKVIVFPE  740

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            DVH I+RPQSDFESFLNIGVW K++
Sbjct  741  DVHAIDRPQSDFESFLNIGVWLKRF  765



>ref|XP_006414693.1| hypothetical protein EUTSA_v10024477mg [Eutrema salsugineum]
 gb|ESQ56146.1| hypothetical protein EUTSA_v10024477mg [Eutrema salsugineum]
Length=770

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TEAPS
Sbjct  625  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQ--THYTEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPIAHISKVKTPTL LLG +DLRVP+S G QY RALK KGVEVKV  FP 
Sbjct  683  PEDMSRFHQMSPIAHISKVKTPTLFLLGTQDLRVPISNGFQYVRALKAKGVEVKVFVFPN  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  743  DNHPLDRPQTDYESFLNIAVWFNKYC  768



>ref|XP_006285247.1| hypothetical protein CARUB_v10006608mg [Capsella rubella]
 gb|EOA18145.1| hypothetical protein CARUB_v10006608mg [Capsella rubella]
Length=817

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCN+A M+G TDIPDWC+ E +G +    +TEAPS
Sbjct  672  HGGFLTTHLIGQAPSKFVAAAARNPVCNIASMIGITDIPDWCFFEAYGDQ--THYTEAPS  729

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L+ F+  SPI+HISKVKTPTL LLGA+DLRVP+S G QY RALKEKGVEVKV+ FP 
Sbjct  730  AEDLSLFHKMSPISHISKVKTPTLFLLGAQDLRVPISNGFQYVRALKEKGVEVKVLVFPN  789

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D H ++RPQ+D+ESFLNI VWF KY
Sbjct  790  DNHPLDRPQTDYESFLNIAVWFNKY  814



>ref|XP_006297056.1| hypothetical protein CARUB_v10013057mg [Capsella rubella]
 gb|EOA29954.1| hypothetical protein CARUB_v10013057mg [Capsella rubella]
Length=734

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AA ARN VCNLA MVG +DIPDWC+ E +G      FTEAPS
Sbjct  589  HGGFLTTHLIGQAPDKFVAAVARNHVCNLASMVGISDIPDWCFFEAYGDTN--HFTEAPS  646

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L+ F+  SPI+H+SKVKTPTL LLG KDLRVPVS GLQY RALKEKGV++KV+ FP 
Sbjct  647  PDDLSRFHQMSPISHVSKVKTPTLFLLGTKDLRVPVSNGLQYVRALKEKGVQIKVLVFPN  706

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ++FESFLNIG WFKKYC
Sbjct  707  DNHPLDRPQTNFESFLNIGCWFKKYC  732



>ref|XP_009144694.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Brassica 
rapa]
Length=769

 Score =   224 bits (572),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCNLA MVG TDIPDWC+ E +G      +TEAPS
Sbjct  624  HGGFLTTHLIGQAPNKFVAAAARNPVCNLASMVGITDIPDWCFFEAYGDR--THYTEAPS  681

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G+QY RALKEKGVEVKV+ FP 
Sbjct  682  PEDMSRFHQMSPISHISKVKTPTLFLLGTMDLRVPISNGIQYVRALKEKGVEVKVLVFPN  741

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RP++D+ESFLNI VWF KYC
Sbjct  742  DNHPLDRPRTDYESFLNIAVWFNKYC  767



>ref|XP_009144692.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Brassica 
rapa]
 ref|XP_009144693.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Brassica 
rapa]
Length=770

 Score =   224 bits (571),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP KF AAAARNPVCNLA MVG TDIPDWC+ E +G      +TEAPS
Sbjct  625  HGGFLTTHLIGQAPNKFVAAAARNPVCNLASMVGITDIPDWCFFEAYGDR--THYTEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G+QY RALKEKGVEVKV+ FP 
Sbjct  683  PEDMSRFHQMSPISHISKVKTPTLFLLGTMDLRVPISNGIQYVRALKEKGVEVKVLVFPN  742

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RP++D+ESFLNI VWF KYC
Sbjct  743  DNHPLDRPRTDYESFLNIAVWFNKYC  768



>ref|XP_006279108.1| hypothetical protein CARUB_v10012695mg [Capsella rubella]
 gb|EOA12006.1| hypothetical protein CARUB_v10012695mg [Capsella rubella]
Length=763

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AA ARNPVCNLA MVG +DIPDWC+ E +G      FTEAPS
Sbjct  589  HGGFLTTHLIGQAPDKFVAAVARNPVCNLASMVGISDIPDWCFFEAYGDTN--HFTEAPS  646

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L+ F+  SPI+H+SKVKTPTL LLG KDLRVPVS GLQY RALKEKGV +KV+ FP 
Sbjct  647  PDDLSRFHQMSPISHVSKVKTPTLFLLGTKDLRVPVSNGLQYVRALKEKGVPIKVLVFPN  706

Query  393  DVHGIERPQSDFESFLNIGVWFKKYCT*TNELSIF  289
            D H ++RPQ++FESFLNIG WFKKY    + L++F
Sbjct  707  DNHPLDRPQTNFESFLNIGCWFKKYSEEASFLAMF  741



>ref|XP_004983186.1| PREDICTED: acylamino-acid-releasing enzyme-like [Setaria italica]
Length=763

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++F  AAARNPVCNL+LM+GTTDIPDWCY+   G E     +E+
Sbjct  615  ISHGGFLTTHLIGQAPDRFVVAAARNPVCNLSLMIGTTDIPDWCYMVACGPESKQYASES  674

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  FY KSPIAHISKVK P LMLLG  DLRVP S GLQYARAL+E+G  VK++ F
Sbjct  675  PSPDHLHLFYQKSPIAHISKVKAPLLMLLGGADLRVPASNGLQYARALRERGGGVKIMMF  734

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  735  PEDIHEIIIPRSDFESFLNIGVWFKKH  761



>ref|NP_001147818.1| LOC100281428 [Zea mays]
 gb|ACG28799.1| acylamino-acid-releasing enzyme [Zea mays]
Length=783

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EA
Sbjct  632  ISHGGFLTTHLIGQAPDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEA  691

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS  HL  FY +SPIAH+SKVK P LMLLG  DLRVP S GLQYAR+L E+G +VK++ F
Sbjct  692  PSPGHLRLFYQRSPIAHVSKVKAPLLMLLGGADLRVPASNGLQYARSLIERGGDVKIMMF  751

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  752  PEDIHEINLPRSDFESFLNIGVWFKKH  778



>ref|XP_008643608.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 ref|XP_008643609.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 ref|XP_008643610.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 ref|XP_008643611.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 ref|XP_008643612.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 ref|XP_008643613.1| PREDICTED: LOC100281428 isoform X1 [Zea mays]
 gb|AFW68760.1| acylamino-acid-releasing enzyme [Zea mays]
Length=783

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EA
Sbjct  632  ISHGGFLTTHLIGQAPDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEA  691

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS  HL  FY +SPIAH+SKVK P LMLLG  DLRVP S GLQYAR+L E+G +VK++ F
Sbjct  692  PSPGHLRLFYQRSPIAHVSKVKAPLLMLLGGADLRVPASNGLQYARSLIERGGDVKIMMF  751

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  752  PEDIHEINLPRSDFESFLNIGVWFKKH  778



>ref|XP_011467693.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=790

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 123/165 (75%), Gaps = 23/165 (14%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALM--------------------VGTTDIPD  634
            HGGFLTTHLIGQAPEKF AAA RNP CNLALM                    VGTTDIPD
Sbjct  627  HGGFLTTHLIGQAPEKFFAAATRNPACNLALMAPEKFFAAATRNPACNLALMVGTTDIPD  686

Query  633  WCYVETFGSEGILSFTEAPSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGL  454
            WCYVE +G+EG   +TEAPS+EHLA F+ KSPI+HISK KTP L LLGA+D+R+P+ +GL
Sbjct  687  WCYVEAYGTEGKNRYTEAPSAEHLALFHCKSPISHISKAKTPILFLLGAQDIRLPICSGL  746

Query  453  QYARALKEKGVEVKVISFPEDVHGIERPQSDFESFLNIGVWFKKY  319
            Q    LKEKGV VKVI FP D H I+RPQSDFESFLNIGVWFK+Y
Sbjct  747  Q---GLKEKGVTVKVIVFPNDNHPIDRPQSDFESFLNIGVWFKRY  788



>ref|XP_008643614.1| PREDICTED: LOC100281428 isoform X2 [Zea mays]
 gb|AFW68754.1| hypothetical protein ZEAMMB73_676318 [Zea mays]
Length=782

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EA
Sbjct  631  ISHGGFLTTHLIGQAPDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEA  690

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS  HL  FY +SPIAH+SKVK P LMLLG  DLRVP S GLQYAR+L E+G +VK++ F
Sbjct  691  PSPGHLRLFYQRSPIAHVSKVKAPLLMLLGGADLRVPASNGLQYARSLIERGGDVKIMMF  750

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  751  PEDIHEINLPRSDFESFLNIGVWFKKH  777



>emb|CDY53734.1| BnaA08g30180D [Brassica napus]
Length=821

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TEAPS
Sbjct  676  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQ--THYTEAPS  733

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G QY RALKEKG +VKV+ FP 
Sbjct  734  PEDMSLFHQISPISHISKVKTPTLFLLGTVDLRVPISNGFQYVRALKEKGADVKVLVFPN  793

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  794  DNHSLDRPQTDYESFLNIAVWFNKYC  819



>emb|CDY36882.1| BnaC08g09650D [Brassica napus]
Length=820

 Score =   222 bits (566),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TEAPS
Sbjct  675  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQ--THYTEAPS  732

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI++ISKVKTPTL LLG  DLRVP+S G QY RALKEKGVEVK + FP 
Sbjct  733  PEDMSLFHQISPISYISKVKTPTLFLLGTADLRVPISNGFQYVRALKEKGVEVKALVFPN  792

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  793  DNHSLDRPQTDYESFLNIAVWFNKYC  818



>ref|XP_009107785.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Brassica 
rapa]
Length=822

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TE PS
Sbjct  677  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQ--THYTEVPS  734

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G QY RALKEKG +VKV+ FP 
Sbjct  735  PEDMSLFHQISPISHISKVKTPTLFLLGTVDLRVPISNGFQYVRALKEKGADVKVLVFPN  794

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  795  DNHSLDRPQTDYESFLNIAVWFNKYC  820



>ref|XP_009107786.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Brassica 
rapa]
Length=766

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCN+A MVG TDIPDWC+ E +G +    +TE PS
Sbjct  621  HGGFLTTHLIGQAPDKFVAAAARNPVCNIASMVGITDIPDWCFFEAYGDQ--THYTEVPS  678

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL LLG  DLRVP+S G QY RALKEKG +VKV+ FP 
Sbjct  679  PEDMSLFHQISPISHISKVKTPTLFLLGTVDLRVPISNGFQYVRALKEKGADVKVLVFPN  738

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLNI VWF KYC
Sbjct  739  DNHSLDRPQTDYESFLNIAVWFNKYC  764



>ref|XP_001767800.1| predicted protein [Physcomitrella patens]
 gb|EDQ67314.1| predicted protein [Physcomitrella patens]
Length=791

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THL+GQAP++F  A  RNP CNL+ MVG TDIPDWCYVE FG +G+ ++TEAPS
Sbjct  645  HGGFLATHLVGQAPDRFTTAITRNPACNLSSMVGITDIPDWCYVEAFGKDGVANYTEAPS  704

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ L+  Y  SPIA++SKVK P L LLGA+D RVPVS G QY +AL+ +G EVKVI FPE
Sbjct  705  TKDLSVLYRCSPIAYLSKVKVPILFLLGAQDRRVPVSNGFQYVQALRARGQEVKVILFPE  764

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            DVH I+RPQSDFESFLNIGVW K++
Sbjct  765  DVHAIDRPQSDFESFLNIGVWLKRF  789



>ref|XP_004497999.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Cicer 
arietinum]
Length=833

 Score =   221 bits (563),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPEKF AAAARNPVCNLALMVGTTDIPDWC+VE++G++     TEAPS
Sbjct  707  HGGFLTTHLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCFVESYGTKCRDRITEAPS  766

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            +E L  FY+KSPIAH+SKVKTPT+ LLGA+DLRVP+STGLQYARALK KGVEVKVI FP 
Sbjct  767  AEDLTLFYNKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALKAKGVEVKVIVFPN  826

Query  393  DVHGIER  373
            DVHGIER
Sbjct  827  DVHGIER  833



>ref|XP_002978109.1| hypothetical protein SELMODRAFT_268154 [Selaginella moellendorffii]
 gb|EFJ20766.1| hypothetical protein SELMODRAFT_268154 [Selaginella moellendorffii]
Length=765

 Score =   219 bits (559),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLT+HLIGQAP +F     RNPVCN++ MVG TDIPDWCY+E++G  G+  + EAPS
Sbjct  620  HGGFLTSHLIGQAPGRFVTGIVRNPVCNISSMVGITDIPDWCYMESYGKAGLDLYDEAPS  679

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             +HL AFY  SPIAH+ KV+ PT+ LLGA+D RVPVS GLQYA+AL+ +G+EVKVI FP+
Sbjct  680  VKHLGAFYQASPIAHVDKVQVPTMFLLGAQDRRVPVSNGLQYAQALRARGLEVKVIVFPD  739

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D+H I+RPQSDFESF+NIG W K++
Sbjct  740  DIHAIDRPQSDFESFVNIGAWLKRF  764



>ref|XP_002966633.1| hypothetical protein SELMODRAFT_168303 [Selaginella moellendorffii]
 gb|EFJ32660.1| hypothetical protein SELMODRAFT_168303 [Selaginella moellendorffii]
Length=781

 Score =   219 bits (559),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLT+HLIGQAP +F     RNPVCN++ MVG TDIPDWCY+E++G  G+  + EAPS
Sbjct  636  HGGFLTSHLIGQAPGRFVTGIVRNPVCNISSMVGITDIPDWCYMESYGKAGLNLYDEAPS  695

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             +HL AFY  SPIAH+ KV+ PT+ LLGA+D RVPVS GLQYA+AL+ +G+EVKVI FP+
Sbjct  696  VKHLGAFYQASPIAHVDKVQVPTMFLLGAQDRRVPVSNGLQYAQALRARGLEVKVIVFPD  755

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D+H I+RPQSDFESF+NIG W K++
Sbjct  756  DIHAIDRPQSDFESFVNIGAWLKRF  780



>dbj|BAJ86841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAPE+FAAAAARNPVCNL+LM+GTTDIPDWCY    G+E     +E+
Sbjct  617  ISHGGFLTTHLIGQAPERFAAAAARNPVCNLSLMIGTTDIPDWCYAVACGAEARRLASES  676

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            P  +HL   + KSPIAHISKVK P LMLLG  DLRVP S GLQYARAL+E+GVE+K I F
Sbjct  677  PPLDHLRILHQKSPIAHISKVKAPLLMLLGGADLRVPASNGLQYARALRERGVEIKTIMF  736

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED H I+ P+SDFESFLN+GVWF+K+
Sbjct  737  PEDTHEIDIPRSDFESFLNMGVWFRKH  763



>ref|XP_009148621.1| PREDICTED: acylamino-acid-releasing enzyme-like [Brassica rapa]
Length=749

 Score =   213 bits (543),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQAP+KF AAAARNPVCN+A +VG TD PDW +   +G +    +TEAPS
Sbjct  604  HGGFLATHLIGQAPDKFVAAAARNPVCNIASLVGITDTPDWGFFHAYGDKK--HYTEAPS  661

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL +LGA DLRVP+S GLQY RALKEKGVEVKV+ FP 
Sbjct  662  PEDMSRFHQVSPISHISKVKTPTLFILGAMDLRVPISNGLQYMRALKEKGVEVKVLVFPN  721

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLN  VWF KYC
Sbjct  722  DNHPLDRPQTDYESFLNTAVWFNKYC  747



>emb|CDY16282.1| BnaC01g23170D [Brassica napus]
Length=755

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQAP+KF AAAARNPVCN+A +VG TD PDW +   +G +    +TEAPS
Sbjct  610  HGGFLATHLIGQAPDKFVAAAARNPVCNIASLVGITDTPDWGFFHAYGDKK--HYTEAPS  667

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SPI+HISKVKTPTL +LGA DLRVP+S GLQY RALKEKGVEVKV+ FP 
Sbjct  668  PEDMSRFHQVSPISHISKVKTPTLFILGAMDLRVPISNGLQYMRALKEKGVEVKVLVFPN  727

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLN  VWF KYC
Sbjct  728  DNHPLDRPQTDYESFLNTAVWFNKYC  753



>emb|CDY29743.1| BnaA01g19230D [Brassica napus]
Length=749

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQAP+KF AAAARNPVCN+A +VG TD PDW +   +G +    +TEAPS
Sbjct  604  HGGFLATHLIGQAPDKFVAAAARNPVCNIASLVGITDTPDWGFFHAYGDKK--HYTEAPS  661

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E ++ F+  SP++HISKVKTPTL +LGA DLRVP+S GLQY RALKEKGVEVKV+ FP 
Sbjct  662  PEDMSRFHQVSPVSHISKVKTPTLFILGAMDLRVPISNGLQYMRALKEKGVEVKVLVFPN  721

Query  393  DVHGIERPQSDFESFLNIGVWFKKYC  316
            D H ++RPQ+D+ESFLN  VWF KYC
Sbjct  722  DNHPLDRPQTDYESFLNTAVWFNKYC  747



>gb|EMS51145.1| Acylamino-acid-releasing enzyme [Triticum urartu]
Length=826

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAPE F AAAARNPVCNL LMVGTTDIPDWC++E +G EG   FTE+P 
Sbjct  696  HGGFLTTHLIGQAPETFVAAAARNPVCNLQLMVGTTDIPDWCFLEVYGKEGKNCFTESPL  755

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            ++ L  FY KSPI+HISKVKTPTL LLGAKDLRVPVS GLQYARALKE+GV+ K+I FPE
Sbjct  756  ADTLTKFYQKSPISHISKVKTPTLFLLGAKDLRVPVSNGLQYARALKERGVDTKIIVFPE  815

Query  393  DVHGIER  373
            D+HG+++
Sbjct  816  DIHGLDK  822



>tpg|DAA49965.1| TPA: hypothetical protein ZEAMMB73_427246 [Zea mays]
Length=117

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  660  MVGTTDIPDWCYVETFGSEGILSFTEAPSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKD  481
            MVGT+DIPDWC+VE +G EG   F+E+PS + L  F+ KSPI+HI+KVKTPTL LLGA+D
Sbjct  1    MVGTSDIPDWCFVEIYGKEGKKYFSESPSVDDLCQFHQKSPISHIAKVKTPTLFLLGAQD  60

Query  480  LRVPVSTGLQYARALKEKGVEVKVISFPEDVHGIERPQSDFESFLNIGVWFKKY  319
            LRVPVS GLQYARALKE+G+E K I FPED+HGI++PQSDFESFLNIGVWFKK+
Sbjct  61   LRVPVSNGLQYARALKERGIETKTIVFPEDIHGIDKPQSDFESFLNIGVWFKKH  114



>ref|XP_007225868.1| hypothetical protein PRUPE_ppa011753mg [Prunus persica]
 gb|EMJ27067.1| hypothetical protein PRUPE_ppa011753mg [Prunus persica]
Length=197

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  660  MVGTTDIPDWCYVETFGSEGILSFTEAPSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKD  481
            MVGTTDIPDWCYVE +GSE   +FTEAPS+EHL  F+ KSPI+HISKVKTPTL LLGA+D
Sbjct  1    MVGTTDIPDWCYVEAYGSESKNTFTEAPSAEHLTLFHRKSPISHISKVKTPTLFLLGAQD  60

Query  480  LRVPVSTGLQYARALKEKGVEVKVISFPEDVHGIERPQSDFESFLNIGV  334
            +R+PV TGLQYARALKEKGV VKVI FP D H IERPQSDFESFLNIGV
Sbjct  61   VRLPVFTGLQYARALKEKGVPVKVIVFPNDTHAIERPQSDFESFLNIGV  109



>ref|XP_008643616.1| PREDICTED: LOC100281428 isoform X4 [Zea mays]
Length=759

 Score =   197 bits (500),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  717  APEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPSSEHLAAFYSKSP  538
            AP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EAPS  HL  FY +SP
Sbjct  622  APDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEAPSPGHLRLFYQRSP  681

Query  537  IAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPEDVHGIERPQSDF  358
            IAH+SKVK P LMLLG  DLRVP S GLQYAR+L E+G +VK++ FPED+H I  P+SDF
Sbjct  682  IAHVSKVKAPLLMLLGGADLRVPASNGLQYARSLIERGGDVKIMMFPEDIHEINLPRSDF  741

Query  357  ESFLNIGVWFKKY  319
            ESFLNIGVWFKK+
Sbjct  742  ESFLNIGVWFKKH  754



>gb|EMT10968.1| Acylamino-acid-releasing enzyme [Aegilops tauschii]
Length=870

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAPE+FA AAARNPVCNL+LM+GTTDIPDWCY    G+E     +E+
Sbjct  600  ISHGGFLTTHLIGQAPERFAVAAARNPVCNLSLMIGTTDIPDWCYAVACGTEARRLASES  659

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS +HL  F+ KSPIAHISKVK P LMLLG  DLRVP+S GLQYARAL+E+G EVK I F
Sbjct  660  PSLDHLRIFHQKSPIAHISKVKAPLLMLLGGADLRVPMSNGLQYARALRERGGEVKTIMF  719

Query  399  PEDVHGIE  376
            PED H I+
Sbjct  720  PEDTHEID  727



>ref|XP_006297055.1| hypothetical protein CARUB_v10013057mg [Capsella rubella]
 gb|EOA29953.1| hypothetical protein CARUB_v10013057mg [Capsella rubella]
Length=713

 Score =   187 bits (476),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AA ARN VCNLA MVG +DIPDWC+ E +G      FTEAPS
Sbjct  589  HGGFLTTHLIGQAPDKFVAAVARNHVCNLASMVGISDIPDWCFFEAYGDTN--HFTEAPS  646

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             + L+ F+  SPI+H+SKVKTPTL LLG KDLRVPVS GLQY RALKEKGV++KV+ FP 
Sbjct  647  PDDLSRFHQMSPISHVSKVKTPTLFLLGTKDLRVPVSNGLQYVRALKEKGVQIKVLVFPN  706

Query  393  DVHGIER  373
            D H ++R
Sbjct  707  DNHPLDR  713



>gb|KDO53934.1| hypothetical protein CISIN_1g003363mg [Citrus sinensis]
Length=789

 Score =   179 bits (453),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNP+CNLALMVGTTDIPDWCYVE++GS+G  SFTE+PS
Sbjct  680  HGGFLTTHLIGQAPDKFVAAAARNPLCNLALMVGTTDIPDWCYVESYGSKGKDSFTESPS  739

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQ  451
             E L  F+SKSPI+HISKVKTPT+ LLGA+DLRVPVS GLQ
Sbjct  740  VEDLTRFHSKSPISHISKVKTPTIFLLGAQDLRVPVSNGLQ  780


 Score = 43.5 bits (101),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA DHVI+MGLA+PSK+ V+GGS
Sbjct  654  DVLTAIDHVIDMGLANPSKVTVVGGS  679



>ref|XP_008643615.1| PREDICTED: LOC100281428 isoform X3 [Zea mays]
 gb|AFW68759.1| hypothetical protein ZEAMMB73_676318 [Zea mays]
Length=760

 Score =   177 bits (448),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 102/147 (69%), Gaps = 23/147 (16%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EA
Sbjct  632  ISHGGFLTTHLIGQAPDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEA  691

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS  HL  FY +SPIAH+SK                       YAR+L E+G +VK++ F
Sbjct  692  PSPGHLRLFYQRSPIAHVSK-----------------------YARSLIERGGDVKIMMF  728

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            PED+H I  P+SDFESFLNIGVWFKK+
Sbjct  729  PEDIHEINLPRSDFESFLNIGVWFKKH  755



>ref|XP_007034936.1| Acylaminoacyl-peptidase-related isoform 3 [Theobroma cacao]
 gb|EOY05862.1| Acylaminoacyl-peptidase-related isoform 3 [Theobroma cacao]
Length=789

 Score =   172 bits (436),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  743

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYA  445
            +EHL   Y+KSPI+HISKVK PTL LLGA+DLRVPVS GLQ A
Sbjct  744  AEHLTHLYNKSPISHISKVKAPTLFLLGAQDLRVPVSNGLQTA  786


 Score = 40.4 bits (93),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA D+VI  GLA+PSKI VLGGS
Sbjct  658  DVLTAIDYVIEKGLANPSKITVLGGS  683



>ref|XP_007034937.1| Acylaminoacyl-peptidase-related isoform 4 [Theobroma cacao]
 gb|EOY05863.1| Acylaminoacyl-peptidase-related isoform 4 [Theobroma cacao]
Length=732

 Score =   172 bits (435),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  623  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  682

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQ  451
            +EHL   Y+KSPI+HISKVK PTL LLGA+DLRVPVS GLQ
Sbjct  683  AEHLTHLYNKSPISHISKVKAPTLFLLGAQDLRVPVSNGLQ  723


 Score = 40.4 bits (93),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA D+VI  GLA+PSKI VLGGS
Sbjct  597  DVLTAIDYVIEKGLANPSKITVLGGS  622



>ref|XP_001700898.1| acylaminoacyl-peptidase [Chlamydomonas reinhardtii]
 gb|EDP07152.1| acylaminoacyl-peptidase [Chlamydomonas reinhardtii]
Length=864

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 100/155 (65%), Gaps = 8/155 (5%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSE-GILSFTEAP  577
            HGGFLT HL+GQ P  F +   RNPV N++ M+  +DIPDWCYVE  GSE G       P
Sbjct  709  HGGFLTAHLLGQHPAAFRSGVMRNPVTNISAMIAASDIPDWCYVEALGSEAGRQRCGPVP  768

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGV-------E  418
            S E LAA Y+ SP+ ++  VK P  M+LGAKD RVP   GLQY  AL+ + V       E
Sbjct  769  SPEDLAAMYAASPVVYVDAVKAPVFMMLGAKDRRVPPPDGLQYLSALRGRDVAAHGAPPE  828

Query  417  VKVISFPEDVHGIERPQSDFESFLNIGVWFKKYCT  313
             ++I FPED HG+++PQ++FE ++N+  W K++ T
Sbjct  829  SRLIVFPEDSHGLDKPQTEFEQWINVVWWLKRFST  863



>ref|XP_002506400.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67658.1| predicted protein, partial [Micromonas sp. RCC299]
Length=231

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 6/141 (4%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL  HL+GQ P+ F  A  RNPV ++A MV  TDIPDWC+VET G E   ++++ PS
Sbjct  90   HGGFLAAHLVGQRPDVFRCAVLRNPVTDIAAMVPLTDIPDWCFVETLGRE---AYSDLPS  146

Query  573  SEHLAAFYSKSPIAHISKV---KTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
            +E L A    SP+ ++++V     P LMLLG  DLRVP + GL+YA AL+E G   +V  
Sbjct  147  TEALIAMREASPVRYVNEVAKHDRPVLMLLGGVDLRVPPTNGLRYAAALREAGGRCEVRM  206

Query  402  FPEDVHGIERPQSDFESFLNI  340
            FPED HG+  P+++FESF+ +
Sbjct  207  FPEDSHGLLNPRTEFESFVTV  227



>gb|KCW57444.1| hypothetical protein EUGRSUZ_H00222 [Eucalyptus grandis]
Length=760

 Score =   145 bits (366),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL LMVGTTDIPDWCYVE+FGSEG   FTEAPS
Sbjct  679  HGGFLTTHLIGQAPDKFIAAATRNPVCNLGLMVGTTDIPDWCYVESFGSEGKNHFTEAPS  738

Query  573  SEHLAAFYSKSPIAHISKV  517
            +EHL+ FYSKSPI+H+ KV
Sbjct  739  AEHLSLFYSKSPISHLHKV  757


 Score = 43.1 bits (100),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA DH +N+GLA+PS+IAV+GGS
Sbjct  653  DVLTAIDHAVNLGLANPSRIAVVGGS  678



>ref|XP_005645226.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE20682.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
Length=760

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 99/148 (67%), Gaps = 3/148 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGS-EGILSFTEAP  577
            HGGFLT +L+GQ PE+F     RNPV +++LMV  +DIPDWCYVE +GS +G+      P
Sbjct  611  HGGFLTGNLVGQHPERFRCGVLRNPVMDISLMVQLSDIPDWCYVEAWGSKDGLKRAAVKP  670

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARAL--KEKGVEVKVIS  403
            ++E +  F   SPIAH+ KV  P L +LGAKD RVP+    QY +AL  +E   + ++  
Sbjct  671  TAEDIERFRQVSPIAHVDKVTAPLLFMLGAKDRRVPLVDAQQYVKALRAREGAPDARIWV  730

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            FPED H +++PQ+D+E +LN+  W K++
Sbjct  731  FPEDTHSLDKPQTDYEQWLNVAWWLKQH  758



>ref|XP_003063428.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52564.1| predicted protein [Micromonas pusilla CCMP1545]
Length=856

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 98/149 (66%), Gaps = 8/149 (5%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL  HL+GQ PE F AA  RNPV ++A MV  TDIPDWC+VET G +   +F++ P+
Sbjct  700  HGGFLGAHLVGQRPEMFKAAVLRNPVTDVASMVSLTDIPDWCFVETLGKD---AFSDLPT  756

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLR-----VPVSTGLQYARALKEKGVEVKV  409
             E LA    KSP+ ++  V+ P LMLLGA DLR     VP + GL+YA AL+E G    V
Sbjct  757  VEQLAVMREKSPVRYVKDVRAPVLMLLGAVDLRRVLPMVPPTNGLRYAAALREAGGRCDV  816

Query  408  ISFPEDVHGIERPQSDFESFLNIGVWFKK  322
              FPED HG+  P+++FESF+ +  + ++
Sbjct  817  RVFPEDSHGLTLPRTEFESFVTVAKFLRE  845



>gb|KJB38267.1| hypothetical protein B456_006G245500 [Gossypium raimondii]
Length=763

 Score =   140 bits (354),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAAARNPVCNL+ MV TTDIPDWCYVE++GS+G   FTEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAARNPVCNLSSMVATTDIPDWCYVESYGSKGKTIFTEAPS  743

Query  573  SEHLAAFYSKSPIAHISKV  517
            +EHL  FYSKSPI HISKV
Sbjct  744  AEHLTHFYSKSPILHISKV  762


 Score = 40.8 bits (94),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA DHVI  GL +PSKI VLGGS
Sbjct  658  DVLTAIDHVIEKGLVNPSKITVLGGS  683



>ref|XP_001632627.1| predicted protein [Nematostella vectensis]
 gb|EDO40564.1| predicted protein [Nematostella vectensis]
Length=725

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+ HLIGQ P+KF A AARNPV +++ MV  TDIPDWC+VE  G +    +  A  
Sbjct  582  HGGFLSAHLIGQYPDKFRACAARNPVIDISSMVTVTDIPDWCFVEC-GFD--FDYNLATD  638

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            S+ +   + KSPIAH+ KV+TP L+ +GA D RVP S G+ + R L+E+GVE K++ +PE
Sbjct  639  SKTMTDMWEKSPIAHVHKVRTPVLLCIGAVDRRVPPSQGIHFHRVLRERGVETKLLLYPE  698

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            D H +++  ++ + F+N   WF ++
Sbjct  699  DAHPLDKVGTESDVFVNTVRWFHEH  723



>ref|XP_002181396.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47319.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=206

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLT H   Q P  F AAA RNPV N+  MV +TDIPDWCYVE  GS     +   P+
Sbjct  60   HGGFLTGHCTSQYPNLFKAAAMRNPVVNIPSMVTSTDIPDWCYVEAIGSYNWREYM-PPT  118

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            S  +   + KSPI H+ +V+TPTL+ LG +DLRVP S GL++  +L+ KGV  K++++  
Sbjct  119  STSIRMMWDKSPIRHVDRVQTPTLVALGMQDLRVPPSQGLEWYHSLRSKGVPTKLLTYDG  178

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            + H I   +++ + ++NI  WF  +
Sbjct  179  NDHAIAGVKAEADHWVNIKQWFDNH  203



>emb|CBJ49173.1| conserved unknown protein [Ectocarpus siliculosus]
Length=785

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = -2

Query  744  FLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFT--EAPSS  571
            FL  HL  Q PE F A A RNPV N+A MV  +DIPDWCYVE  G  G  +F   + P++
Sbjct  641  FLGAHLTAQHPEIFKATALRNPVTNIASMVTVSDIPDWCYVEALGC-GKYNFDAFKTPTA  699

Query  570  EHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPED  391
            E L   +  SP+AHI  V  PTL+ LGAKD RVP S GL++  AL+ +GV+ K++ +PED
Sbjct  700  EDLHEMWKASPVAHIDGVVAPTLVALGAKDRRVPHSQGLEWFHALRSRGVKTKLLVYPED  759

Query  390  VHGIERPQSDFESFLNIGVWFKKY  319
            VH I+ P S+ + +LNI  W KK+
Sbjct  760  VHAIDMPASEADQWLNIVGWLKKH  783



>ref|XP_002291357.1| hypothetical protein THAPSDRAFT_262750 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED91464.1| hypothetical protein THAPSDRAFT_262750, partial [Thalassiosira 
pseudonana CCMP1335]
Length=636

 Score =   140 bits (352),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTE--A  580
            HGGFL  HLIGQ PE F  A+ RNP  N+A MV  TDIPDWCYVET G  G  ++++   
Sbjct  490  HGGFLAGHLIGQHPELFKVASMRNPCMNIASMVTATDIPDWCYVETLGP-GKYNWSDYRT  548

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            P+ E L   + KSPIAH+  VK PTL+ LG  D RVP S GL+Y  A++ K V  K++ +
Sbjct  549  PTKEELGVMWDKSPIAHLDNVKAPTLIGLGMMDKRVPPSQGLEYFHAVRAKNVPAKLLVY  608

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
             +  H I+R +S+ + ++N   WF ++
Sbjct  609  EDCDHAIDRIKSEADFWINTKQWFDEH  635


 Score = 36.6 bits (83),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+ A  HVI MGL DP ++ V GGS
Sbjct  464  DVVAATRHVIEMGLVDPERVGVCGGS  489



>ref|XP_007034939.1| Acylaminoacyl-peptidase-related isoform 6 [Theobroma cacao]
 gb|EOY05865.1| Acylaminoacyl-peptidase-related isoform 6 [Theobroma cacao]
Length=764

 Score =   135 bits (340),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  743

Query  573  SEHLAAFYSKSPIAHISKV  517
            +EHL   Y+KSPI+HISKV
Sbjct  744  AEHLTHLYNKSPISHISKV  762


 Score = 40.4 bits (93),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA D+VI  GLA+PSKI VLGGS
Sbjct  658  DVLTAIDYVIEKGLANPSKITVLGGS  683



>ref|XP_002958853.1| hypothetical protein VOLCADRAFT_100173 [Volvox carteri f. nagariensis]
 gb|EFJ40104.1| hypothetical protein VOLCADRAFT_100173 [Volvox carteri f. nagariensis]
Length=893

 Score =   144 bits (364),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 10/155 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGS-EGILSFTEAP  577
            HGGFLT HL+GQ P  F     RNPV N++ MV  +DIPDWCYVE  GS EG        
Sbjct  710  HGGFLTAHLLGQHPGAFRCGVMRNPVTNISAMVAASDIPDWCYVEVLGSEEGCRRAAPVA  769

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGV--------  421
            +   LAA Y  SP++++  V  P  M+LGA+D RVP   GLQY  AL+ + V        
Sbjct  770  TPADLAAMYGASPVSYVDSVTAPVFMMLGARDRRVPPLDGLQYLSALRGRDVGAAGAAPP  829

Query  420  -EVKVISFPEDVHGIERPQSDFESFLNIGVWFKKY  319
               ++I FPED HG+++PQ++FE ++N+  W K Y
Sbjct  830  PPTRLIVFPEDSHGLDKPQTEFEQWINVVWWLKSY  864



>gb|ABQ22534.1| acylamino acid-releasing enzyme-like protein [Callithrix jacchus]
Length=190

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  46   HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  100

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  101  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  159

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + ++F+N  +W + +
Sbjct  160  YPKSTHALSEVEVESDNFMNAVLWLRTH  187



>ref|XP_007034938.1| Acylaminoacyl-peptidase-related isoform 5 [Theobroma cacao]
 gb|EOY05864.1| Acylaminoacyl-peptidase-related isoform 5 [Theobroma cacao]
Length=769

 Score =   134 bits (336),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQAP+KF AAA RNPVCNL+ MVG TDIPDWCYVE++GS G   +TEAPS
Sbjct  684  HGGFLTTHLIGQAPDKFVAAAVRNPVCNLSSMVGITDIPDWCYVESYGSNGKSIYTEAPS  743

Query  573  SEHLAAFYSKSPIAHISK  520
            +EHL   Y+KSPI+HISK
Sbjct  744  AEHLTHLYNKSPISHISK  761


 Score = 40.4 bits (93),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  832  DVITAXDHVINMGLADPSKIAVLGGS  755
            DV+TA D+VI  GLA+PSKI VLGGS
Sbjct  658  DVLTAIDYVIEKGLANPSKITVLGGS  683



>gb|AAH34199.1| Apeh protein, partial [Mus musculus]
Length=244

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  100  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  155

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  156  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  215

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  216  KSTHALSEVEVESDSFMNTVLWLHTH  241



>gb|ABQ22787.1| acylamino acid-releasing enzyme-like protein [Callithrix jacchus]
Length=187

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 93/150 (62%), Gaps = 12/150 (8%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  43   HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  97

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  98   -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  156

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            +P+  H +   + + ++F+N  +W    CT
Sbjct  157  YPKSTHALSEVEVESDNFMNAVLWL---CT  183



>gb|EJK69297.1| hypothetical protein THAOC_09459 [Thalassiosira oceanica]
Length=772

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTE--A  580
            HGGFL  HLIGQ PE F  A  RNP  N+A MV  TDIPDWCYVET G  G   F+    
Sbjct  626  HGGFLAGHLIGQHPELFKVACMRNPCTNIASMVTATDIPDWCYVETLG-PGTYDFSRFSG  684

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            PS + L   +  SPIA+++ VK PTL+ LG KD RVP S GL+Y  AL+ KGV  K++ +
Sbjct  685  PSRQELEKMWESSPIAYLANVKAPTLVALGMKDRRVPPSQGLEYYHALRAKGVTTKLLVY  744

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
             E  H I+   S+ + ++NI  +F K+
Sbjct  745  EECDHAIDLVASETDHWINIKQFFDKH  771



>ref|XP_011668031.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Strongylocentrotus 
purpuratus]
 ref|XP_011668032.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Strongylocentrotus 
purpuratus]
Length=719

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+TH+IGQ P+ + A   RNPV NLA M+G TDIP W   E     GI   F  AP
Sbjct  577  HGGFLSTHMIGQYPDFYKACVTRNPVTNLAAMLGGTDIPSWTMTEA----GIDFDFKIAP  632

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            S+E  A  ++ SP+AHI KVK PTL++LG+ DLRVP   G++Y   LK +GV+ +++ +P
Sbjct  633  SAEMYAKMFNCSPMAHIDKVKAPTLLMLGSDDLRVPPQQGIRYHEMLKARGVKTRLLMYP  692

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ++ H I +  ++ + F+N+  W  ++
Sbjct  693  DNSHPINKVDAEADCFMNMYTWITEH  718



>ref|XP_007420713.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Python 
bivittatus]
 ref|XP_007420714.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Python 
bivittatus]
Length=727

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 93/147 (63%), Gaps = 7/147 (5%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA--  580
            HGGFL+ HLIGQ P  + A AARNPV N+A M+G+TDIPDWC  E       L + +A  
Sbjct  584  HGGFLSCHLIGQYPGTYKACAARNPVVNMASMIGSTDIPDWCMTEVG-----LPYDQAAL  638

Query  579  PSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISF  400
            P  EH A     SP+ ++ KV+ P L+++G +D RVP   GL+Y RALK +GV  +V+ +
Sbjct  639  PVPEHWAKMLLHSPMQYVDKVQAPVLLMIGEEDRRVPPKQGLEYYRALKSRGVPTRVLWY  698

Query  399  PEDVHGIERPQSDFESFLNIGVWFKKY  319
            P D H +   +++ + F+NI +W  ++
Sbjct  699  PGDNHALSSVEAEADCFMNIALWLLQH  725



>ref|XP_005730746.1| PREDICTED: acylamino-acid-releasing enzyme-like [Pundamilia nyererei]
Length=703

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y+    S G   S+ + P
Sbjct  561  HGGFLACHLLGQYPESYRVCAARNPVINAATLLGTSDIVDWRYI----SAGFHYSYDQIP  616

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  617  TAEALAAMLQKSPIAHAAKIKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  676

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  677  EDGHSLSRVDTQVDCFLNTALWLHQH  702



>ref|XP_008569783.1| PREDICTED: acylamino-acid-releasing enzyme [Galeopterus variegatus]
Length=783

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VET   + S+ +     
Sbjct  639  HGGFLSCHLIGQYPENYSACVARNPVINIASMIGSTDIPDWCVVETGFPYSSDHL-----  693

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSP+ +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  694  -PDLSVWAEMLDKSPVKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLL  752

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  753  YPKSTHALSEVEVESDSFMNAVLWLRTH  780



>ref|XP_002111936.1| hypothetical protein TRIADDRAFT_24080 [Trichoplax adhaerens]
 gb|EDV25903.1| hypothetical protein TRIADDRAFT_24080, partial [Trichoplax adhaerens]
Length=524

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (65%), Gaps = 3/144 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL TH++GQ P+ F A A RNPV ++A M+  TDIPDWCYVE         F    S
Sbjct  382  HGGFLGTHMVGQFPDLFKACAVRNPVTDIASMLNVTDIPDWCYVEAGFK---WDFRNLSS  438

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
            S+  +   ++SP+ +IS+V+TPTL+LLG  D RVP   G ++ RALK +G+E +++S+P 
Sbjct  439  SDVYSKMINQSPMNYISQVRTPTLILLGEDDERVPPYQGREFFRALKARGIETRLLSYPG  498

Query  393  DVHGIERPQSDFESFLNIGVWFKK  322
            + H +   + + + F+N+  WF +
Sbjct  499  NNHSLSEVECEADVFMNVVNWFSR  522



>ref|XP_010588098.1| PREDICTED: acylamino-acid-releasing enzyme isoform X4 [Loxodonta 
africana]
Length=712

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  568  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  622

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  623  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARKVPVRLLL  681

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  HG+   + + +SF+N  +W + +
Sbjct  682  YPKSTHGLSEVEVESDSFMNAVLWLRTH  709



>gb|AFW68758.1| hypothetical protein ZEAMMB73_676318 [Zea mays]
Length=803

 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 81/140 (58%), Gaps = 37/140 (26%)
 Frame = -2

Query  759  VPHGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA  580
            + HGGFLTTHLIGQAP++FA AAARNPVCNL+LM GTTDIPDWCYV   G++     +EA
Sbjct  632  ISHGGFLTTHLIGQAPDRFAVAAARNPVCNLSLMAGTTDIPDWCYVVACGTQAKRYASEA  691

Query  579  PSSEHLAAFYSKSPIAHISK-------------------------------------VKT  511
            PS  HL  FY +SPIAH+SK                                     VK 
Sbjct  692  PSPGHLRLFYQRSPIAHVSKVCCFSPACLLLSYQLVDLIVVLVVRTVDGALLSESVQVKA  751

Query  510  PTLMLLGAKDLRVPVSTGLQ  451
            P LMLLG  DLRVP S GLQ
Sbjct  752  PLLMLLGGADLRVPASNGLQ  771



>ref|XP_010588097.1| PREDICTED: acylamino-acid-releasing enzyme isoform X3 [Loxodonta 
africana]
Length=722

 Score =   137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  578  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  632

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  633  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARKVPVRLLL  691

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  HG+   + + +SF+N  +W + +
Sbjct  692  YPKSTHGLSEVEVESDSFMNAVLWLRTH  719



>ref|XP_003409701.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Loxodonta 
africana]
Length=732

 Score =   137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARKVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  HG+   + + +SF+N  +W + +
Sbjct  702  YPKSTHGLSEVEVESDSFMNAVLWLRTH  729



>ref|XP_010588099.1| PREDICTED: acylamino-acid-releasing enzyme isoform X5 [Loxodonta 
africana]
Length=696

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  552  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  606

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  607  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARKVPVRLLL  665

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  HG+   + + +SF+N  +W + +
Sbjct  666  YPKSTHGLSEVEVESDSFMNAVLWLRTH  693



>ref|XP_010091255.1| hypothetical protein L484_010282 [Morus notabilis]
 gb|EXB44176.1| hypothetical protein L484_010282 [Morus notabilis]
Length=100

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 74/116 (64%), Gaps = 26/116 (22%)
 Frame = -2

Query  720  QAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPSSEHLAAFYSKS  541
            QAP+KFAAAA RNPVCNLALMVGTTDIPDW Y ET+GS G  SFTEAPS+E L A Y KS
Sbjct  3    QAPDKFAAAAVRNPVCNLALMVGTTDIPDWAYFETYGSLGKNSFTEAPSAEDLIALYKKS  62

Query  540  PIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPEDVHGIER  373
            PI+H+SK                           LKE+G  VK I FP+D+H I+R
Sbjct  63   PISHLSK--------------------------ELKERGGNVKTIMFPDDIHEIDR  92



>ref|XP_010588096.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Loxodonta 
africana]
Length=740

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  596  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  650

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  651  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARKVPVRLLL  709

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  HG+   + + +SF+N  +W + +
Sbjct  710  YPKSTHGLSEVEVESDSFMNAVLWLRTH  737



>ref|XP_006785463.1| PREDICTED: acylamino-acid-releasing enzyme-like [Neolamprologus 
brichardi]
Length=703

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y     S G   S+ + P
Sbjct  561  HGGFLACHLLGQYPESYKVCAARNPVINAATLLGTSDIVDWRYT----SAGFHYSYDQIP  616

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  617  TAEALAAMLQKSPIAHAAKIKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  676

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  677  EDGHSLSRVDTQVDCFLNTALWLHQH  702



>ref|XP_005937909.1| PREDICTED: acylamino-acid-releasing enzyme-like [Haplochromis 
burtoni]
Length=703

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y     S G   S+ + P
Sbjct  561  HGGFLACHLLGQYPESYRVCAARNPVINAATLLGTSDIVDWRYT----SAGFHYSYDQIP  616

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  617  TAEALAAMLQKSPIAHAAKIKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  676

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  677  EDGHSLSRVDTQVDCFLNTALWLHQH  702



>ref|XP_004554076.1| PREDICTED: acylamino-acid-releasing enzyme-like [Maylandia zebra]
Length=703

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y     S G   S+ + P
Sbjct  561  HGGFLACHLLGQYPESYRVCAARNPVINAATLLGTSDIVDWRYT----SAGFHYSYDQIP  616

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  617  TAEALAAMLQKSPIAHAAKIKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  676

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  677  EDGHSLSRVDTQVDCFLNTALWLHQH  702



>ref|XP_011531963.1| PREDICTED: acylamino-acid-releasing enzyme isoform X8 [Homo sapiens]
 ref|XP_011531964.1| PREDICTED: acylamino-acid-releasing enzyme isoform X8 [Homo sapiens]
 ref|XP_011531965.1| PREDICTED: acylamino-acid-releasing enzyme isoform X8 [Homo sapiens]
 gb|EAW64998.1| N-acylaminoacyl-peptide hydrolase, isoform CRA_d [Homo sapiens]
Length=537

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  393  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  447

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  448  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  506

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  507  YPKSTHALSEVEVESDSFMNAVLWLRTH  534



>ref|XP_003963327.2| PREDICTED: acylamino-acid-releasing enzyme-like [Takifugu rubripes]
Length=728

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 94/145 (65%), Gaps = 3/145 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL  HLIGQ P  +    ARNPV NLA M+G+TDIPDWC VE  G +   S  + P 
Sbjct  586  HGGFLACHLIGQYPGFYKVCVARNPVINLASMIGSTDIPDWCMVEA-GYD--YSTGDLPD  642

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E  A   +KSPI H+++V+TP L+LLG +D RVP   G++Y RALK K V V+++ +P 
Sbjct  643  PEVWAQMLNKSPIKHVTQVQTPVLLLLGEEDKRVPNKQGIEYYRALKAKQVPVQLLWYPG  702

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            + H + +  ++ + F+N+ +W  ++
Sbjct  703  NNHSLSKVDAESDGFMNVALWIVQH  727



>ref|XP_004451929.1| PREDICTED: acylamino-acid-releasing enzyme isoform 3 [Dasypus 
novemcinctus]
Length=732

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE + A  ARNPV N+A M G+TDIPDWC VET   + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYGACVARNPVINIASMAGSTDIPDWCVVETGFPYSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P +   A    KSPI +I +VKTP L++LG +D RVP   GL+Y RALK   V V+++ 
Sbjct  643  -PDASVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFRQGLEYYRALKAWKVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            +P+  H +   + + +SF+N  +W + + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTHLS  731



>ref|XP_003444889.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X1 [Oreochromis 
niloticus]
Length=703

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y     S G   S+ + P
Sbjct  561  HGGFLACHLLGQYPESYRVCAARNPVINAATLLGTSDIVDWRYT----SAGFHYSYDQIP  616

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  617  TAEALAAMLQKSPIAHAAKMKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  676

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  677  EDGHSLSRVDTQVDCFLNTALWLHQH  702



>gb|EDL21267.1| acylpeptide hydrolase, isoform CRA_b, partial [Mus musculus]
Length=541

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  397  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  452

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  453  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  512

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  513  KSTHALSEVEVESDSFMNTVLWLHTH  538



>ref|XP_008970507.1| PREDICTED: acylamino-acid-releasing enzyme isoform X3 [Pan paniscus]
 ref|XP_009443782.1| PREDICTED: acylamino-acid-releasing enzyme isoform X3 [Pan troglodytes]
Length=631

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  487  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  541

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  542  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  600

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  601  YPKSTHALSEVEVESDSFMNAVLWLRTH  628



>ref|XP_011620093.1| PREDICTED: acylamino-acid-releasing enzyme [Takifugu rubripes]
 ref|XP_011620094.1| PREDICTED: acylamino-acid-releasing enzyme [Takifugu rubripes]
Length=712

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE + A A RNPV N A ++GT+DI DW Y     S G+  S+ E P
Sbjct  570  HGGFLSCHLIGQYPEFYRACAVRNPVINAATLLGTSDIVDWRYT----SVGLQYSYQEIP  625

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPI H +++K P L++LG +D RV    GL+  RALK +   V+++ FP
Sbjct  626  TAEALAAMLEKSPITHAAQIKAPVLLMLGGRDRRVNPHQGLELYRALKSRASPVRLLWFP  685

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W +++
Sbjct  686  EDGHSLSRVDTQADCFLNTALWLQQH  711



>ref|XP_006511786.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Mus musculus]
Length=597

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  453  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  508

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  509  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  568

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  569  KSTHALSEVEVESDSFMNTVLWLHTH  594



>ref|XP_005265155.1| PREDICTED: acylamino-acid-releasing enzyme isoform X7 [Homo sapiens]
Length=631

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  487  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  541

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  542  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  600

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  601  YPKSTHALSEVEVESDSFMNAVLWLRTH  628



>ref|XP_005478404.1| PREDICTED: acylamino-acid-releasing enzyme-like isoform X2 [Oreochromis 
niloticus]
Length=747

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL  HL+GQ PE +   AARNPV N A ++GT+DI DW Y     S G   S+ + P
Sbjct  605  HGGFLACHLLGQYPESYRVCAARNPVINAATLLGTSDIVDWRYT----SAGFHYSYDQIP  660

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPIAH +K+K P L++LG +D RV    G++  +ALK +G  V+++ FP
Sbjct  661  TAEALAAMLQKSPIAHAAKMKAPVLLMLGGRDRRVSPHQGMELYKALKSRGSPVRLLWFP  720

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  721  EDGHSLSRVDTQVDCFLNTALWLHQH  746



>ref|XP_004451927.1| PREDICTED: acylamino-acid-releasing enzyme isoform 1 [Dasypus 
novemcinctus]
Length=757

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE + A  ARNPV N+A M G+TDIPDWC VET   + S+ +     
Sbjct  613  HGGFLSCHLIGQYPETYGACVARNPVINIASMAGSTDIPDWCVVETGFPYSSDCL-----  667

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P +   A    KSPI +I +VKTP L++LG +D RVP   GL+Y RALK   V V+++ 
Sbjct  668  -PDASVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFRQGLEYYRALKAWKVPVRLLL  726

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKYCT  313
            +P+  H +   + + +SF+N  +W + + +
Sbjct  727  YPKSTHALSEVEVESDSFMNAVLWLRTHLS  756



>gb|AAH26594.1| Apeh protein, partial [Mus musculus]
Length=587

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  443  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  498

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  499  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  558

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  559  KSTHALSEVEVESDSFMNTVLWLHTH  584



>ref|XP_011889121.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Cercocebus 
atys]
Length=686

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  542  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  596

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  597  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  655

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  656  YPKSTHALSEVEVESDSFMNAVLWLRTH  683



>ref|XP_009049577.1| hypothetical protein LOTGIDRAFT_201138 [Lottia gigantea]
 gb|ESO99718.1| hypothetical protein LOTGIDRAFT_201138 [Lottia gigantea]
Length=714

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFLTTHLIGQ P+ F A   RNPV NL +M G TDIPDW YVE+ G +   S    PS
Sbjct  572  HGGFLTTHLIGQYPDFFQAGCCRNPVTNLTVMTGVTDIPDWVYVES-GFDYNHSCLLNPS  630

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
              +    + +SPI ++ +VK P L+++G  DLRVP S   +Y RALK + ++ ++I + +
Sbjct  631  --YSEEMWKRSPIRYVDQVKAPLLLMIGKDDLRVPPSQAKEYYRALKTRNIKTRLIEYED  688

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            + H I +  S+ ++F+NI +W+K++
Sbjct  689  NCHPIVKVDSEADAFVNIMLWYKEH  713



>ref|XP_005265154.1| PREDICTED: acylamino-acid-releasing enzyme isoform X6 [Homo sapiens]
Length=686

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  542  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  596

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  597  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  655

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  656  YPKSTHALSEVEVESDSFMNAVLWLRTH  683



>ref|XP_004715221.1| PREDICTED: acylamino-acid-releasing enzyme [Echinops telfairi]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA-P  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+A MVG+TDIPDWC VE     G    T+  P
Sbjct  588  HGGFLSCHLIGQYPETYSACVARNPVVNIASMVGSTDIPDWCMVEA----GFPYSTDCLP  643

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                 A    KSPI + SKVKTP L++LG +D RVP   G++Y RALK + V V+++ +P
Sbjct  644  DLSVWAEMLGKSPIKYASKVKTPLLLMLGQEDRRVPFKQGIEYYRALKARNVPVRLLLYP  703

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +S +N  +W + +
Sbjct  704  KSTHTLSEVEVESDSLMNAVLWLRTH  729



>ref|XP_010770546.1| PREDICTED: acylamino-acid-releasing enzyme-like [Notothenia coriiceps]
Length=155

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA-P  577
            HGGFL  HLIGQ P  + A  +RNPV NLA M+G+TDIPDWC VE     G    T+  P
Sbjct  11   HGGFLACHLIGQYPGFYKACVSRNPVTNLASMIGSTDIPDWCMVEA----GFDYTTDCLP  66

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                     +KSPI ++++V+TP L+ LG  D RVP   G++Y RAL+ K V V+++ +P
Sbjct  67   DPAVWEQMLNKSPIRYVTQVQTPVLLTLGEDDKRVPSKQGIEYYRALQAKKVPVRLLWYP  126

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
             + H + +  ++ + F+NI +W  ++
Sbjct  127  GNNHSLSKVDAESDGFMNIALWIIQH  152



>ref|XP_003894462.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Papio 
anubis]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_004034203.1| PREDICTED: acylamino-acid-releasing enzyme [Gorilla gorilla gorilla]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_011836281.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Mandrillus 
leucophaeus]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_011889120.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Cercocebus 
atys]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_011794461.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Colobus 
angolensis palliatus]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_010367973.1| PREDICTED: acylamino-acid-releasing enzyme [Rhinopithecus roxellana]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|NP_001248664.1| acylamino-acid-releasing enzyme [Macaca mulatta]
 ref|XP_005547206.1| PREDICTED: acylamino-acid-releasing enzyme [Macaca fascicularis]
 ref|XP_011737659.1| PREDICTED: acylamino-acid-releasing enzyme [Macaca nemestrina]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_001165665.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Pan troglodytes]
 ref|XP_003818900.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Pan paniscus]
 ref|XP_009443781.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Pan troglodytes]
Length=732

 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>gb|AAF37321.1|AF141383_1 oxidized protein hydrolase [Homo sapiens]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_005410263.1| PREDICTED: acylamino-acid-releasing enzyme [Chinchilla lanigera]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 92/145 (63%), Gaps = 9/145 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+G+     
Sbjct  588  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYNSDGL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDRSVWAEMLDKSPIRYIPQVKTPLLLMLGHEDRRVPFKQGIEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWF  328
            +P+  H +   + + +S +N  +W 
Sbjct  702  YPKSAHALSEVEVESDSLMNAVLWL  726



>ref|NP_001631.3| acylamino-acid-releasing enzyme [Homo sapiens]
 ref|XP_011531962.1| PREDICTED: acylamino-acid-releasing enzyme isoform X1 [Homo sapiens]
 sp|P13798.4|ACPH_HUMAN RecName: Full=Acylamino-acid-releasing enzyme; Short=AARE; AltName: 
Full=Acyl-peptide hydrolase; Short=APH; AltName: Full=Acylaminoacyl-peptidase; 
AltName: Full=Oxidized protein hydrolase; 
Short=OPH [Homo sapiens]
 gb|AAH00362.1| N-acylaminoacyl-peptide hydrolase [Homo sapiens]
 gb|AAH01826.1| N-acylaminoacyl-peptide hydrolase [Homo sapiens]
 gb|AAH01499.1| N-acylaminoacyl-peptide hydrolase [Homo sapiens]
 gb|EAW64995.1| N-acylaminoacyl-peptide hydrolase, isoform CRA_b [Homo sapiens]
 gb|EAW64996.1| N-acylaminoacyl-peptide hydrolase, isoform CRA_b [Homo sapiens]
 gb|ABM82344.1| N-acylaminoacyl-peptide hydrolase [synthetic construct]
 gb|ABM85518.1| N-acylaminoacyl-peptide hydrolase [synthetic construct]
 gb|AIC54016.1| APEH, partial [synthetic construct]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_003257122.1| PREDICTED: acylamino-acid-releasing enzyme [Nomascus leucogenys]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGIEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_002813789.1| PREDICTED: acylamino-acid-releasing enzyme [Pongo abelii]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_008061380.1| PREDICTED: acylamino-acid-releasing enzyme [Tarsius syrichta]
Length=800

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 94/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  656  HGGFLSCHLIGQYPETYSACVARNPVINIATMLGSTDIPDWCVVEAGFPYSSDYL-----  710

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V ++++ 
Sbjct  711  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARNVPIRLLL  769

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  770  YPKSTHALSEVEVESDSFMNTVLWLRTH  797



>ref|XP_002936520.1| PREDICTED: acylamino-acid-releasing enzyme [Xenopus (Silurana) 
tropicalis]
Length=730

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 92/148 (62%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ P  + A  ARNPV N+  MVG+TDIPDWC VE+   + SE +     
Sbjct  584  HGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETL-----  638

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P          KSPI ++S+VKTP L++LG +D RVP   GL+Y RALK  GV  +++ 
Sbjct  639  -PDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLW  697

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P + H + +  ++ + F+NI +W  K+
Sbjct  698  YPGNNHSLAKVDAESDGFMNIALWILKH  725



>dbj|BAA07476.1| acylamino acid-releasing enzyme [Homo sapiens]
Length=732

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  588  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLRTH  729



>ref|XP_008153804.1| PREDICTED: acylamino-acid-releasing enzyme [Eptesicus fuscus]
Length=730

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 3/145 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M G+TDIPDWC VE   S    S    P 
Sbjct  586  HGGFLSCHLIGQYPETYSACVARNPVINIASMWGSTDIPDWCVVEAGFS---YSSDRLPD  642

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
                A    KSP+ +  +VKTP L++LG KD RVP   G++Y RALK + V V+++ +P+
Sbjct  643  LSMWAEMLDKSPLKYSPQVKTPLLLMLGQKDRRVPFKQGIEYYRALKTRNVPVRLLLYPQ  702

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
              H +   + + +SF+N  +W + +
Sbjct  703  STHALSEVEVESDSFMNAVLWLRMH  727



>gb|EHH62250.1| hypothetical protein EGM_20501 [Macaca fascicularis]
Length=786

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  642  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  696

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  697  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  755

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  756  YPKSTHALSEVEVESDSFMNAVLWLRTH  783



>ref|XP_002611296.1| hypothetical protein BRAFLDRAFT_210907 [Branchiostoma floridae]
 gb|EEN67306.1| hypothetical protein BRAFLDRAFT_210907 [Branchiostoma floridae]
Length=716

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 94/145 (65%), Gaps = 3/145 (2%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEAPS  574
            HGGFL THLIGQ P+ + A  ARNPV N+A M G TDIPDWC VE  G E    + + PS
Sbjct  571  HGGFLVTHLIGQFPDTYKACVARNPVINIASMFGITDIPDWCCVEA-GVEP--DYHKPPS  627

Query  573  SEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFPE  394
             E   A  +KSP+ H SK+K PT+++LG  D RVP + G +  R LK +GV  +++ +P+
Sbjct  628  PEVYTAMLTKSPMFHASKIKAPTMIMLGEVDRRVPHTQGKELYRLLKTRGVPARLLVYPD  687

Query  393  DVHGIERPQSDFESFLNIGVWFKKY  319
            + H I +  ++ ++F+NI  WF ++
Sbjct  688  NNHPIAKVDAEADAFVNIYKWFTEH  712



>gb|EDL21269.1| acylpeptide hydrolase, isoform CRA_d, partial [Mus musculus]
Length=718

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 89/143 (62%), Gaps = 5/143 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  574  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  629

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  630  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  689

Query  396  EDVHGIERPQSDFESFLNIGVWF  328
            +  H +   + + +SF+N  +W 
Sbjct  690  KSTHALSEVEVESDSFMNTVLWL  712



>ref|XP_004581523.1| PREDICTED: acylamino-acid-releasing enzyme [Ochotona princeps]
Length=732

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYGACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWADMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSSHALSEVEVESDSFMNTVLWLRMH  729



>gb|AAH25494.1| Acylpeptide hydrolase [Mus musculus]
Length=717

 Score =   134 bits (338),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  573  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  628

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  629  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  688

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  689  KSTHALSEVEVESDSFMNTVLWLHTH  714



>ref|XP_005347945.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Microtus 
ochrogaster]
Length=717

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA-P  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VET    G     +  P
Sbjct  573  HGGFLSCHLIGQYPETYSACIARNPVINIASMMGSTDIPDWCVVET----GFRYSNDCLP  628

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                      KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ +P
Sbjct  629  DLNVWKEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYP  688

Query  396  EDVHGIERPQSDFESFLNIGVWF  328
            +  H +   + + +SF+N  +W 
Sbjct  689  KSTHALSEVEVESDSFMNTVLWL  711



>ref|XP_004625158.1| PREDICTED: acylamino-acid-releasing enzyme [Octodon degus]
Length=732

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYRACVARNPVINIASMMGSTDIPDWCVVEAGFPYNSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGIEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLQTH  729



>ref|XP_011531961.1| PREDICTED: acylamino-acid-releasing enzyme isoform X5 [Homo sapiens]
Length=760

 Score =   135 bits (339),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  616  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  670

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  671  -PDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  729

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  730  YPKSTHALSEVEVESDSFMNAVLWLRTH  757



>gb|EHH16361.1| hypothetical protein EGK_11632 [Macaca mulatta]
Length=858

 Score =   135 bits (340),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGF++ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    F S+ +     
Sbjct  714  HGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCL-----  768

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  769  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLL  827

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  828  YPKSTHALSEVEVESDSFMNAVLWLRTH  855



>ref|XP_004664297.1| PREDICTED: acylamino-acid-releasing enzyme [Jaculus jaculus]
Length=732

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 91/145 (63%), Gaps = 9/145 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE + A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPESYGACVARNPVVNIASMMGSTDIPDWCVVEAGFPYSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   GL+Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGLEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWF  328
            +P+  H +   + + +SF+N  +W 
Sbjct  702  YPKSNHALSEVEVESDSFMNAVLWL  726



>ref|NP_036632.1| acylamino-acid-releasing enzyme [Rattus norvegicus]
 sp|P13676.1|ACPH_RAT RecName: Full=Acylamino-acid-releasing enzyme; Short=AARE; AltName: 
Full=Acyl-peptide hydrolase; Short=APH; AltName: Full=Acylaminoacyl-peptidase 
[Rattus norvegicus]
 gb|AAA88506.1| acyl-peptide hydrolase [Rattus norvegicus]
 gb|AAI66605.1| N-acylaminoacyl-peptide hydrolase [Rattus norvegicus]
Length=732

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VET    G   S +  P
Sbjct  588  HGGFLSCHLIGQYPETYSACIARNPVINIASMMGSTDIPDWCMVET----GFPYSNSCLP  643

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                      KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ +P
Sbjct  644  DLNVWEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYP  703

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   +++ +SF+N  +W   +
Sbjct  704  KSNHALSEVEAESDSFMNAVLWLHTH  729



>gb|EDL77191.1| acylpeptide hydrolase, isoform CRA_a [Rattus norvegicus]
Length=732

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VET    G   S +  P
Sbjct  588  HGGFLSCHLIGQYPETYSACIARNPVINIASMMGSTDIPDWCMVET----GFPYSNSCLP  643

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                      KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ +P
Sbjct  644  DLNVWEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYP  703

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   +++ +SF+N  +W   +
Sbjct  704  KSNHALSEVEAESDSFMNAVLWLHTH  729



>ref|XP_003476500.1| PREDICTED: acylamino-acid-releasing enzyme [Cavia porcellus]
Length=732

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEVGFPYNSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI +I +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLNVWADMLDKSPIKYIPQVKTPLLLMLGQEDRRVPFKQGIEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W   +
Sbjct  702  YPKSTHALSEVEVESDSFMNAVLWLHTH  729



>ref|NP_666338.2| acylamino-acid-releasing enzyme [Mus musculus]
 sp|Q8R146.3|APEH_MOUSE RecName: Full=Acylamino-acid-releasing enzyme; Short=AARE; AltName: 
Full=Acyl-peptide hydrolase; Short=APH; AltName: Full=Acylaminoacyl-peptidase 
[Mus musculus]
 gb|EDL21266.1| acylpeptide hydrolase, isoform CRA_a [Mus musculus]
Length=732

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ PE ++A  ARNPV N+  M+GTTDIPDWC VET    G   S    P
Sbjct  588  HGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVET----GFPYSNDYLP  643

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                L     KSPI +I +VKTP L++LG +D RVP   GL+Y  ALK + V V+++ +P
Sbjct  644  DLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYP  703

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            +  H +   + + +SF+N  +W   +
Sbjct  704  KSTHALSEVEVESDSFMNTVLWLHTH  729



>ref|XP_008422058.1| PREDICTED: acylamino-acid-releasing enzyme isoform X2 [Poecilia 
reticulata]
Length=704

 Score =   134 bits (337),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 91/146 (62%), Gaps = 5/146 (3%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGI-LSFTEAP  577
            HGGFL+ HLIGQ P+ + A AARNPV N A ++GT+DI DW Y     S G   S+   P
Sbjct  562  HGGFLSCHLIGQYPDSYRACAARNPVINAATLLGTSDIVDWRYT----SAGFQFSYDNIP  617

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
            ++E LAA   KSPI H +++K P L++LG KD RV    GL+  + LK +G  V+++ FP
Sbjct  618  NAETLAAMLLKSPITHAAQIKAPVLLMLGGKDRRVSPHQGLELYKVLKSRGSPVRLLWFP  677

Query  396  EDVHGIERPQSDFESFLNIGVWFKKY  319
            ED H + R  +  + FLN  +W  ++
Sbjct  678  EDGHSLSRVDTQVDCFLNTVLWLNQH  703



>ref|XP_010850157.1| PREDICTED: acylamino-acid-releasing enzyme [Bison bison bison]
Length=730

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 92/148 (62%), Gaps = 8/148 (5%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVETFGSEGILSFTEA-P  577
            HGGFL+ HLIGQ PE + A   RNPV N+A M+G+TDIPDWC VE     G L  ++  P
Sbjct  586  HGGFLSCHLIGQYPETYGACVVRNPVINIASMMGSTDIPDWCVVEA----GYLYSSDCLP  641

Query  576  SSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVISFP  397
                 +   +KSPI +  +VKTP L++LG +D RVP   G++Y RALK + V V+++ +P
Sbjct  642  DPSVWSEMLNKSPIKYTPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYP  701

Query  396  EDVHGIERPQSDFESFLNIGVWFKKYCT  313
            +  H +   + + +SF+N  VW    CT
Sbjct  702  KSTHSLSEVEVESDSFMNAAVWM---CT  726



>ref|XP_007953537.1| PREDICTED: acylamino-acid-releasing enzyme [Orycteropus afer 
afer]
Length=732

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 94/148 (64%), Gaps = 9/148 (6%)
 Frame = -2

Query  753  HGGFLTTHLIGQAPEKFAAAAARNPVCNLALMVGTTDIPDWCYVET---FGSEGILSFTE  583
            HGGFL+ HLIGQ PE ++A  ARNPV N+A M+G+TDIPDWC VE    + S+ +     
Sbjct  588  HGGFLSCHLIGQYPETYSACVARNPVINIASMMGSTDIPDWCVVEAGFPYSSDCL-----  642

Query  582  APSSEHLAAFYSKSPIAHISKVKTPTLMLLGAKDLRVPVSTGLQYARALKEKGVEVKVIS  403
             P     A    KSPI ++ +VKTP L++LG +D RVP   G++Y RALK + V V+++ 
Sbjct  643  -PDLSVWAEMLDKSPIKYVPQVKTPLLLMLGQEDRRVPFKQGIEYYRALKARNVPVRLLL  701

Query  402  FPEDVHGIERPQSDFESFLNIGVWFKKY  319
            +P+  H +   + + +SF+N  +W + +
Sbjct  702  YPKSNHALSEMEVESDSFMNAVLWLRTH  729



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1785100074290