BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6809

Length=1222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626256.1|  PREDICTED: histone-lysine N-methyltransferas...    508   2e-174   Nicotiana tomentosiformis
ref|XP_009626255.1|  PREDICTED: histone-lysine N-methyltransferas...    509   3e-174   Nicotiana tomentosiformis
ref|XP_009772814.1|  PREDICTED: histone-lysine N-methyltransferas...    508   5e-174   Nicotiana sylvestris
ref|XP_006357187.1|  PREDICTED: histone-lysine N-methyltransferas...    506   5e-173   Solanum tuberosum [potatoes]
ref|XP_010317061.1|  PREDICTED: uncharacterized protein LOC101250184    505   1e-172   Solanum lycopersicum
gb|KJB76451.1|  hypothetical protein B456_012G089000                    498   3e-172   Gossypium raimondii
emb|CBI40070.3|  unnamed protein product                                498   3e-171   Vitis vinifera
ref|XP_011098840.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    501   3e-171   Sesamum indicum [beniseed]
ref|XP_004303999.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    501   5e-171   Fragaria vesca subsp. vesca
gb|KDO55675.1|  hypothetical protein CISIN_1g008853mg                   494   7e-171   Citrus sinensis [apfelsine]
gb|KJB76449.1|  hypothetical protein B456_012G089000                    500   9e-171   Gossypium raimondii
gb|KDO55674.1|  hypothetical protein CISIN_1g008853mg                   495   1e-170   Citrus sinensis [apfelsine]
ref|XP_002264334.1|  PREDICTED: histone-lysine N-methyltransferas...    499   2e-170   Vitis vinifera
ref|XP_003633789.1|  PREDICTED: histone-lysine N-methyltransferas...    499   3e-170   Vitis vinifera
ref|XP_010250811.1|  PREDICTED: histone-lysine N-methyltransferas...    498   1e-169   Nelumbo nucifera [Indian lotus]
ref|XP_004489592.1|  PREDICTED: histone-lysine N-methyltransferas...    497   1e-169   
emb|CDP16667.1|  unnamed protein product                                497   2e-169   Coffea canephora [robusta coffee]
ref|XP_006447134.1|  hypothetical protein CICLE_v10014955mg             496   3e-169   
ref|XP_011009075.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    496   3e-169   Populus euphratica
gb|KDO55665.1|  hypothetical protein CISIN_1g008853mg                   496   4e-169   Citrus sinensis [apfelsine]
ref|XP_007031777.1|  Rubisco methyltransferase family protein           495   4e-169   
gb|KDP46324.1|  hypothetical protein JCGZ_10164                         495   1e-168   Jatropha curcas
ref|XP_012070924.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    494   2e-168   Jatropha curcas
ref|XP_010111617.1|  hypothetical protein L484_017643                   494   2e-168   Morus notabilis
ref|XP_008348003.1|  PREDICTED: histone-lysine N-methyltransferas...    494   4e-168   Malus domestica [apple tree]
ref|XP_006373263.1|  hypothetical protein POPTR_0017s10180g             493   4e-168   Populus trichocarpa [western balsam poplar]
ref|XP_010029028.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    493   5e-168   Eucalyptus grandis [rose gum]
ref|XP_009370281.1|  PREDICTED: histone-lysine N-methyltransferas...    493   1e-167   Pyrus x bretschneideri [bai li]
ref|XP_008231158.1|  PREDICTED: histone-lysine N-methyltransferas...    493   1e-167   Prunus mume [ume]
gb|KHG27486.1|  COP9 signalosome complex subunit 3 -like protein        506   3e-167   Gossypium arboreum [tree cotton]
ref|XP_009371683.1|  PREDICTED: histone-lysine N-methyltransferas...    491   4e-167   Pyrus x bretschneideri [bai li]
ref|XP_006852184.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    491   6e-167   Amborella trichopoda
ref|XP_011009073.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    490   6e-167   Populus euphratica
ref|XP_008450074.1|  PREDICTED: histone-lysine N-methyltransferas...    489   2e-166   Cucumis melo [Oriental melon]
ref|XP_010930088.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    488   5e-166   Elaeis guineensis
ref|XP_006373264.1|  hypothetical protein POPTR_0017s10180g             488   6e-166   Populus trichocarpa [western balsam poplar]
gb|KDO55664.1|  hypothetical protein CISIN_1g008853mg                   488   7e-166   Citrus sinensis [apfelsine]
gb|EYU44861.1|  hypothetical protein MIMGU_mgv1a004981mg                487   8e-166   Erythranthe guttata [common monkey flower]
ref|XP_003618816.1|  SET domain protein                                 487   9e-166   
ref|XP_008807527.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    487   1e-165   Phoenix dactylifera
gb|KJB40694.1|  hypothetical protein B456_007G073800                    486   2e-165   Gossypium raimondii
ref|XP_011651569.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    486   4e-165   Cucumis sativus [cucumbers]
ref|XP_007151549.1|  hypothetical protein PHAVU_004G056200g             485   8e-165   Phaseolus vulgaris [French bean]
ref|XP_010453544.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    485   1e-164   Camelina sativa [gold-of-pleasure]
ref|XP_010492227.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    484   2e-164   Camelina sativa [gold-of-pleasure]
gb|KHG04663.1|  Histone-lysine N-methyltransferase setd3                483   2e-164   Gossypium arboreum [tree cotton]
ref|NP_196930.2|  Rubisco methyltransferase family protein              484   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420056.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    484   3e-164   Camelina sativa [gold-of-pleasure]
ref|XP_002871610.1|  SET domain-containing protein                      481   2e-163   
gb|AAL67009.1|  unknown protein                                         481   2e-163   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04664.1|  Histone-lysine N-methyltransferase setd3                481   5e-163   Gossypium arboreum [tree cotton]
ref|XP_008341326.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    481   5e-163   
ref|XP_008800375.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    480   7e-163   Phoenix dactylifera
ref|XP_008800373.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    479   1e-162   Phoenix dactylifera
ref|XP_009121680.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    479   2e-162   Brassica rapa
ref|XP_003553868.1|  PREDICTED: histone-lysine N-methyltransferas...    478   4e-162   Glycine max [soybeans]
ref|XP_009392603.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    478   4e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399936.1|  hypothetical protein EUTSA_v10013274mg             478   4e-162   
ref|XP_010912842.1|  PREDICTED: histone-lysine N-methyltransferas...    478   6e-162   
ref|XP_006470002.1|  PREDICTED: histone-lysine N-methyltransferas...    477   1e-161   
gb|KHN18676.1|  Putative ribulose-1,5 bisphosphate carboxylase/ox...    474   2e-161   Glycine soja [wild soybean]
gb|KDO55663.1|  hypothetical protein CISIN_1g008853mg                   476   7e-161   Citrus sinensis [apfelsine]
ref|XP_003524489.1|  PREDICTED: Fructose-bisphosphate aldolase-ly...    474   2e-160   Glycine max [soybeans]
gb|KJB40697.1|  hypothetical protein B456_007G073800                    473   2e-160   Gossypium raimondii
ref|XP_010551929.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    472   1e-159   Tarenaya hassleriana [spider flower]
ref|XP_009125968.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    470   4e-159   Brassica rapa
emb|CDX91073.1|  BnaC02g05240D                                          468   4e-159   
emb|CDX69594.1|  BnaA10g19430D                                          483   6e-159   
emb|CDY57896.1|  BnaC09g54420D                                          483   8e-159   Brassica napus [oilseed rape]
ref|XP_006664454.1|  PREDICTED: histone-lysine N-methyltransferas...    464   5e-158   
ref|XP_010667269.1|  PREDICTED: histone-lysine N-methyltransferas...    466   2e-157   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24248.1|  unknown                                                 464   9e-157   Picea sitchensis
gb|EAY82695.1|  hypothetical protein OsI_37912                          462   4e-156   Oryza sativa Indica Group [Indian rice]
ref|NP_001066466.1|  Os12g0236900                                       462   6e-156   
gb|EAZ20075.1|  hypothetical protein OsJ_35675                          463   1e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003578740.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    461   4e-155   Brachypodium distachyon [annual false brome]
ref|XP_007216336.1|  hypothetical protein PRUPE_ppa020142mg             459   4e-155   
gb|AGT16868.1|  Rubisco LS methyltransferase, substrate-binding d...    459   6e-155   Saccharum hybrid cultivar R570
dbj|BAJ87354.1|  predicted protein                                      459   1e-154   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008672132.1|  PREDICTED: hypothetical protein isoform X1         458   3e-154   
ref|XP_008656702.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    452   8e-154   
ref|XP_004960721.1|  PREDICTED: ribosomal N-lysine methyltransfer...    456   1e-153   Setaria italica
ref|XP_002456030.1|  hypothetical protein SORBIDRAFT_03g029140          456   2e-153   Sorghum bicolor [broomcorn]
ref|XP_010250814.1|  PREDICTED: histone-lysine N-methyltransferas...    451   9e-152   Nelumbo nucifera [Indian lotus]
gb|KDO55671.1|  hypothetical protein CISIN_1g008853mg                   431   3e-144   Citrus sinensis [apfelsine]
ref|XP_008800376.1|  PREDICTED: [Fructose-bisphosphate aldolase]-...    431   5e-144   
ref|XP_006447137.1|  hypothetical protein CICLE_v10014955mg             430   1e-143   
gb|KJB76452.1|  hypothetical protein B456_012G089000                    427   6e-143   Gossypium raimondii
gb|KJB40696.1|  hypothetical protein B456_007G073800                    422   5e-141   Gossypium raimondii
gb|KDO55670.1|  hypothetical protein CISIN_1g008853mg                   417   7e-139   Citrus sinensis [apfelsine]
emb|CAB87765.1|  putative protein                                       410   5e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001774765.1|  predicted protein                                  395   2e-129   
ref|XP_002978944.1|  hypothetical protein SELMODRAFT_110000             390   8e-129   
ref|XP_002986460.1|  hypothetical protein SELMODRAFT_269129             390   9e-129   
ref|XP_009370283.1|  PREDICTED: histone-lysine N-methyltransferas...    387   5e-127   Pyrus x bretschneideri [bai li]
ref|XP_010492229.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    385   7e-127   Camelina sativa [gold-of-pleasure]
ref|XP_001762568.1|  predicted protein                                  382   8e-126   
ref|XP_008353375.1|  PREDICTED: histone-lysine N-methyltransferas...    380   7e-125   
ref|XP_008800377.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    377   1e-123   
gb|KJB40695.1|  hypothetical protein B456_007G073800                    374   2e-122   Gossypium raimondii
dbj|BAJ99196.1|  predicted protein                                      363   2e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132025.1|  hypothetical protein                               352   2e-116   
gb|AFW83391.1|  hypothetical protein ZEAMMB73_866859                    347   2e-114   
ref|XP_010912843.1|  PREDICTED: histone-lysine N-methyltransferas...    349   8e-113   
gb|AFW83393.1|  hypothetical protein ZEAMMB73_866859                    331   1e-107   
emb|CDX85607.1|  BnaA02g02060D                                          319   8e-102   
gb|EPS58823.1|  hypothetical protein M569_15990                         310   4e-98    Genlisea aurea
gb|EMT26543.1|  hypothetical protein F775_31105                         296   1e-94    
gb|KDO55673.1|  hypothetical protein CISIN_1g008853mg                   270   4e-83    Citrus sinensis [apfelsine]
ref|XP_005644855.1|  hypothetical protein COCSUDRAFT_48681              267   7e-80    Coccomyxa subellipsoidea C-169
ref|XP_002509559.1|  conserved hypothetical protein                     246   8e-74    
gb|KIY95099.1|  hypothetical protein MNEG_12863                         239   6e-72    Monoraphidium neglectum
ref|XP_011396833.1|  Histone-lysine N-methyltransferase setd3           237   4e-69    Auxenochlorella protothecoides
ref|XP_005847730.1|  hypothetical protein CHLNCDRAFT_57818              233   1e-67    Chlorella variabilis
gb|EMS66279.1|  hypothetical protein TRIUR3_22444                       207   5e-61    Triticum urartu
ref|XP_002955272.1|  hypothetical protein VOLCADRAFT_76643              203   5e-56    Volvox carteri f. nagariensis
gb|EPS66857.1|  hypothetical protein M569_07920                         164   2e-45    Genlisea aurea
gb|KDD71504.1|  hypothetical protein H632_c4901p0                       152   4e-40    Helicosporidium sp. ATCC 50920
emb|CDX85606.1|  BnaA02g02070D                                          121   1e-29    
gb|AFW83390.1|  hypothetical protein ZEAMMB73_201403                    112   4e-26    
gb|EMT26542.1|  hypothetical protein F775_31104                         113   2e-24    
ref|XP_001754113.1|  predicted protein                                89.7    7e-16    
ref|XP_002993188.1|  hypothetical protein SELMODRAFT_449044           82.8    1e-13    
ref|XP_005705388.1|  ribulose-1,5-bisphosphate carboxylase/oxygen...  81.6    2e-13    Galdieria sulphuraria
ref|XP_002965462.1|  hypothetical protein SELMODRAFT_406852           81.6    2e-13    Selaginella moellendorffii
ref|XP_002320530.2|  hypothetical protein POPTR_0014s16720g           79.3    1e-12    
emb|CBJ29688.1|  putative ribulose-1,5-bisphosphate carboxylase/o...  78.6    2e-12    Ectocarpus siliculosus
ref|XP_011008074.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  78.2    3e-12    Populus euphratica
ref|XP_010464405.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  77.4    5e-12    Camelina sativa [gold-of-pleasure]
ref|XP_002882542.1|  SET domain-containing protein                    77.4    6e-12    Arabidopsis lyrata subsp. lyrata
ref|XP_004502116.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  77.0    7e-12    Cicer arietinum [garbanzo]
ref|XP_006297498.1|  hypothetical protein CARUB_v10013517mg           77.0    7e-12    
gb|KIZ05290.1|  hypothetical protein MNEG_2664                        76.6    9e-12    Monoraphidium neglectum
gb|KCW89047.1|  hypothetical protein EUGRSUZ_A01370                   75.5    1e-11    Eucalyptus grandis [rose gum]
gb|AAC14296.1|  putative methyltransferase                            76.3    2e-11    Arabidopsis thaliana [mouse-ear cress]
ref|NP_187424.1|  Rubisco methyltransferase family protein            75.9    2e-11    Arabidopsis thaliana [mouse-ear cress]
gb|KCW89046.1|  hypothetical protein EUGRSUZ_A01370                   75.5    2e-11    Eucalyptus grandis [rose gum]
ref|XP_010524627.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  75.9    2e-11    Tarenaya hassleriana [spider flower]
gb|AAM61650.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  75.9    2e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407809.1|  hypothetical protein EUTSA_v10020552mg           75.9    2e-11    Eutrema salsugineum [saltwater cress]
ref|XP_010486336.1|  PREDICTED: histone-lysine N-methyltransferas...  75.9    2e-11    Camelina sativa [gold-of-pleasure]
ref|XP_010252799.1|  PREDICTED: histone-lysine N-methyltransferas...  75.5    2e-11    Nelumbo nucifera [Indian lotus]
gb|KCW89043.1|  hypothetical protein EUGRSUZ_A01370                   75.5    2e-11    Eucalyptus grandis [rose gum]
ref|XP_009124214.1|  PREDICTED: histone-lysine N-methyltransferas...  75.5    3e-11    Brassica rapa
gb|KCW89045.1|  hypothetical protein EUGRSUZ_A01370                   75.1    3e-11    Eucalyptus grandis [rose gum]
ref|XP_010048281.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5...  75.1    3e-11    Eucalyptus grandis [rose gum]
emb|CDY22127.1|  BnaC01g39740D                                        74.7    4e-11    Brassica napus [oilseed rape]
ref|XP_010456598.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  74.7    5e-11    Camelina sativa [gold-of-pleasure]
gb|KFK38228.1|  hypothetical protein AALP_AA3G085300                  74.3    6e-11    Arabis alpina [alpine rockcress]
ref|XP_001754252.1|  predicted protein                                73.9    7e-11    
emb|CBI28466.3|  unnamed protein product                              73.2    1e-10    Vitis vinifera
gb|KHN39942.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...  72.8    1e-10    Glycine soja [wild soybean]
ref|XP_002267469.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  73.2    1e-10    Vitis vinifera
ref|XP_007146016.1|  hypothetical protein PHAVU_006G005700g           72.8    2e-10    Phaseolus vulgaris [French bean]
ref|XP_003542190.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  72.8    2e-10    Glycine max [soybeans]
ref|XP_003601528.1|  SET domain-containing protein                    72.8    2e-10    Medicago truncatula
ref|XP_003605258.1|  SET domain-containing protein                    72.4    2e-10    
ref|XP_002286075.1|  rubisco small subunit small subunit n-methyl...  71.6    3e-10    Thalassiosira pseudonana CCMP1335
ref|XP_010088354.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...  71.6    4e-10    
gb|EEC73918.1|  hypothetical protein OsI_08761                        71.6    4e-10    Oryza sativa Indica Group [Indian rice]
ref|NP_001047982.1|  Os02g0725200                                     71.2    5e-10    
ref|XP_006649004.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  70.5    1e-09    
ref|XP_002185762.1|  ribulose-1,5-bisphosphate carboxylase/oxygen...  69.7    2e-09    Phaeodactylum tricornutum CCAP 1055/1
gb|EJK62256.1|  hypothetical protein THAOC_17139                      69.7    2e-09    Thalassiosira oceanica
ref|XP_010236007.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  67.0    1e-08    Brachypodium distachyon [annual false brome]
ref|XP_005719244.1|  unnamed protein product                          67.0    1e-08    Chondrus crispus [carageen]
ref|NP_001140387.1|  uncharacterized protein LOC100272441             66.6    2e-08    Zea mays [maize]
ref|XP_010689223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  66.6    2e-08    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689224.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  66.2    2e-08    
ref|XP_004953752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  65.5    4e-08    
ref|XP_006857756.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  65.1    5e-08    Amborella trichopoda
gb|ACG45124.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...  65.1    5e-08    Zea mays [maize]
ref|XP_002454362.1|  hypothetical protein SORBIDRAFT_04g029430        64.7    7e-08    Sorghum bicolor [broomcorn]
ref|XP_009033030.1|  hypothetical protein AURANDRAFT_61181            64.3    8e-08    Aureococcus anophagefferens
gb|KJB22703.1|  hypothetical protein B456_004G061300                  64.3    9e-08    Gossypium raimondii
ref|XP_002974548.1|  hypothetical protein SELMODRAFT_101776           62.8    3e-07    
ref|XP_003081307.1|  putative methyltransferase (ISS)                 62.4    4e-07    
ref|XP_004305682.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  62.0    4e-07    Fragaria vesca subsp. vesca
emb|CEF99133.1|  Rubisco LS methyltransferase, substrate-binding ...  62.0    5e-07    Ostreococcus tauri
gb|AFK46204.1|  unknown                                               59.3    2e-06    Lotus japonicus
ref|XP_005718157.1|  unnamed protein product                          59.7    3e-06    Chondrus crispus [carageen]
ref|XP_006661223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  58.9    3e-06    Oryza brachyantha
ref|XP_002963244.1|  hypothetical protein SELMODRAFT_80789            59.3    3e-06    
gb|EWM24078.1|  ribulose- -bisphosphate carboxylase oxygenase sma...  59.3    4e-06    Nannochloropsis gaditana
ref|XP_002508524.1|  set domain protein                               58.5    5e-06    Micromonas commoda
ref|XP_001783777.1|  predicted protein                                57.4    1e-05    
ref|XP_007510589.1|  predicted protein                                57.4    1e-05    Bathycoccus prasinos
dbj|BAD28364.1|  putative ribulose-1,5 bisphosphate carboxylase/o...  56.6    3e-05    Oryza sativa Japonica Group [Japonica rice]
gb|AFP65462.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...  56.2    4e-05    Chroomonas mesostigmatica CCMP1168
ref|NP_001175834.1|  Os09g0411650                                     54.3    4e-05    
ref|XP_001419603.1|  predicted protein                                55.5    6e-05    Ostreococcus lucimarinus CCE9901
ref|XP_008617921.1|  hypothetical protein SDRG_13603                  55.1    7e-05    Saprolegnia diclina VS20
gb|EEC84567.1|  hypothetical protein OsI_31339                        55.5    7e-05    Oryza sativa Indica Group [Indian rice]
ref|XP_001774257.1|  predicted protein                                54.7    1e-04    
gb|AAI35195.1|  LOC549331 protein                                     54.7    1e-04    Xenopus tropicalis [western clawed frog]
ref|XP_007222120.1|  hypothetical protein PRUPE_ppa004634mg           54.7    1e-04    Prunus persica
gb|ETS04896.1|  SET domain-containing protein                         54.3    1e-04    Trichoderma reesei RUT C-30
ref|XP_005831105.1|  hypothetical protein GUITHDRAFT_109909           54.3    1e-04    Guillardia theta CCMP2712
ref|XP_008221574.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.3    1e-04    Prunus mume [ume]
sp|B7ZUF3.1|SETD3_XENTR  RecName: Full=Histone-lysine N-methyltra...  54.3    1e-04    Xenopus tropicalis [western clawed frog]
emb|CAN82664.1|  hypothetical protein VITISV_015206                   54.3    1e-04    Vitis vinifera
ref|NP_001016577.1|  histone-lysine N-methyltransferase setd3         54.3    2e-04    Xenopus tropicalis [western clawed frog]
ref|XP_002267249.1|  PREDICTED: fructose-bisphosphate aldolase-ly...  53.9    2e-04    Vitis vinifera
dbj|GAA97699.1|  hypothetical protein E5Q_04377                       53.5    2e-04    Mixia osmundae IAM 14324
ref|XP_001696900.1|  rubisco small subunit N-methyltransferase        53.9    2e-04    Chlamydomonas reinhardtii
ref|XP_011449702.1|  PREDICTED: histone-lysine N-methyltransferas...  53.5    3e-04    Crassostrea gigas
ref|XP_001448054.1|  hypothetical protein                             53.1    3e-04    Paramecium tetraurelia strain d4-2
ref|NP_001168589.1|  hypothetical protein                             53.1    3e-04    Zea mays [maize]
gb|EXX65722.1|  Efm1p                                                 52.8    4e-04    Rhizophagus irregularis DAOM 197198w
gb|ERZ96724.1|  hypothetical protein GLOINDRAFT_12309                 52.8    4e-04    
ref|XP_004335535.1|  SET domain containing protein                    52.8    4e-04    Acanthamoeba castellanii str. Neff
ref|XP_003057276.1|  set domain protein                               52.0    5e-04    Micromonas pusilla CCMP1545
ref|XP_002988920.1|  hypothetical protein SELMODRAFT_129035           52.4    5e-04    
ref|XP_008361779.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.4    5e-04    Malus domestica [apple tree]
ref|XP_001759585.1|  predicted protein                                51.6    6e-04    
gb|KJK75253.1|  hypothetical protein H634G_09600                      52.0    7e-04    Metarhizium anisopliae BRIP 53293
gb|AAI55279.1|  SET domain containing 3                               52.0    7e-04    Danio rerio [leopard danio]
ref|WP_002621005.1|  hypothetical protein                             52.0    7e-04    Cystobacter fuscus
dbj|BAJ90193.1|  predicted protein                                    51.6    0.001    Hordeum vulgare subsp. vulgare [two-rowed barley]



>ref|XP_009626256.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Nicotiana tomentosiformis]
Length=480

 Score =   508 bits (1308),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 255/296 (86%), Positives = 277/296 (94%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  185   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  244

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSYCSNC+AMLAAVDGAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  245   SLARRFALVPLGPPLLSYCSNCRAMLAAVDGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  304

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V VG+E+E + EM
Sbjct  305   INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCVGKEREAVLEM  364

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CPVSPC E+AVL QL++YF+ RL  YPTTLSEDEA
Sbjct  365   LPYLRLGYVSDPSEMQTVLSSQGPICPVSPCMEKAVLGQLSDYFEARLASYPTTLSEDEA  424

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD DLDPKKRVATQLVRLEK+ILN CL+TT++ I+QLPDLSVSPCPAP+AP LK
Sbjct  425   LLADADLDPKKRVATQLVRLEKKILNACLETTVNFINQLPDLSVSPCPAPFAPTLK  480



>ref|XP_009626255.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nicotiana tomentosiformis]
Length=513

 Score =   509 bits (1311),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 255/296 (86%), Positives = 277/296 (94%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  218   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  277

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSYCSNC+AMLAAVDGAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  278   SLARRFALVPLGPPLLSYCSNCRAMLAAVDGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  337

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V VG+E+E + EM
Sbjct  338   INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCVGKEREAVLEM  397

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CPVSPC E+AVL QL++YF+ RL  YPTTLSEDEA
Sbjct  398   LPYLRLGYVSDPSEMQTVLSSQGPICPVSPCMEKAVLGQLSDYFEARLASYPTTLSEDEA  457

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD DLDPKKRVATQLVRLEK+ILN CL+TT++ I+QLPDLSVSPCPAP+AP LK
Sbjct  458   LLADADLDPKKRVATQLVRLEKKILNACLETTVNFINQLPDLSVSPCPAPFAPTLK  513



>ref|XP_009772814.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=512

 Score =   508 bits (1309),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 255/296 (86%), Positives = 277/296 (94%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSYCSNC+AMLAAV+GAVQLVVDR Y+ G+PIVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLSYCSNCRAMLAAVNGAVQLVVDRSYRAGDPIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V VG+E+E + EM
Sbjct  337   INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCVGKEREAVLEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CPVSPC ERAVL QL++YF+ RL  YPTTLSEDEA
Sbjct  397   LPYLRLGYVSDPSEMQTVLSSQGPICPVSPCMERAVLGQLSDYFEARLASYPTTLSEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD DLDPKKRVATQLVRLEK+ILN CL+TT++ I+QLPDLSVSPCPAP+AP LK
Sbjct  457   LLADADLDPKKRVATQLVRLEKKILNACLETTVNFINQLPDLSVSPCPAPFAPTLK  512



>ref|XP_006357187.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Solanum tuberosum]
Length=511

 Score =   506 bits (1303),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/296 (86%), Positives = 276/296 (93%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  216   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  275

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSYCSNCKAMLAAV+GAVQLVVDR Y  G+PIVVWCGPQPNSKLL
Sbjct  276   SLARRFALVPLGPPLLSYCSNCKAMLAAVNGAVQLVVDRSYSVGDPIVVWCGPQPNSKLL  335

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N YDR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V VG+E+E + EM
Sbjct  336   INYGFVDEENSYDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCVGKEREAVLEM  395

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CP+SPC ERAVLDQL++YF+ RL  YPTTLSEDEA
Sbjct  396   LPYLRLGYVSDPSEMQTVLSSQGPICPMSPCMERAVLDQLSDYFRARLACYPTTLSEDEA  455

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D DLDPKKRVATQLVRLEK+ILN CL+TT++ I+QLPD SVSPCPAP+AP LK
Sbjct  456   LLSDADLDPKKRVATQLVRLEKKILNACLETTVNFINQLPDHSVSPCPAPFAPTLK  511



>ref|XP_010317061.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
 ref|XP_010317062.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
 ref|XP_010317063.1| PREDICTED: uncharacterized protein LOC101250184 [Solanum lycopersicum]
Length=511

 Score =   505 bits (1301),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 251/296 (85%), Positives = 274/296 (93%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPY+IPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  216   VLERAEGIKREYNELDTVWFMAGSLFQQYPYEIPTEAFPFEIFKQAFVAVQSCVVHLQKV  275

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDR Y  G+PIVVWCGPQPNSKLL
Sbjct  276   SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRSYSAGDPIVVWCGPQPNSKLL  335

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N +DR+ +EAALNTEDPQYQDKRLAAQRNGK SVQAF V VG+E+E + EM
Sbjct  336   INYGFVDEENSHDRLMVEAALNTEDPQYQDKRLAAQRNGKLSVQAFQVCVGKEREAVLEM  395

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEM+ VLSSQGP+CP+SPC ERAVLDQL++YFK RL  YPTTLSEDE 
Sbjct  396   LPYLRLGYVSDPSEMETVLSSQGPICPMSPCVERAVLDQLSDYFKARLAGYPTTLSEDET  455

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
              LAD DLDPK+RVATQLVRLEK+ILN CL+TT++ I+QLPD SVSPCPAP+AP LK
Sbjct  456   SLADADLDPKRRVATQLVRLEKKILNACLETTVNFINQLPDHSVSPCPAPFAPTLK  511



>gb|KJB76451.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=348

 Score =   498 bits (1281),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 249/296 (84%), Positives = 272/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  53    ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  112

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  113   PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  172

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF VY G+EKE +S+M
Sbjct  173   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPVYAGKEKEAVSDM  232

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY RLGYVSDPSEMQ VLSSQGPVCPVS C ERAVLDQLA+YFK RL  YPTTL+EDE+
Sbjct  233   LPYFRLGYVSDPSEMQSVLSSQGPVCPVSSCMERAVLDQLADYFKRRLAGYPTTLNEDES  292

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+PKKRVATQLVRLEK+IL+ CLQ T+ LIDQLPD +VSPCPAPYAP+LK
Sbjct  293   LLSDPNLNPKKRVATQLVRLEKKILHACLQATMDLIDQLPDHTVSPCPAPYAPLLK  348



>emb|CBI40070.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   498 bits (1283),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 244/296 (82%), Positives = 273/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  133   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  192

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  193   SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  252

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV VG+E+E +S+M
Sbjct  253   LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSVGKEREAVSDM  312

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQL +YF+ RL  YPTT+SEDE 
Sbjct  313   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLVDYFERRLAGYPTTMSEDEC  372

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD++L+PKK VATQLVRLEK++LN CL+ T+ LI+QLPD +VSPCPAPY P+LK
Sbjct  373   LLADSNLNPKKLVATQLVRLEKKMLNACLKATVDLINQLPDHTVSPCPAPYTPLLK  428



>ref|XP_011098840.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Sesamum indicum]
Length=501

 Score =   501 bits (1290),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/296 (85%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLF+QYPYDIPTEAFPF+IFKQAFVAVQSCVVHLQKV
Sbjct  206   VLERAEGIKREYNELDTVWFMAGSLFEQYPYDIPTEAFPFKIFKQAFVAVQSCVVHLQKV  265

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDG VQLVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  266   SLARRFALVPLGPPLLSYRSNCKAMLTAVDGTVQLVVDRPYKAGEPIVVWCGPQPNSKLL  325

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N YDR+ +EA+LNTEDPQYQDKRLAAQRNGK SVQAF V+VG+E++ + +M
Sbjct  326   INYGFVDEENSYDRMVVEASLNTEDPQYQDKRLAAQRNGKLSVQAFQVFVGKERDAVMDM  385

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CPVS C ERAVLDQLAEYF  +L  YPTTLSEDE 
Sbjct  386   LPYLRLGYVSDPSEMQSVLSSQGPICPVSSCMERAVLDQLAEYFVAKLAGYPTTLSEDET  445

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+PKKRVATQLVRLEK+IL  CLQ T+ LI+QLPD SVSPCPAPYAPILK
Sbjct  446   LLADPTLNPKKRVATQLVRLEKKILKACLQATVDLINQLPDHSVSPCPAPYAPILK  501



>ref|XP_004303999.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   501 bits (1289),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 250/296 (84%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  210   VHERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  269

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y S CKAML A D AVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  270   SLAQRFALVPLGPPLLAYGSKCKAMLTATDDAVQLVVDRPYKAGESIAVWCGPQPNSKLL  329

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQAF VYVG+EKET+S+M
Sbjct  330   INYGFVDEDNPYDRLMVEAALNTEDPQYQDKRMVAQRNGKLSVQAFQVYVGKEKETVSDM  389

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC E AVLDQLA+YF+TRL  YPTTLSEDE+
Sbjct  390   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMESAVLDQLAQYFRTRLASYPTTLSEDES  449

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +L+PKKRVATQLVR EK+IL+ CLQ TL  I+QLPDLSV+PCPAPYAP L+
Sbjct  450   LLADPNLNPKKRVATQLVRSEKKILHACLQVTLDFINQLPDLSVTPCPAPYAPSLR  505



>gb|KDO55675.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=348

 Score =   494 bits (1272),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  53    ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  112

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  113   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  172

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  173   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  232

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA
Sbjct  233   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEA  292

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  293   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  348



>gb|KJB76449.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76450.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76453.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
 gb|KJB76454.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=497

 Score =   500 bits (1287),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 249/296 (84%), Positives = 272/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  262   PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF VY G+EKE +S+M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPVYAGKEKEAVSDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY RLGYVSDPSEMQ VLSSQGPVCPVS C ERAVLDQLA+YFK RL  YPTTL+EDE+
Sbjct  382   LPYFRLGYVSDPSEMQSVLSSQGPVCPVSSCMERAVLDQLADYFKRRLAGYPTTLNEDES  441

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+PKKRVATQLVRLEK+IL+ CLQ T+ LIDQLPD +VSPCPAPYAP+LK
Sbjct  442   LLSDPNLNPKKRVATQLVRLEKKILHACLQATMDLIDQLPDHTVSPCPAPYAPLLK  497



>gb|KDO55674.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=376

 Score =   495 bits (1274),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  81    ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  140

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  141   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  200

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  201   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  260

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA
Sbjct  261   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEA  320

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  321   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  376



>ref|XP_002264334.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Vitis vinifera]
Length=509

 Score =   499 bits (1285),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 244/296 (82%), Positives = 273/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  214   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  273

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  274   SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  333

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV VG+E+E +S+M
Sbjct  334   LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSVGKEREAVSDM  393

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQL +YF+ RL  YPTT+SEDE 
Sbjct  394   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLVDYFERRLAGYPTTMSEDEC  453

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD++L+PKK VATQLVRLEK++LN CL+ T+ LI+QLPD +VSPCPAPY P+LK
Sbjct  454   LLADSNLNPKKLVATQLVRLEKKMLNACLKATVDLINQLPDHTVSPCPAPYTPLLK  509



>ref|XP_003633789.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Vitis vinifera]
Length=515

 Score =   499 bits (1284),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 244/296 (82%), Positives = 273/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  220   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  279

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAMLAAVDG+VQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  280   SLARRFALVPLGPPLLAYRSNCKAMLAAVDGSVQLVVDRPYKAGESIVVWCGPQPNSKLL  339

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK +VQ FHV VG+E+E +S+M
Sbjct  340   LNYGFVDEDNSYDRIVVEAALNTEDPQYQDKRMVAQRNGKLTVQKFHVSVGKEREAVSDM  399

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQL +YF+ RL  YPTT+SEDE 
Sbjct  400   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLVDYFERRLAGYPTTMSEDEC  459

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD++L+PKK VATQLVRLEK++LN CL+ T+ LI+QLPD +VSPCPAPY P+LK
Sbjct  460   LLADSNLNPKKLVATQLVRLEKKMLNACLKATVDLINQLPDHTVSPCPAPYTPLLK  515



>ref|XP_010250811.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250812.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
 ref|XP_010250813.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Nelumbo nucifera]
Length=516

 Score =   498 bits (1281),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 241/296 (81%), Positives = 273/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER+EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  221   VLERSEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S+CKAML AV+GA+QLVVDRPYK G+ IVVWCGPQPNS+LL
Sbjct  281   SLARRFALVPLGPPLLAYKSDCKAMLEAVEGAIQLVVDRPYKAGDSIVVWCGPQPNSRLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDE+NPYDR+ +EA+LNTEDPQYQ+KR+ AQR+GK +VQ FHVY G+EKE +S+M
Sbjct  341   LNYGFVDENNPYDRIMVEASLNTEDPQYQEKRIVAQRHGKLAVQVFHVYAGKEKEAVSDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVL+QL++YF  RL  YPTTL EDEA
Sbjct  401   LPYIRLGYVSDPSEMQSVISSQGPICPVSPCVERAVLNQLSDYFTARLDGYPTTLHEDEA  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D  LDPKKRVATQL+RLEK++LN CLQ TL LI+QLPDLSVSPCPAPYAPILK
Sbjct  461   LLTDFTLDPKKRVATQLLRLEKKLLNACLQATLELINQLPDLSVSPCPAPYAPILK  516



>ref|XP_004489592.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489593.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Cicer arietinum]
Length=495

 Score =   497 bits (1279),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 270/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             +++R EGI++EY+ELDTVWFM+GSLFQQYPYDIPTEAFPFEIFKQAF AVQSCVVHLQ V
Sbjct  200   IVQRIEGIRKEYNELDTVWFMSGSLFQQYPYDIPTEAFPFEIFKQAFAAVQSCVVHLQNV  259

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAMLA+VDG+VQLVVDRPYK G+PIVVWCGPQPNSKLL
Sbjct  260   SLARRFALVPLGPPLLAYCSNCKAMLASVDGSVQLVVDRPYKAGDPIVVWCGPQPNSKLL  319

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
              NYGFVDEDN  DR+ +EAALNTEDPQYQDKR+ AQRNGK S+Q F VY G+E+E +S+M
Sbjct  320   TNYGFVDEDNSNDRLIIEAALNTEDPQYQDKRMVAQRNGKLSIQTFQVYAGKEREAVSDM  379

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             +PYLRLGYVSDPSEMQ+V+SSQGPVCPVSPC ERAVLDQLA+YFKTRL  YPTTL+EDE+
Sbjct  380   IPYLRLGYVSDPSEMQYVMSSQGPVCPVSPCMERAVLDQLADYFKTRLAGYPTTLAEDES  439

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  L+PK+RVATQLVRLEK++L+ CLQ T+  I+QLPD SVSPCPAPY P+LK
Sbjct  440   MLTDASLNPKRRVATQLVRLEKKMLHACLQATMDFINQLPDHSVSPCPAPYGPLLK  495



>emb|CDP16667.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/296 (84%), Positives = 269/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   LLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVD AVQL VDRPY+ G PIVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLSYRSNCKAMLTAVDDAVQLAVDRPYEAGHPIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EAALN EDPQYQDKRLAAQRNGK S+Q FHV+ G+E+E + +M
Sbjct  337   INYGFVDEDNAYDRLVVEAALNIEDPQYQDKRLAAQRNGKLSLQTFHVHAGKEREAVLDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ VLSSQGP+CPVSPC ERAVLDQL ++FKTRL  YPTTL EDEA
Sbjct  397   LPYLRLGYVSDASEMQSVLSSQGPICPVSPCMERAVLDQLVDFFKTRLAGYPTTLIEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +LDPKKRVATQLVRLEKRIL+ CLQ T+ +I +LPD SVSPCPAPYAPILK
Sbjct  457   LLADYNLDPKKRVATQLVRLEKRILDACLQATVDMIHELPDHSVSPCPAPYAPILK  512



>ref|XP_006447134.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006447135.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006447136.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 ref|XP_006470001.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Citrus sinensis]
 gb|ESR60374.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60375.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60376.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
Length=512

 Score =   496 bits (1278),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  337   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA
Sbjct  397   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  457   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  512



>ref|XP_011009075.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Populus 
euphratica]
Length=502

 Score =   496 bits (1276),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 242/296 (82%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207   VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VY G+EKE +S++
Sbjct  327   LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQVYAGKEKEAVSDI  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGPVCPVSPC E+AVLDQL  YF+TRL  Y T++SEDE 
Sbjct  387   LPYLRLGYVSDPSEMQSVISSQGPVCPVSPCMEQAVLDQLTVYFRTRLAGYCTSISEDEL  446

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKKRVATQLVRLEK++LN CLQ T+ LI+QLPD ++ PCPAPYAP+LK
Sbjct  447   MLADPNLNPKKRVATQLVRLEKKMLNACLQATVDLINQLPDHTMPPCPAPYAPLLK  502



>gb|KDO55665.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55666.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55667.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55668.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55669.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=512

 Score =   496 bits (1277),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  337   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA
Sbjct  397   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  457   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  512



>ref|XP_007031777.1| Rubisco methyltransferase family protein [Theobroma cacao]
 gb|EOY02703.1| Rubisco methyltransferase family protein [Theobroma cacao]
Length=497

 Score =   495 bits (1275),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 270/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML+AVDGAV+LVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  262   ALARRFALVPLGPPLLAYRSNCKAMLSAVDGAVELVVDRPYKAGESIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQ+KR+  QRNGK SVQ F VY GREKE +++M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQEKRMVVQRNGKLSVQVFRVYAGREKEAVTDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAVL QL +YF  RL  YPTTL EDE+
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVLGQLVDYFNGRLAGYPTTLHEDES  441

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+PK+RVATQLVRLEK+IL+ CLQ T+ L+DQLPD +VSPCPAPYAPILK
Sbjct  442   LLSDPNLNPKRRVATQLVRLEKKILHACLQATIDLMDQLPDHTVSPCPAPYAPILK  497



>gb|KDP46324.1| hypothetical protein JCGZ_10164 [Jatropha curcas]
Length=515

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/296 (82%), Positives = 272/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERA+GI+REY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  220   ILERADGIRREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  279

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVD PYK GEPI VWCGPQPNSKLL
Sbjct  280   SLARRFALVPLGPPLLAYKSNCKAMLIAVDGAVELVVDCPYKAGEPIAVWCGPQPNSKLL  339

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F + VG+EKE IS++
Sbjct  340   INYGFVDEDNPYDRIVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQICVGKEKEAISDI  399

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SS GP+CPVSPC ERAVLDQL +YFK RL  YPT+LSEDE 
Sbjct  400   LPYLRLGYVSDPSEMQSVISSLGPICPVSPCMERAVLDQLVDYFKRRLDGYPTSLSEDEF  459

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD++L+PKKRVATQLVRLEK+IL+TCLQ T++LI+QLPD ++SPCPAPYAP LK
Sbjct  460   MLADHNLNPKKRVATQLVRLEKKILHTCLQLTVNLINQLPDHTISPCPAPYAPTLK  515



>ref|XP_012070924.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Jatropha curcas]
 ref|XP_012070933.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Jatropha curcas]
Length=519

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 243/296 (82%), Positives = 272/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERA+GI+REY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  224   ILERADGIRREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  283

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVD PYK GEPI VWCGPQPNSKLL
Sbjct  284   SLARRFALVPLGPPLLAYKSNCKAMLIAVDGAVELVVDCPYKAGEPIAVWCGPQPNSKLL  343

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F + VG+EKE IS++
Sbjct  344   INYGFVDEDNPYDRIVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQICVGKEKEAISDI  403

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SS GP+CPVSPC ERAVLDQL +YFK RL  YPT+LSEDE 
Sbjct  404   LPYLRLGYVSDPSEMQSVISSLGPICPVSPCMERAVLDQLVDYFKRRLDGYPTSLSEDEF  463

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD++L+PKKRVATQLVRLEK+IL+TCLQ T++LI+QLPD ++SPCPAPYAP LK
Sbjct  464   MLADHNLNPKKRVATQLVRLEKKILHTCLQLTVNLINQLPDHTISPCPAPYAPTLK  519



>ref|XP_010111617.1| hypothetical protein L484_017643 [Morus notabilis]
 gb|EXC31362.1| hypothetical protein L484_017643 [Morus notabilis]
Length=500

 Score =   494 bits (1271),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPF+IFKQAFVAVQSCVVHLQKV
Sbjct  205   VLERDEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFKIFKQAFVAVQSCVVHLQKV  264

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAML AVD AVQLVVDRPYK GE IV WCGPQPNSKLL
Sbjct  265   SLARRFALVPLGPPLLAYSSKCKAMLTAVDDAVQLVVDRPYKAGESIVAWCGPQPNSKLL  324

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALN EDPQYQDKRL AQRNGK SVQ FHVYVG+EKE +S+M
Sbjct  325   LNYGFVDEDNSYDRLVVEAALNREDPQYQDKRLVAQRNGKLSVQTFHVYVGKEKEAVSDM  384

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGPVCPVSPC ERAVLDQLA+YF+TRL  YPTTL EDE+
Sbjct  385   LPYLRLGYVSDPSEMQCVISSQGPVCPVSPCMERAVLDQLADYFRTRLACYPTTLKEDES  444

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D  L+PKKRVATQLVRLEK++L+ CLQ T   I+QLPD +VSPCPAPYAP  K
Sbjct  445   LLEDPTLNPKKRVATQLVRLEKKMLHACLQATDEFINQLPDHTVSPCPAPYAPSFK  500



>ref|XP_008348003.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=516

 Score =   494 bits (1271),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 246/296 (83%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V  RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221   VRARAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y SNC+AML AVDGAVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  281   SLAQRFALVPLGPPLLAYGSNCRAMLTAVDGAVQLVVDRPYKAGESIVVWCGPQPNSKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VYVG+EKET+ +M
Sbjct  341   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVFDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+C VSPC ERAVLDQLA+YF+TRL  YPTTLSED++
Sbjct  401   LPYLRLGYVSDPSEMQSVISSQGPICAVSPCMERAVLDQLADYFRTRLAGYPTTLSEDDS  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +L+PKKRVAT+LVRLEK++L+ CL+  + LI QLPD +VSPCPAPYAP LK
Sbjct  461   LLADANLNPKKRVATRLVRLEKKMLHACLKVVVDLIGQLPDDTVSPCPAPYAPSLK  516



>ref|XP_006373263.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
 gb|ERP51060.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
Length=502

 Score =   493 bits (1269),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 241/296 (81%), Positives = 270/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207   VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VY G+EKE +S++
Sbjct  327   LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQVYAGKEKEAVSDI  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGPVCPVSPC E+AVLDQL  YF+TRL  Y T++SEDE 
Sbjct  387   LPYLRLGYVSDPSEMQSVISSQGPVCPVSPCMEQAVLDQLTVYFRTRLAGYCTSISEDEL  446

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKKRVATQLVRLEK++L  CLQ T+ LI+QLPD ++ PCPAPYAP+LK
Sbjct  447   MLADPNLNPKKRVATQLVRLEKKMLKACLQATVDLINQLPDHTMPPCPAPYAPLLK  502



>ref|XP_010029028.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Eucalyptus grandis]
 ref|XP_010029029.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Eucalyptus grandis]
 gb|KCW55857.1| hypothetical protein EUGRSUZ_I01666 [Eucalyptus grandis]
 gb|KCW55858.1| hypothetical protein EUGRSUZ_I01666 [Eucalyptus grandis]
Length=514

 Score =   493 bits (1270),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 242/296 (82%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGI+REY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  219   VLERAEGIRREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDR YK GEPIVVWCGPQPNS+LL
Sbjct  279   SLARRFALVPLGPPLLTYRSNCKAMLTAVDGAVELVVDRAYKAGEPIVVWCGPQPNSRLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK S Q F+VY G+E+E + +M
Sbjct  339   LNYGFVDEDNSYDRLGVEASLNTEDPQYQDKRIVAQRNGKLSKQLFYVYAGKEREAVWDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPS+MQ V+SSQGP+CPVSPCTERAVLDQL EYF++R+  YPTTLSEDE 
Sbjct  399   LPYLRLGYVSDPSDMQSVISSQGPICPVSPCTERAVLDQLVEYFESRIAGYPTTLSEDET  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+PKKRVATQLVRLEK+ILN+CLQ  + LI+QLPD +VSPCPAPYAP LK
Sbjct  459   LLADPSLNPKKRVATQLVRLEKKILNSCLQAAVDLINQLPDHTVSPCPAPYAPYLK  514



>ref|XP_009370281.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009370282.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Pyrus x bretschneideri]
Length=516

 Score =   493 bits (1268),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/293 (82%), Positives = 268/293 (91%), Gaps = 0/293 (0%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA
Sbjct  224   RAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  283

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINY  854
             +RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLLINY
Sbjct  284   QRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLLINY  343

Query  853   GFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPY  674
             GFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VYVG+EKET+ +MLPY
Sbjct  344   GFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVFDMLPY  403

Query  673   LRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealla  494
             LRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQLA+YF+ RL  YPTTLSEDE+LL 
Sbjct  404   LRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLADYFRMRLAGYPTTLSEDESLLE  463

Query  493   dndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             D +L+PKKRVAT+L+RLEK++L+ CL+  + LID+LPD +VSPCPAPYAP LK
Sbjct  464   DANLNPKKRVATRLIRLEKKMLHACLKVVVDLIDRLPDDTVSPCPAPYAPSLK  516



>ref|XP_008231158.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231159.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231160.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231161.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
 ref|XP_008231162.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Prunus mume]
Length=514

 Score =   493 bits (1268),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/296 (83%), Positives = 270/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V ERAEGIKREY+ELDTVWFMAGSLFQQYPYD PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219   VHERAEGIKREYNELDTVWFMAGSLFQQYPYDSPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y SNCKAML A DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  279   SLAQRFALVPLGPPLLAYRSNCKAMLTATDGAVQLVVDRPYKAGESICVWCGPQPNSKLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK SVQAF V VG+EKET+ +M
Sbjct  339   INYGFVDEDNSYDRLVVEASLNTEDPQYQDKRMVAQRNGKLSVQAFQVNVGKEKETVFDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQLA+YF+TRL  YPTTLSEDE+
Sbjct  399   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLADYFRTRLAGYPTTLSEDES  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +L+PKKRVATQL+RLEK++L+ CL+  + LI+QLPD +VSPCPAPYAP LK
Sbjct  459   LLADANLNPKKRVATQLIRLEKKMLHACLKVAVDLINQLPDHTVSPCPAPYAPSLK  514



>gb|KHG27486.1| COP9 signalosome complex subunit 3 -like protein [Gossypium arboreum]
Length=965

 Score =   506 bits (1304),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 251/296 (85%), Positives = 273/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  670   IVERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  729

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  730   PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  789

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DNPYDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF VY G+EKE +S+M
Sbjct  790   INYGFVDDDNPYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPVYAGKEKEAVSDM  849

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVS C ERAVLDQLA+YFK RL  YPTTL+EDE+
Sbjct  850   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSSCMERAVLDQLADYFKRRLAGYPTTLNEDES  909

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D +L+PKKRVATQLVRLEK+IL+ CLQ T+ LIDQLPD +VSPCPAPYAP+LK
Sbjct  910   LLLDPNLNPKKRVATQLVRLEKKILHACLQATVDLIDQLPDHTVSPCPAPYAPLLK  965



>ref|XP_009371683.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
 ref|XP_009371684.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=516

 Score =   491 bits (1264),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 240/296 (81%), Positives = 270/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V  RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221   VHARAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  281   SLAQRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGF+DEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VYVG+EKET+ ++
Sbjct  341   INYGFIDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVFDI  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQLA+YF+TRL  YPTTLSEDE+
Sbjct  401   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLADYFRTRLAGYPTTLSEDES  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D +L+PKKRVATQL+RLEK++L+ CL+  + LID+LPD ++SPCPAP+AP LK
Sbjct  461   LLEDANLNPKKRVATQLIRLEKKMLHACLKVVVDLIDRLPDDTISPCPAPHAPSLK  516



>ref|XP_006852184.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Amborella trichopoda]
 gb|ERN13651.1| hypothetical protein AMTR_s00049p00107230 [Amborella trichopoda]
Length=514

 Score =   491 bits (1263),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 237/296 (80%), Positives = 267/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ V
Sbjct  219   VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQNV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV+ AVQLVVDR YK GE IVVWCGPQPNS+LL
Sbjct  279   SLARRFALVPLGPPLLAYKSNCKAMLTAVENAVQLVVDRAYKAGEAIVVWCGPQPNSRLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ ++A+LNT+DPQYQDKR+ AQRNGK +VQAFHVY GRE+E +++M
Sbjct  339   LNYGFVDEDNPYDRLFIKASLNTDDPQYQDKRMIAQRNGKLTVQAFHVYAGREREAVTDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDPSEM  V+SSQGP+CPVSPC ERAVLDQLA YFK RL  YPTT SEDEA
Sbjct  399   LPYMRLGYVSDPSEMHSVISSQGPICPVSPCMERAVLDQLAGYFKDRLAGYPTTSSEDEA  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
              L+++++DPK+RVATQL+RLEKR+LN CLQ    LI+QLPD + SPCPAPYAP+LK
Sbjct  459   RLSESNVDPKRRVATQLIRLEKRMLNACLQAVDELIEQLPDQTTSPCPAPYAPLLK  514



>ref|XP_011009073.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011009074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Populus 
euphratica]
Length=505

 Score =   490 bits (1262),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 242/299 (81%), Positives = 271/299 (91%), Gaps = 3/299 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207   VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VY G+EKE +S++
Sbjct  327   LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQVYAGKEKEAVSDI  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCP---VSPCTERAVLDQLAEYFKTRLLRYPTTlse  512
             LPYLRLGYVSDPSEMQ V+SSQGPVCP   VSPC E+AVLDQL  YF+TRL  Y T++SE
Sbjct  387   LPYLRLGYVSDPSEMQSVISSQGPVCPLLQVSPCMEQAVLDQLTVYFRTRLAGYCTSISE  446

Query  511   dealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             DE +LAD +L+PKKRVATQLVRLEK++LN CLQ T+ LI+QLPD ++ PCPAPYAP+LK
Sbjct  447   DELMLADPNLNPKKRVATQLVRLEKKMLNACLQATVDLINQLPDHTMPPCPAPYAPLLK  505



>ref|XP_008450074.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cucumis 
melo]
 ref|XP_008450075.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cucumis 
melo]
Length=521

 Score =   489 bits (1260),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 240/296 (81%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  226   VLERAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQKV  285

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GE I VWCGPQPNSKLL
Sbjct  286   SLARRFALVPLGPPLLAYRSNCKAMLTAVDGAVELVVDRPYKGGESIAVWCGPQPNSKLL  345

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNG+ S+QAF+VY G+EKE + +M
Sbjct  346   LNYGFVDEDNRYDRLVVEAALNTEDPQYQDKRMVAQRNGRLSIQAFNVYAGKEKEAVLDM  405

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYV+ PSEMQ V+SSQGPVCPVSPC ERA+LDQ+A+YFK RL  YPTTLSEDE 
Sbjct  406   LPYLRLGYVTHPSEMQSVISSQGPVCPVSPCMERAMLDQVADYFKRRLAGYPTTLSEDEF  465

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +L+PKKRVATQLVRLEK+IL++CL+ T+  I+QLPD +VSPCPAPYAP+L+
Sbjct  466   LLADGNLNPKKRVATQLVRLEKKILHSCLEVTIDFINQLPDHTVSPCPAPYAPLLR  521



>ref|XP_010930088.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010930089.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=512

 Score =   488 bits (1256),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   VLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV  AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  277   SLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHVYVGREKE ISEM
Sbjct  337   LNYGFVDEDNPYDRIVVEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYVGREKEAISEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EM  V+SSQGPVCPVSPC ERAVLDQL  YF+ RL  YPTTLSEDE 
Sbjct  397   LPYMRLGYVSDPAEMHSVISSQGPVCPVSPCMERAVLDQLVGYFEARLAGYPTTLSEDEN  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  L+PKKRVA QLV+LEK++L+ CLQ    +I+QLPD +VSPCPAP+AP LK
Sbjct  457   MLRDGHLNPKKRVAVQLVKLEKKMLHACLQAVFEVINQLPDHTVSPCPAPFAPQLK  512



>ref|XP_006373264.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
 gb|ERP51061.1| hypothetical protein POPTR_0017s10180g [Populus trichocarpa]
Length=505

 Score =   488 bits (1255),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 241/299 (81%), Positives = 270/299 (90%), Gaps = 3/299 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V++RA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  207   VLDRADGIKREYEELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLAYSSNCKAMLTAVDGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VY G+EKE +S++
Sbjct  327   LNYGFVDEDNPYDRIAVEAALNTEDPQYQDKRMVAQRNGKLSVQVFQVYAGKEKEAVSDI  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCP---VSPCTERAVLDQLAEYFKTRLLRYPTTlse  512
             LPYLRLGYVSDPSEMQ V+SSQGPVCP   VSPC E+AVLDQL  YF+TRL  Y T++SE
Sbjct  387   LPYLRLGYVSDPSEMQSVISSQGPVCPLLQVSPCMEQAVLDQLTVYFRTRLAGYCTSISE  446

Query  511   dealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             DE +LAD +L+PKKRVATQLVRLEK++L  CLQ T+ LI+QLPD ++ PCPAPYAP+LK
Sbjct  447   DELMLADPNLNPKKRVATQLVRLEKKMLKACLQATVDLINQLPDHTMPPCPAPYAPLLK  505



>gb|KDO55664.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=523

 Score =   488 bits (1256),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 245/307 (80%), Positives = 266/307 (87%), Gaps = 11/307 (4%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVW----------  893
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVW          
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWYNISFTGHDF  336

Query  892   -CGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY  716
              CGPQPNSKLLINYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+
Sbjct  337   KCGPQPNSKLLINYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVH  396

Query  715   VGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLL  536
              GREKE IS+MLPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL 
Sbjct  397   AGREKEAISDMLPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLA  456

Query  535   RYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPA  356
              YP TLSEDEA+L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPA
Sbjct  457   GYPATLSEDEAMLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPA  516

Query  355   PYAPILK  335
             PYAP+L 
Sbjct  517   PYAPLLN  523



>gb|EYU44861.1| hypothetical protein MIMGU_mgv1a004981mg [Erythranthe guttata]
 gb|EYU44862.1| hypothetical protein MIMGU_mgv1a004981mg [Erythranthe guttata]
Length=502

 Score =   487 bits (1254),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 242/296 (82%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V ER+EGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  207   VFERSEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDGAVQLV+DRPYK G+PIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLSYRSNCKAMLTAVDGAVQLVIDRPYKAGDPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EA+LNTEDPQYQ+KRLAAQRN K SVQ F + VG+E+E + +M
Sbjct  327   INYGFVDEDNSYDRLVVEASLNTEDPQYQNKRLAAQRNAKLSVQTFQIVVGKEREAVMDM  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGP+CPVS C ERAVLDQLA YF +RL  YPTTL+EDE 
Sbjct  387   LPYLRLGYVSDPSEMQSVLSSQGPICPVSSCMERAVLDQLAGYFISRLAGYPTTLTEDET  446

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD++L PK+RVATQLV+ EK+IL  CLQ T+ LI+QLPD S+SPCPAPYA  LK
Sbjct  447   LLADSNLSPKQRVATQLVKSEKKILKACLQATVDLINQLPDFSISPCPAPYALNLK  502



>ref|XP_003618816.1| SET domain protein [Medicago truncatula]
 gb|AES75034.1| rubisco methyltransferase family protein [Medicago truncatula]
Length=501

 Score =   487 bits (1254),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 232/296 (78%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             +++R EGI++EY+ELDTVWFM+GSLFQQYPYD+PTEAFPFEIFKQAF AVQSCVVHLQ V
Sbjct  206   IVKRIEGIRKEYNELDTVWFMSGSLFQQYPYDLPTEAFPFEIFKQAFAAVQSCVVHLQNV  265

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  266   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNTKLL  325

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
              NYGFVDEDN  DR+ +E AL+TEDPQYQDKR+ AQRNGK S+Q F+VY G+E+E +S+M
Sbjct  326   TNYGFVDEDNSNDRLIVEVALSTEDPQYQDKRIVAQRNGKLSIQTFYVYTGKEREAVSDM  385

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             +PY+RLGYVSDPSEMQ V+SSQGPVCPVSPC ERAVLDQLA+YF TRL  YPTTL+EDE+
Sbjct  386   IPYMRLGYVSDPSEMQSVISSQGPVCPVSPCMERAVLDQLADYFNTRLAAYPTTLAEDES  445

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  L+PK+RVATQLVRLEK++L+ CLQ  + LI QLPD SVSPCPAPYAP LK
Sbjct  446   MLTDGSLNPKRRVATQLVRLEKKMLHACLQAIMDLISQLPDHSVSPCPAPYAPSLK  501



>ref|XP_008807527.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807529.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807530.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008807531.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=514

 Score =   487 bits (1254),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 237/296 (80%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPF+IFK+AFVAVQSCVVHLQKV
Sbjct  219   VLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFKIFKEAFVAVQSCVVHLQKV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV+ AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  279   SLARRFALVPLGPPLLAYKSNCKAMLTAVNDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHVYVGREKE ISEM
Sbjct  339   LNYGFVDEDNPYDRIVVEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYVGREKEAISEM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EM  V+SSQGP+CPVSPC ERAVLDQL  YF+ RL  YPTTLSEDE 
Sbjct  399   LPYMRLGYVSDPAEMHSVISSQGPICPVSPCMERAVLDQLVGYFEARLAGYPTTLSEDED  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  L+PKKRVA QLV+LEK++L+ CLQ    LI+QLPD +VSPCPAP+AP LK
Sbjct  459   MLRDGHLNPKKRVAVQLVKLEKKMLHACLQAVFELINQLPDHTVSPCPAPFAPQLK  514



>gb|KJB40694.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
 gb|KJB40698.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=497

 Score =   486 bits (1251),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 242/296 (82%), Positives = 269/296 (91%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262   PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE +S+M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVSDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAVLDQLA+YF  RL  Y TTL+EDE+
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVLDQLADYFNRRLAGYLTTLNEDES  441

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+P++RVAT+LVRLEK+IL+ CLQ T  LID+LPD +VSPCPAPYA +LK
Sbjct  442   LLSDPNLNPRRRVATELVRLEKKILHACLQATTELIDELPDHTVSPCPAPYALLLK  497



>ref|XP_011651569.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis sativus]
 ref|XP_011651570.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis sativus]
 gb|KGN58197.1| hypothetical protein Csa_3G589550 [Cucumis sativus]
Length=521

 Score =   486 bits (1251),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 238/296 (80%), Positives = 271/296 (92%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  226   VLERAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQKV  285

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDGAV+LVVDRPYK GE I VWCGPQPNSKLL
Sbjct  286   SLARRFALVPLGPPLLAYRSNCKAMLTAVDGAVELVVDRPYKAGESIAVWCGPQPNSKLL  345

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNG+ S+QAF+VY G+EKE + +M
Sbjct  346   LNYGFVDEDNRYDRLVVEAALNTEDPQYQDKRMVAQRNGRLSIQAFYVYAGKEKEAVLDM  405

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYV+ PSEMQ V+SSQGPVCPVSPC ERA+L+Q+A+YFK RL  YPTTLSEDE 
Sbjct  406   LPYLRLGYVTHPSEMQSVISSQGPVCPVSPCMERAMLEQVADYFKRRLAGYPTTLSEDEF  465

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD +L+PKKRVATQLVRLEK++L++CL+ T+  I+QLPD +VSPCPAPYAP+L+
Sbjct  466   LLADGNLNPKKRVATQLVRLEKKLLHSCLEVTIDFINQLPDHTVSPCPAPYAPLLR  521



>ref|XP_007151549.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 ref|XP_007151550.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 ref|XP_007151551.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23543.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23544.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
 gb|ESW23545.1| hypothetical protein PHAVU_004G056200g [Phaseolus vulgaris]
Length=504

 Score =   485 bits (1248),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 237/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             VIER E I++EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  209   VIERTEAIRKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  268

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  269   SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  328

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N  DR+ +EAAL+TEDPQYQDKR+ AQRNGK SVQ F VY G+E+E I +M
Sbjct  329   INYGFVDENNSNDRLIVEAALDTEDPQYQDKRIVAQRNGKLSVQVFRVYSGKEREAILDM  388

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGPVCPVSPC ERAVLDQL +YFKTRL RYPTTL+EDE+
Sbjct  389   LPYLRLGYVSDPSEMQTVISSQGPVCPVSPCMERAVLDQLTDYFKTRLARYPTTLAEDES  448

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L+PKKRVATQ VRLEK++L+ CL  T   I+QLPD S+SPCPAPYAP+LK
Sbjct  449   MLTDGNLNPKKRVATQFVRLEKKMLHACLHATTDFINQLPDHSISPCPAPYAPLLK  504



>ref|XP_010453544.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Camelina sativa]
 ref|XP_010453545.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Camelina sativa]
Length=517

 Score =   485 bits (1248),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/296 (80%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  342   LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRVGKEREAVQDM  401

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA YF  RL  YPTTL ED+A
Sbjct  402   LPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLANYFMRRLAGYPTTLKEDDA  461

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD S+SPCPAPYAP LK
Sbjct  462   LLADPGLSPRKRVATRLVQLEKKILVACLTTTVDLLNQLPDSSISPCPAPYAPSLK  517



>ref|XP_010492227.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=517

 Score =   484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  342   LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRVGKEREAVQDM  401

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA YF  RL  YPTT  ED+A
Sbjct  402   LPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLANYFMRRLAGYPTTPKEDDA  461

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD S+SPCPAPYAP LK
Sbjct  462   LLADPGLSPRKRVATRLVQLEKKILVACLTTTVDLLNQLPDSSISPCPAPYAPSLK  517



>gb|KHG04663.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=497

 Score =   483 bits (1244),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 241/296 (81%), Positives = 267/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262   PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE + +M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVFDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAV DQLA+YF  RL  Y TTL+EDE+
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVRDQLADYFNRRLAGYLTTLNEDES  441

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+P++RVAT+LVRLEK+IL+ CLQ T  LID+LPD +VSPCPAPYAP+LK
Sbjct  442   LLSDPNLNPRRRVATELVRLEKKILHACLQATTELIDELPDHTVSPCPAPYAPLLK  497



>ref|NP_196930.2| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 ref|NP_851038.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 ref|NP_974778.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAL38260.1| putative protein [Arabidopsis thaliana]
 gb|AAN13005.1| unknown protein [Arabidopsis thaliana]
 gb|AED92007.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AED92008.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AED92009.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=514

 Score =   484 bits (1246),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  219   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  279   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  339   LNYGFVDEDNPYDRVIVEAALNTEDPQYQDKRMVAQRNGKLSQQVFQVRVGKEREAVQDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA YF  RL  YPTT  ED+A
Sbjct  399   LPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLANYFMRRLSGYPTTPKEDDA  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD ++SPCPAPYAP LK
Sbjct  459   LLADPSLSPRKRVATRLVQLEKKILVACLTTTVDLLNQLPDTAISPCPAPYAPSLK  514



>ref|XP_010420056.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010420057.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=517

 Score =   484 bits (1246),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  342   LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRVGKEREAVQDM  401

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA YF  RL  YPTT  ED+A
Sbjct  402   LPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLANYFMRRLAGYPTTPKEDDA  461

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD S+SPCPAPYAP LK
Sbjct  462   LLADPGLSPRKRVATRLVQLEKKILVACLTTTVDLLNQLPDSSISPCPAPYAPSLK  517



>ref|XP_002871610.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47869.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=516

 Score =   481 bits (1239),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  281   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  341   LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQVFQVRVGKEREAVQDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVC +SPC ERAVLDQLA YF  RL  YPTT  ED+A
Sbjct  401   LPYLRLGYMSDPSEMQSVISSQGPVCTMSPCMERAVLDQLANYFMRRLSGYPTTPKEDDA  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD ++SPCPAPYAP LK
Sbjct  461   LLADPSLSPRKRVATRLVQLEKKILAACLTTTVDLLNQLPDTAISPCPAPYAPSLK  516



>gb|AAL67009.1| unknown protein [Arabidopsis thaliana]
Length=514

 Score =   481 bits (1239),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/296 (79%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  219   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  279   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EAALNTE PQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  339   LNYGFVDEDNPYDRVIVEAALNTEGPQYQDKRMVAQRNGKLSQQVFQVRVGKEREAVQDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA YF  RL  YPTT  ED+A
Sbjct  399   LPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLANYFMRRLSGYPTTPKEDDA  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L P+KRVAT+LV+LEK+IL  CL TT+ L++QLPD ++SPCPAPYAP LK
Sbjct  459   LLADPSLSPRKRVATRLVQLEKKILVACLTTTVDLLNQLPDTAISPCPAPYAPSLK  514



>gb|KHG04664.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=515

 Score =   481 bits (1237),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 240/296 (81%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262   PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE + +M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVFDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAV DQLA+YF  RL  Y TTL+EDE+
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVRDQLADYFNRRLAGYLTTLNEDES  441

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+P++RVAT+LVRLEK+IL+ CLQ T  LID+LPD +VSPCPAPYAP  K
Sbjct  442   LLSDPNLNPRRRVATELVRLEKKILHACLQATTELIDELPDHTVSPCPAPYAPWFK  497



>ref|XP_008341326.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
setd3 [Malus domestica]
Length=516

 Score =   481 bits (1237),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 238/296 (80%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V  RA GIKREY+ELDTVWFMAGSLFQQYPYDIPT+AFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221   VHARAXGIKREYNELDTVWFMAGSLFQQYPYDIPTDAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALV LG PLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  281   SLAQRFALVLLGXPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQ NGK SVQ F VY G+EKET+ +M
Sbjct  341   INYGFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQGNGKLSVQTFQVYAGKEKETVFDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQLA+YF+TRL  YPTTLSEDE+
Sbjct  401   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLADYFRTRLAGYPTTLSEDES  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D +L+PKKRVATQL+RLEK++L+ CL+  + LID+LPD +VSPCPAPYAP LK
Sbjct  461   LLEDANLNPKKRVATQLIRLEKKMLHACLKVVVDLIDRLPDDTVSPCPAPYAPSLK  516



>ref|XP_008800375.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X2 [Phoenix dactylifera]
Length=512

 Score =   480 bits (1235),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  277   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F VYVGREKE ISEM
Sbjct  337   LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYVGREKEAISEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EMQ V+SSQGP+CPVSPC ERAVLDQL  YF+ RL  YPTTLSEDE 
Sbjct  397   LPYMRLGYVSDPAEMQSVISSQGPICPVSPCMERAVLDQLVGYFEARLAGYPTTLSEDED  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  LDPKKRVA QLV+LEK++L+ CLQ T   I+QLPD +VSPCPAP+AP LK
Sbjct  457   MLRDGHLDPKKRVAVQLVKLEKKMLHACLQATFGFINQLPDHTVSPCPAPFAPQLK  512



>ref|XP_008800373.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800374.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Phoenix dactylifera]
Length=519

 Score =   479 bits (1234),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  224   LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  283

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  284   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  343

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F VYVGREKE ISEM
Sbjct  344   LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYVGREKEAISEM  403

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EMQ V+SSQGP+CPVSPC ERAVLDQL  YF+ RL  YPTTLSEDE 
Sbjct  404   LPYMRLGYVSDPAEMQSVISSQGPICPVSPCMERAVLDQLVGYFEARLAGYPTTLSEDED  463

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  LDPKKRVA QLV+LEK++L+ CLQ T   I+QLPD +VSPCPAP+AP LK
Sbjct  464   MLRDGHLDPKKRVAVQLVKLEKKMLHACLQATFGFINQLPDHTVSPCPAPFAPQLK  519



>ref|XP_009121680.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brassica rapa]
Length=516

 Score =   479 bits (1234),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  221   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFTFEIFKQAFAAVQSCVVHLQNV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  281   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGF+DEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V VG+EKE + +M
Sbjct  341   LNYGFIDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVGKEKEAVQDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP+EMQ V+SSQGPVC +SPC ERAVLDQLA+YF  RL  YPTTL ED+A
Sbjct  401   LPYLRLGYMSDPAEMQSVISSQGPVCSMSPCMERAVLDQLADYFMRRLAGYPTTLKEDDA  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+P+KRVAT+LVRLEK++L  CL  T+ L+++LPD ++SPCPAPYAP LK
Sbjct  461   LLADPSLNPRKRVATRLVRLEKKMLAACLVATVDLLNELPDTTISPCPAPYAPSLK  516



>ref|XP_003553868.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoformX1 
[Glycine max]
 ref|XP_006604092.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Glycine max]
 gb|KHN09879.1| Putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine soja]
Length=502

 Score =   478 bits (1230),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 232/296 (78%), Positives = 264/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             VI+R E I++EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  207   VIQREEAIRKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHVY G+E+E + +M
Sbjct  327   INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVYAGKEREAVLDM  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             L Y+RLGYVSDPSEM+ V+SSQGPVCPVSPC ERA LDQLA+YFK RL  YPTTL+EDE+
Sbjct  387   LRYMRLGYVSDPSEMESVISSQGPVCPVSPCMERAALDQLADYFKARLAGYPTTLAEDES  446

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D++L+PKKRVATQ VRLEK++L+ CLQ T   I+QLPD ++SPCPAPYAP+LK
Sbjct  447   MLTDDNLNPKKRVATQYVRLEKKMLHACLQATTDFINQLPDHTISPCPAPYAPLLK  502



>ref|XP_009392603.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   478 bits (1230),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY+ELDTVWFMAGSLF+QYP+DIPTEAFP+EIFKQAFVAVQSCVVHLQ V
Sbjct  213   VLEREEGIKREYNELDTVWFMAGSLFKQYPFDIPTEAFPYEIFKQAFVAVQSCVVHLQNV  272

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVD AVQLVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  273   SLARRFALVPLGPPLLAYKSNCKAMLTAVDDAVQLVVDRPYKAGEPIVVWCGPQPNSRLL  332

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK +VQ FHVYVGREKE ISEM
Sbjct  333   LNYGFVDEDNPYDRIVIEASLNTEDPQYQEKRMVAQRNGKLAVQVFHVYVGREKEAISEM  392

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SD +EM  V+SSQGP CP+SPC E+AVLDQLA YF+ RL  YPTTLSEDEA
Sbjct  393   LPYLRLGYISDTAEMNSVISSQGPTCPLSPCMEQAVLDQLAAYFEARLAAYPTTLSEDEA  452

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK+VA QLV+LEK+IL+ CL+      DQLPD ++SPCPAP+AP LK
Sbjct  453   MLADRNLNPKKQVAVQLVKLEKKILHACLRAIFDFTDQLPDNTISPCPAPFAPHLK  508



>ref|XP_006399936.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 ref|XP_006399937.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 gb|ESQ41389.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
 gb|ESQ41390.1| hypothetical protein EUTSA_v10013274mg [Eutrema salsugineum]
Length=516

 Score =   478 bits (1231),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 231/296 (78%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGI+REY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221   VLERAEGIRREYKELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAIQSCVVHLQNV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIV WCGPQPN+KLL
Sbjct  281   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVAWCGPQPNAKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+T+EAAL+T+DPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  341   LNYGFVDEDNPYDRITVEAALSTQDPQYQDKRMVAQRNGKLSQQVFQVRVGKEREAVQDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ V+SSQGPVCP+SPC ERAVLDQLA+YF  RL  YPTTL ED+A
Sbjct  401   LPYLRLGYMSDPDEMQSVISSQGPVCPMSPCMERAVLDQLADYFMRRLSGYPTTLKEDDA  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL D  L+P+KRVAT+LVRLEK++L  CL  T+ L++ LPD ++SPCPAPYAP LK
Sbjct  461   LLEDPSLNPRKRVATRLVRLEKKMLAACLVATVDLLNDLPDTTISPCPAPYAPSLK  516



>ref|XP_010912842.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Elaeis guineensis]
Length=512

 Score =   478 bits (1229),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 232/296 (78%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  217   LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRP+K GEPIVVWCGPQPNS+LL
Sbjct  277   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVELVVDRPFKAGEPIVVWCGPQPNSRLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYG VDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK +VQ FHV+VGREKE ISEM
Sbjct  337   LNYGLVDEDNPYDRIAVEASLNMEDPQYQEKRMVAQRNGKLAVQVFHVFVGREKEAISEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EMQ V+SSQGP+CPVSPC ERAVLDQL  YF+ RL  Y TTLSEDE 
Sbjct  397   LPYMRLGYVSDPTEMQSVISSQGPICPVSPCMERAVLDQLVGYFEARLAGYSTTLSEDED  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  LDPKKRVA QLV+LEK++L+ CLQ T   I+QLPD +VSPCPAP+AP LK
Sbjct  457   MLRDGHLDPKKRVAVQLVKLEKKMLHACLQATFEFINQLPDHTVSPCPAPFAPQLK  512



>ref|XP_006470002.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Citrus sinensis]
Length=505

 Score =   477 bits (1227),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 260/296 (88%), Gaps = 7/296 (2%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  337   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CP       AVLDQLA+YFK RL  YP TLSEDEA
Sbjct  397   LPYLRLGYVSDTSEMQSVISSLGPICP-------AVLDQLADYFKARLAGYPATLSEDEA  449

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  450   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  505



>gb|KHN18676.1| Putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine soja]
Length=429

 Score =   474 bits (1219),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/297 (77%), Positives = 258/297 (87%), Gaps = 1/297 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             VI+R E I++EY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  133   VIQREEAIRKEYKELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  192

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  193   SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  252

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHVY G+E+E + +M
Sbjct  253   INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVYAGKEREAVLDM  312

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlse-de  506
             L Y+RLGYVSDPSEMQ V+SSQGPVCPVSPC ERA LDQLA+YFK RL  YPT L+E + 
Sbjct  313   LRYMRLGYVSDPSEMQSVISSQGPVCPVSPCMERAALDQLADYFKARLAGYPTILAEDES  372

Query  505   alladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
              L    +L+PKKRVATQ VRLEK++L+ CLQ T+  I+QLPD ++SPCPAPYAP+LK
Sbjct  373   MLTDGGNLNPKKRVATQYVRLEKKMLHACLQATIDFINQLPDHTISPCPAPYAPLLK  429



>gb|KDO55663.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=551

 Score =   476 bits (1226),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 245/335 (73%), Positives = 266/335 (79%), Gaps = 39/335 (12%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  1049
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQ  
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQRC  276

Query  1048  -------------------------------------KVSLARRFALVPLGPPLLSYCSN  980
                                                  KVSLARRFALVPLGPPLL+Y S 
Sbjct  277   GCTPQMGTESFASHLVHLQTSCTTTRTPLSPTHNPKEKVSLARRFALVPLGPPLLAYSSK  336

Query  979   CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  800
             CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLLINYGFVDEDNPYDR+ +EAAL
Sbjct  337   CKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLLINYGFVDEDNPYDRLVVEAAL  396

Query  799   NTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSS  620
             NTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+MLPYLRLGYVSD SEMQ V+SS
Sbjct  397   NTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDMLPYLRLGYVSDTSEMQSVISS  456

Query  619   QGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLE  440
              GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA+L D +L PKKRVATQLVR+E
Sbjct  457   LGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEAMLTDYNLHPKKRVATQLVRME  516

Query  439   KRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             K++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  517   KKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  551



>ref|XP_003524489.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006579696.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006579697.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X3 [Glycine max]
 ref|XP_006579698.1| PREDICTED: Fructose-bisphosphate aldolase-lysine-lysine N-methyltransferase, 
chloroplastic-like isoform X4 [Glycine max]
Length=503

 Score =   474 bits (1219),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 232/297 (78%), Positives = 262/297 (88%), Gaps = 1/297 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             VI+R E I++EY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAF A+QSCVVHLQKV
Sbjct  207   VIQREEAIRKEYKELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFAAIQSCVVHLQKV  266

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLLSY SNCKAML AVDGAV+L VDRPYK G+PIVVWCGPQPNSKLL
Sbjct  267   SLARRFALVPLGPPLLSYQSNCKAMLTAVDGAVELAVDRPYKAGDPIVVWCGPQPNSKLL  326

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDE+N  DR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHVY G+E+E + +M
Sbjct  327   INYGFVDENNSNDRLIVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVYAGKEREAVLDM  386

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             L Y+RLGYVSDPSEMQ V+SSQGPVCPVSPC ERA LDQLA+YFK RL  YPT L+EDE+
Sbjct  387   LRYMRLGYVSDPSEMQSVISSQGPVCPVSPCMERAALDQLADYFKARLAGYPTILAEDES  446

Query  502   llad-ndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  +L+PKKRVATQ VRLEK++L+ CLQ T+  I+QLPD ++SPCPAPYAP+LK
Sbjct  447   MLTDGGNLNPKKRVATQYVRLEKKMLHACLQATIDFINQLPDHTISPCPAPYAPLLK  503



>gb|KJB40697.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=491

 Score =   473 bits (1218),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/296 (80%), Positives = 264/296 (89%), Gaps = 6/296 (2%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  
Sbjct  202   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  259

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
                 RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  260   ----RFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  315

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE +S+M
Sbjct  316   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVSDM  375

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAVLDQLA+YF  RL  Y TTL+EDE+
Sbjct  376   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVLDQLADYFNRRLAGYLTTLNEDES  435

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LL+D +L+P++RVAT+LVRLEK+IL+ CLQ T  LID+LPD +VSPCPAPYA +LK
Sbjct  436   LLSDPNLNPRRRVATELVRLEKKILHACLQATTELIDELPDHTVSPCPAPYALLLK  491



>ref|XP_010551929.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
 ref|XP_010551930.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=516

 Score =   472 bits (1215),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/296 (77%), Positives = 263/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  221   VLERAEGIKREYKELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAIQSCVVHLQNV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVP GPPLL+Y  NCKAML AVDGAV+LVVDRPYK G+PIV WCGPQPN++LL
Sbjct  281   SLARRFALVPFGPPLLAYSCNCKAMLTAVDGAVELVVDRPYKYGDPIVAWCGPQPNARLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAAL+TEDPQYQDKR+ AQRNGK S Q F V VG+E++ + +M
Sbjct  341   LNYGFVDEDNPYDRIIVEAALSTEDPQYQDKRMVAQRNGKLSQQVFQVRVGKERDAVQDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVS+PSEM  V+SSQGPVCPVSPC ERAVL+QLA+YF+ RL  YPT+L+EDE 
Sbjct  401   LPYMRLGYVSEPSEMHSVISSQGPVCPVSPCMERAVLEQLADYFRKRLSGYPTSLNEDET  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+PKKRVAT+LVRLEK++L  CL  TL L++QLPD +++PCPAPYAP+LK
Sbjct  461   LLADPTLNPKKRVATRLVRLEKKMLTACLDATLDLLNQLPDTTIAPCPAPYAPLLK  516



>ref|XP_009125968.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Brassica 
rapa]
Length=505

 Score =   470 bits (1210),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  210   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  269

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVD AV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  270   SLARRFALVPLGPPLLAYCSNCKAMLTAVDDAVELVVDRAYKAGDPIVAWCGPQPNAKLL  329

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V VG+E+E + +M
Sbjct  330   LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVGKEREAVQDM  389

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP+EMQ V+SSQGPVC +SPC ERAVLDQLA+YF  RL RYPTTL ED+A
Sbjct  390   LPYLRLGYMSDPAEMQSVISSQGPVCSMSPCMERAVLDQLADYFMRRLSRYPTTLKEDDA  449

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+P+KRVAT+LVRLEK++L  CL  T+  +++LPD S+SPCPA YAP LK
Sbjct  450   MLADPSLNPRKRVATRLVRLEKKMLAACLVATVDFLNELPDTSISPCPALYAPSLK  505



>emb|CDX91073.1| BnaC02g05240D [Brassica napus]
Length=429

 Score =   468 bits (1203),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 228/296 (77%), Positives = 261/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  134   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  193

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVD AV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  194   SLARRFALVPLGPPLLAYCSNCKAMLTAVDSAVELVVDRAYKAGDPIVAWCGPQPNAKLL  253

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V VG+E+E + +M
Sbjct  254   LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVGKEREAVQDM  313

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP+EMQ V+SSQGPVC +SPC ERAVLDQLA+YF  RL RYPTTL ED+A
Sbjct  314   LPYLRLGYMSDPAEMQSVISSQGPVCSMSPCMERAVLDQLADYFMRRLSRYPTTLKEDDA  373

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+P+KRVAT+LVRLEK++L  CL  T+  +++LPD ++SPCPA YA  LK
Sbjct  374   LLADPSLNPRKRVATRLVRLEKKMLAACLVATVDFLNELPDTTISPCPALYALSLK  429



>emb|CDX69594.1| BnaA10g19430D [Brassica napus]
Length=917

 Score =   483 bits (1244),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  622   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFTFEIFKQAFAAVQSCVVHLQNV  681

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  682   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  741

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGF+DEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V VG+EKE + +M
Sbjct  742   LNYGFIDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVGKEKEAVQDM  801

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP+EMQ V+SSQGPVC +SPC ERAVLDQLA+YF  RL  YPTTL ED+A
Sbjct  802   LPYLRLGYMSDPAEMQSVISSQGPVCSMSPCMERAVLDQLADYFMRRLAGYPTTLKEDDA  861

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+P+KRVAT+LVRLEK++L  CL  T+ L+++LPD ++SPCPAPYAP LK
Sbjct  862   LLADPSLNPRKRVATRLVRLEKKMLAACLVATVDLLNELPDTTISPCPAPYAPSLK  917



>emb|CDY57896.1| BnaC09g54420D [Brassica napus]
Length=917

 Score =   483 bits (1243),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 234/296 (79%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAF AVQSCVVHLQ V
Sbjct  622   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFAAVQSCVVHLQNV  681

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAVQLVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  682   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVQLVVDRPYKAGDPIVVWCGPQPNAKLL  741

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V VG+EKE + +M
Sbjct  742   LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVGKEKEAVQDM  801

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP+EMQ V+SSQGPVC +SPC E+AVLDQLA+YF  RL  YPTTL ED+A
Sbjct  802   LPYLRLGYMSDPAEMQSVISSQGPVCSMSPCMEKAVLDQLADYFMRRLAGYPTTLKEDDA  861

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD  L+P+KRVAT+LVRLEK++L  CL  T+ L+++LPD ++SPCPAPYAP LK
Sbjct  862   LLADPSLNPRKRVATRLVRLEKKMLAACLVATVDLLNELPDTTISPCPAPYAPSLK  917



>ref|XP_006664454.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=402

 Score =   464 bits (1193),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 226/296 (76%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V  R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  107   VFARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  166

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK+GEPI+VWCGPQPNS+LL
Sbjct  167   SLARRFALVPLGPPLLTYKSNCKAMLTAGGDSVRLVVDRPYKSGEPIIVWCGPQPNSRLL  226

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EA+LNTEDPQ+Q+KR+ AQRNGK ++Q FHV VG+EKETI+EM
Sbjct  227   LNYGFVDEDNPYDRVVIEASLNTEDPQFQEKRMVAQRNGKLAIQNFHVCVGKEKETIAEM  286

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL EDEA
Sbjct  287   LPYLRLGYISDPDEMQAILSSEGDTCPVSPCTERAVLDQLVGYLESRLAGYPTTLDEDEA  346

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L+PKK VAT+LVR EK++L++CLQ    LI+ LPD +VSPCPAP+AP LK
Sbjct  347   MLEDGNLEPKKEVATRLVRSEKKLLHSCLQAANDLINNLPDHTVSPCPAPFAPELK  402



>ref|XP_010667269.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=518

 Score =   466 bits (1200),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 231/296 (78%), Positives = 261/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ RAEGIK+EY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  223   ILGRAEGIKKEYNELDTVWFMAGSLFQQYPYDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  282

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S C+AML AVD AVQLVVDR YK GEPIVVWCGPQPNSKLL
Sbjct  283   SLARRFALVPLGPPLLAYKSTCRAMLTAVDDAVQLVVDRQYKAGEPIVVWCGPQPNSKLL  342

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q+F+V VG+E+E +++M
Sbjct  343   INYGFVDEDNPYDRIVVEAALNTEDPQYQDKRMVAQRNGKLSQQSFYVLVGKEREAVTDM  402

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDP++M  V++SQGPVCPVSPC ERAVLDQL  YF  RL  Y TTL+ED++
Sbjct  403   LPYLRLGYVSDPADMHSVITSQGPVCPVSPCVERAVLDQLLYYFAERLSGYSTTLNEDDS  462

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             LLAD DL+PK++VATQL+RLEK+IL  CLQ T+ LI  LPD SVSPCPA Y+P LK
Sbjct  463   LLADQDLNPKRQVATQLLRLEKKILQACLQATMDLISLLPDNSVSPCPARYSPSLK  518



>gb|ABK24248.1| unknown [Picea sitchensis]
Length=507

 Score =   464 bits (1195),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 225/296 (76%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER  GIKREY ELDTVWFMAGSLF+QYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ V
Sbjct  212   MLERNSGIKREYEELDTVWFMAGSLFKQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQNV  271

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLLSY SNCKAML AV  +VQL VDR YK GEPIVVWCGPQPN++LL
Sbjct  272   NLARRFALVPLGPPLLSYKSNCKAMLKAVGDSVQLEVDREYKAGEPIVVWCGPQPNARLL  331

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DR+ +E +L+T+DP YQDKR+ AQRNGK SVQ F++Y+GREKE + +M
Sbjct  332   LNYGFVDEDNPHDRLIVEVSLDTKDPLYQDKRIIAQRNGKLSVQTFNIYIGREKEAVLDM  391

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRL YVSDPSEMQ VLSSQGPVCPVSPCTERAVLDQL+ YF+ RL  YPTT SEDE 
Sbjct  392   LPYLRLAYVSDPSEMQSVLSSQGPVCPVSPCTERAVLDQLSRYFRERLAGYPTTASEDEI  451

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD   +PK++VATQLV +EK++LN+CL     +IDQLPDL+V+PCP+PY+PILK
Sbjct  452   VLADPTTNPKRQVATQLVLIEKKMLNSCLAAVYEIIDQLPDLAVTPCPSPYSPILK  507



>gb|EAY82695.1| hypothetical protein OsI_37912 [Oryza sativa Indica Group]
Length=505

 Score =   462 bits (1190),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  210   VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  269

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  270   SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  329

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV VG+EKETI+EM
Sbjct  330   LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCVGKEKETIAEM  389

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL ED+A
Sbjct  390   LPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLVGYLESRLADYPTTLDEDDA  449

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK VAT+LVRLEK++L+ CLQ     I+ LPD +VSPCPAP+AP LK
Sbjct  450   MLADGNLEPKKEVATRLVRLEKKLLHGCLQAANEFINDLPDHTVSPCPAPFAPELK  505



>ref|NP_001066466.1| Os12g0236900 [Oryza sativa Japonica Group]
 gb|ABA96840.1| SET domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29485.1| Os12g0236900 [Oryza sativa Japonica Group]
Length=509

 Score =   462 bits (1190),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  214   VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  273

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  274   SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  333

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV VG+EKETI+EM
Sbjct  334   LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCVGKEKETIAEM  393

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL ED+A
Sbjct  394   LPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLVGYLESRLADYPTTLDEDDA  453

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK VAT+LVRLEK++L+ CLQ     I+ LPD +VSPCPAP+AP LK
Sbjct  454   MLADGNLEPKKEVATRLVRLEKKLLHGCLQAANEFINDLPDHTVSPCPAPFAPELK  509



>gb|EAZ20075.1| hypothetical protein OsJ_35675 [Oryza sativa Japonica Group]
Length=536

 Score =   463 bits (1191),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGI+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  241   VVARDEGIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  300

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV  +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  301   SLARRFALVPLGPPLLTYKSNCKAMLTAVGDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  360

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGF+DEDNPYDR+ +EA+LN EDPQ+Q+KR+ AQRNGK ++Q FHV VG+EKETI+EM
Sbjct  361   LNYGFIDEDNPYDRIVIEASLNIEDPQFQEKRMVAQRNGKLAIQNFHVCVGKEKETIAEM  420

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL ED+A
Sbjct  421   LPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLVGYLESRLADYPTTLDEDDA  480

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK VAT+LVRLEK++L+ CLQ     I+ LPD +VSPCPAP+AP LK
Sbjct  481   MLADGNLEPKKEVATRLVRLEKKLLHGCLQAANEFINDLPDHTVSPCPAPFAPELK  536



>ref|XP_003578740.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic [Brachypodium distachyon]
Length=516

 Score =   461 bits (1185),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 226/296 (76%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGI+REY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221   VVVRDEGIRREYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVD +V+LVVDRPYK GEPI+VWCGPQPNS+LL
Sbjct  281   SLARRFALVPLGPPLLTYKSNCKAMLTAVDDSVRLVVDRPYKAGEPIIVWCGPQPNSRLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK ++Q F V VG+EKETISEM
Sbjct  341   LNYGFVDEDNPYDRIAIEASLNMEDPQYQEKRMVAQRNGKLAIQKFQVCVGKEKETISEM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPC+ERAVLDQL  Y K+RL  YPTTL EDEA
Sbjct  401   LPYLRLGYISDPDEMQCILSSEGDTCPVSPCSERAVLDQLVVYLKSRLAGYPTTLDEDEA  460

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK VAT+LVRLEK++L+ CLQ     I  LPD +VSPCPA YAP LK
Sbjct  461   MLADGNLEPKKEVATRLVRLEKKLLHGCLQAAHEFISALPDHTVSPCPALYAPNLK  516



>ref|XP_007216336.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica]
 gb|EMJ17535.1| hypothetical protein PRUPE_ppa020142mg, partial [Prunus persica]
Length=495

 Score =   459 bits (1182),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 228/277 (82%), Positives = 252/277 (91%), Gaps = 0/277 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V ER EGIKREY+ELDTVWFMAGSLFQQYPYD PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219   VHERGEGIKREYNELDTVWFMAGSLFQQYPYDSPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y SNCKAML A DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  279   SLAQRFALVPLGPPLLAYRSNCKAMLTATDGAVQLVVDRPYKAGESICVWCGPQPNSKLL  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EA+LNTEDPQYQDKR+ AQRNGK SVQAF V VG+EKET+ +M
Sbjct  339   INYGFVDEDNSYDRLVVEASLNTEDPQYQDKRMVAQRNGKLSVQAFQVNVGKEKETVFDM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVSPC ERAVLDQLA+YF+TRL  YPTTLSEDE+
Sbjct  399   LPYLRLGYVSDPSEMQSVISSQGPICPVSPCMERAVLDQLADYFRTRLAGYPTTLSEDES  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLID  392
             LLAD +L+PKKRVATQL+RLEK++L+ CL+  + LI+
Sbjct  459   LLADANLNPKKRVATQLIRLEKKMLHACLKVAVDLIN  495



>gb|AGT16868.1| Rubisco LS methyltransferase, substrate-binding domain [Saccharum 
hybrid cultivar R570]
Length=495

 Score =   459 bits (1181),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 221/296 (75%), Positives = 261/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  200   IVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  259

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  260   SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  319

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DR+ +EA+LNTEDPQYQDKR+ AQRNGK ++Q F+VYVG+EK+T++EM
Sbjct  320   LNYGFVDEDNPFDRIAIEASLNTEDPQYQDKRMVAQRNGKLAIQNFNVYVGKEKQTVAEM  379

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CP+SPCTERAVLDQL  Y ++RL  YPTTL EDEA
Sbjct  380   LPYLRLGYISDPDEMQSILSSEGDTCPLSPCTERAVLDQLIGYLESRLAGYPTTLDEDEA  439

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+PKK VAT+LVRLEK++L+ CLQ T   I+ LPD +VSPCPAPYAP LK
Sbjct  440   MLADGSLEPKKEVATRLVRLEKKMLHACLQATNEFINDLPDHTVSPCPAPYAPELK  495



>dbj|BAJ87354.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88824.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score =   459 bits (1182),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/296 (76%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGIK+EY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  228   VVVRDEGIKKEYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  287

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS+LL
Sbjct  288   SLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNSRLL  347

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F V VG+EK+TISEM
Sbjct  348   LNYGFVDEDNPYDRIAIEASLNTEDPQYQEKRMVAQRNGKLAIQKFQVCVGKEKQTISEM  407

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPC+ERAVLDQL  Y K+RL  YPT L EDEA
Sbjct  408   LPYLRLGYISDPDEMQCILSSEGDTCPVSPCSERAVLDQLVVYLKSRLAGYPTNLDEDEA  467

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+PKK VAT+LVRLEK++L+ CL+     I  LPD +VSPCPA YAP LK
Sbjct  468   MLADGSLEPKKEVATRLVRLEKKMLHGCLEAANEFISGLPDHTVSPCPALYAPELK  523



>ref|XP_008672132.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672133.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58397.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
Length=512

 Score =   458 bits (1178),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/296 (75%), Positives = 262/296 (89%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  277   SLARRFALVPLGPPLLTYRSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DRV +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+VYVG+EK+T++EM
Sbjct  337   LNYGFVDEDNPFDRVAIEASLNTEDPQYQEKRMVAQRNGKLAIQNFNVYVGKEKQTVAEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+S+P EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL EDEA
Sbjct  397   LPYLRLGYISNPDEMQSILSSEGDTCPVSPCTERAVLDQLVGYLESRLAGYPTTLDEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD +L+PKK VAT+LVRLEK++L+ CLQ T   I+ LPD +VSPCPAPYAP LK
Sbjct  457   MLADGNLEPKKEVATRLVRLEKKMLHACLQATNEFINDLPDHTVSPCPAPYAPELK  512



>ref|XP_008656702.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like [Zea mays]
Length=379

 Score =   452 bits (1163),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 217/296 (73%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  84    VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  143

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  144   SLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGPQTNSRLV  203

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+VYVG+EK+T++EM
Sbjct  204   LNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYVGKEKQTVAEM  263

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPTTL+EDEA
Sbjct  264   LPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLGGYLESRLAGYPTTLNEDEA  323

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+PK+ VAT+LVRLEK++L+ CLQ T   I  LPD +VSPCPA YAP +K
Sbjct  324   MLADGSLEPKQEVATRLVRLEKKMLHACLQATNEFITDLPDHTVSPCPAQYAPEMK  379



>ref|XP_004960721.1| PREDICTED: ribosomal N-lysine methyltransferase set10-like [Setaria 
italica]
Length=514

 Score =   456 bits (1174),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/296 (74%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             VI R E ++REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  219   VIARDEAVRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  278

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI+VWCGPQ NS+L+
Sbjct  279   SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIVWCGPQTNSRLV  338

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DR+++EA+LNTEDPQ+Q+KR+ AQRNGK ++Q F+VYVG+EKET++EM
Sbjct  339   LNYGFVDEDNPFDRISIEASLNTEDPQFQEKRMVAQRNGKLAIQNFNVYVGKEKETVAEM  398

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EM+ +LSS G  CPVSPCTERAVLDQL  Y ++RL  YPTTL +DEA
Sbjct  399   LPYLRLGYISDPDEMRSILSSDGETCPVSPCTERAVLDQLVGYLESRLAGYPTTLDQDEA  458

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+PKK VAT+LVRLEK++L+ CLQ     I+ LPD +VSPCPAPYAP LK
Sbjct  459   MLADGSLEPKKEVATRLVRLEKKMLHACLQAAKEFINDLPDHTVSPCPAPYAPELK  514



>ref|XP_002456030.1| hypothetical protein SORBIDRAFT_03g029140 [Sorghum bicolor]
 gb|EES01150.1| hypothetical protein SORBIDRAFT_03g029140 [Sorghum bicolor]
Length=512

 Score =   456 bits (1173),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 219/296 (74%), Positives = 261/296 (88%), Gaps = 0/296 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  217   VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGPQ NS+L+
Sbjct  277   SLARRFALVPLGPPLLTYKSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGPQTNSRLV  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DR+ +EA+LN+EDPQYQ+KR+ AQRNGK ++Q F+VYVG+EK+T++EM
Sbjct  337   LNYGFVDEDNPFDRIAIEASLNSEDPQYQEKRMVAQRNGKLAIQNFNVYVGKEKQTVAEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGY+SDP EMQ +LSS+G  CP+SPCTERAVLDQL  Y ++RL  YPTTL EDEA
Sbjct  397   LPYLRLGYISDPDEMQSILSSEGDTCPLSPCTERAVLDQLVGYLESRLAGYPTTLDEDEA  456

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +LAD  L+PKK VAT+LVRLEK++++ CLQ T   I+ LPD +VSPCPAPYAP LK
Sbjct  457   MLADGSLEPKKEVATRLVRLEKKMIHACLQATNEFINDLPDHTVSPCPAPYAPELK  512



>ref|XP_010250814.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Nelumbo nucifera]
Length=487

 Score =   451 bits (1160),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 222/284 (78%), Positives = 255/284 (90%), Gaps = 3/284 (1%)
 Frame = -1

Query  1186  SELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLG  1007
             +ELD   ++ GS  +QYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQKVSLARRFALVPLG
Sbjct  207   AELD---YLTGSATKQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQKVSLARRFALVPLG  263

Query  1006  PPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPY  827
             PPLL+Y S+CKAML AV+GA+QLVVDRPYK G+ IVVWCGPQPNS+LL+NYGFVDE+NPY
Sbjct  264   PPLLAYKSDCKAMLEAVEGAIQLVVDRPYKAGDSIVVWCGPQPNSRLLLNYGFVDENNPY  323

Query  826   DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDP  647
             DR+ +EA+LNTEDPQYQ+KR+ AQR+GK +VQ FHVY G+EKE +S+MLPY+RLGYVSDP
Sbjct  324   DRIMVEASLNTEDPQYQEKRIVAQRHGKLAVQVFHVYAGKEKEAVSDMLPYIRLGYVSDP  383

Query  646   SEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKR  467
             SEMQ V+SSQGP+CPVSPC ERAVL+QL++YF  RL  YPTTL EDEALL D  LDPKKR
Sbjct  384   SEMQSVISSQGPICPVSPCVERAVLNQLSDYFTARLDGYPTTLHEDEALLTDFTLDPKKR  443

Query  466   VATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             VATQL+RLEK++LN CLQ TL LI+QLPDLSVSPCPAPYAPILK
Sbjct  444   VATQLLRLEKKLLNACLQATLELINQLPDLSVSPCPAPYAPILK  487



>gb|KDO55671.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
 gb|KDO55672.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=467

 Score =   431 bits (1108),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  337   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTT  521
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP T
Sbjct  397   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPAT  450



>ref|XP_008800376.1| PREDICTED: [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, 
chloroplastic-like isoform X3 [Phoenix dactylifera]
Length=494

 Score =   431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 219/296 (74%), Positives = 246/296 (83%), Gaps = 18/296 (6%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQ                  AFVAVQSCVVHLQKV
Sbjct  217   LLERDEGIKREYNELDTVWFMAGSLFQ------------------AFVAVQSCVVHLQKV  258

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  259   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  318

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F VYVGREKE ISEM
Sbjct  319   LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYVGREKEAISEM  378

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLGYVSDP+EMQ V+SSQGP+CPVSPC ERAVLDQL  YF+ RL  YPTTLSEDE 
Sbjct  379   LPYMRLGYVSDPAEMQSVISSQGPICPVSPCMERAVLDQLVGYFEARLAGYPTTLSEDED  438

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D  LDPKKRVA QLV+LEK++L+ CLQ T   I+QLPD +VSPCPAP+AP LK
Sbjct  439   MLRDGHLDPKKRVAVQLVKLEKKMLHACLQATFGFINQLPDHTVSPCPAPFAPQLK  494



>ref|XP_006447137.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
 gb|ESR60377.1| hypothetical protein CICLE_v10014955mg [Citrus clementina]
Length=484

 Score =   430 bits (1106),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  337   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTT  521
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP T
Sbjct  397   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPAT  450



>gb|KJB76452.1| hypothetical protein B456_012G089000 [Gossypium raimondii]
Length=460

 Score =   427 bits (1099),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 215/234 (92%), Gaps = 0/234 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+Y SNCKAML+AV GAV+LVVDRPYK GEPIVVWCGPQPNSKLL
Sbjct  262   PLARRFALVPLGPPLLAYRSNCKAMLSAVAGAVELVVDRPYKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQAF VY G+EKE +S+M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQAFPVYAGKEKEAVSDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTT  521
             LPY RLGYVSDPSEMQ VLSSQGPVCPVS C ERAVLDQLA+YFK RL  YPTT
Sbjct  382   LPYFRLGYVSDPSEMQSVLSSQGPVCPVSSCMERAVLDQLADYFKRRLAGYPTT  435



>gb|KJB40696.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=445

 Score =   422 bits (1084),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 200/234 (85%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262   PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE +S+M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVSDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTT  521
             LPYLRLGYVSDPSEMQ VLSSQGPVCPVSPC ERAVLDQLA+YF  RL  Y TT
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQGPVCPVSPCMERAVLDQLADYFNRRLAGYLTT  435



>gb|KDO55670.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=481

 Score =   417 bits (1073),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 215/296 (73%), Positives = 236/296 (80%), Gaps = 31/296 (10%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQ                               KV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQ-------------------------------KV  245

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  246   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  305

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ FHV+ GREKE IS+M
Sbjct  306   INYGFVDEDNPYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQVFHVHAGREKEAISDM  365

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLGYVSD SEMQ V+SS GP+CPVSPC ERAVLDQLA+YFK RL  YP TLSEDEA
Sbjct  366   LPYLRLGYVSDTSEMQSVISSLGPICPVSPCMERAVLDQLADYFKARLAGYPATLSEDEA  425

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             +L D +L PKKRVATQLVR+EK++LN CLQ T  +I  LPD++VSPCPAPYAP+L 
Sbjct  426   MLTDYNLHPKKRVATQLVRMEKKMLNACLQVTADMIMLLPDVTVSPCPAPYAPLLN  481



>emb|CAB87765.1| putative protein [Arabidopsis thaliana]
Length=537

 Score =   410 bits (1053),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 213/252 (85%), Gaps = 18/252 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ--  1049
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ  
Sbjct  219   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQVV  278

Query  1048  ----------------KVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  917
                              V LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK
Sbjct  279   LVASSNLDCYASSCTQNVGLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYK  338

Query  916   TGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSS  737
              G+PIVVWCGPQPN+KLL+NYGFVDEDNPYDRV +EAALNTEDPQYQDKR+ AQRNGK S
Sbjct  339   AGDPIVVWCGPQPNAKLLLNYGFVDEDNPYDRVIVEAALNTEDPQYQDKRMVAQRNGKLS  398

Query  736   VQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAE  557
              Q F V VG+E+E + +MLPYLRLGY+SDPSEMQ V+SSQGPVCP+SPC ERAVLDQLA 
Sbjct  399   QQVFQVRVGKEREAVQDMLPYLRLGYMSDPSEMQSVISSQGPVCPMSPCMERAVLDQLAN  458

Query  556   YFKTRLLRYPTT  521
             YF  RL  YPTT
Sbjct  459   YFMRRLSGYPTT  470



>ref|XP_001774765.1| predicted protein [Physcomitrella patens]
 gb|EDQ60436.1| predicted protein [Physcomitrella patens]
Length=523

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 227/296 (77%), Gaps = 3/296 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER  GIKREY ELDTVWFMAGSLF+QYP+D+PTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  231   VLERLAGIKREYEELDTVWFMAGSLFKQYPFDLPTEAFSFEIFKQAFVAVQSCVVHLQGV  290

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVD  V L VDR YK G+PI VWCGPQPNSKLL
Sbjct  291   SLARRFALVPLGPPLLAYKSNCKAMLKAVDDNVVLEVDRAYKAGDPIAVWCGPQPNSKLL  350

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+L+TEDP YQ KR   Q+N + ++Q F +Y G+E E + +M
Sbjct  351   LNYGFVDEDNPYDRLAVEASLDTEDPLYQQKRAIVQKNNRLTIQTFQIYKGKEMEAVLDM  410

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RL +++DP EM+ V  +QGPVCPVS C ERAVL+QL +YF+ RL  Y ++ + +  
Sbjct  411   LPYMRLAHLADPEEMETVSFAQGPVCPVSACNERAVLEQLEQYFEKRLAGYKSSHATEGG  470

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
                 N    KKRVA +L+ +EK IL   L     LI QLPD ++SPC  PY P LK
Sbjct  471   DAKKNA---KKRVAEKLLCIEKSILRNALAAVQELISQLPDSAISPCIGPYLPNLK  523



>ref|XP_002978944.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
 gb|EFJ19901.1| hypothetical protein SELMODRAFT_110000 [Selaginella moellendorffii]
Length=432

 Score =   390 bits (1002),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 238/299 (80%), Gaps = 3/299 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY ELDTVWFMAGSLF++YP+DIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  134   VLERLEGIKREYQELDTVWFMAGSLFKEYPFDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  193

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SL RRFALVPLGPPLL+Y SNCKAML A    V+L VDR YK GE I+VWCGPQPN++LL
Sbjct  194   SLPRRFALVPLGPPLLAYKSNCKAMLKAAGDLVRLEVDRAYKKGEQILVWCGPQPNTRLL  253

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVD DNP+DR+++EA+LNT DP YQ+KR+  Q+N + ++Q F ++ GREKE + EM
Sbjct  254   LNYGFVDPDNPHDRLSVEASLNTRDPFYQNKRIIVQKNNRLTIQNFQIFKGREKEAVLEM  313

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLG+VSDP  M+ V S++GP CPVS C ERAVLDQLA+YF+ R+ +Y TT+ ED A
Sbjct  314   LPYLRLGHVSDPYHMESVFSAEGPTCPVSACNERAVLDQLAQYFQERIAKYKTTIDEDRA  373

Query  502   lla--dndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVS-PCPAPYAPILK  335
             LL    +D++PK+RVATQL+ +EK IL+  L       +QLPD SV+ PC   + P LK
Sbjct  374   LLEDGSSDINPKQRVATQLLLIEKEILHNTLDVVNGFRNQLPDGSVAPPCCGDFVPKLK  432



>ref|XP_002986460.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
 gb|EFJ12317.1| hypothetical protein SELMODRAFT_269129 [Selaginella moellendorffii]
Length=432

 Score =   390 bits (1002),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 238/299 (80%), Gaps = 3/299 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER EGIKREY ELDTVWFMAGSLF++YP+DIPTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  134   VLERLEGIKREYQELDTVWFMAGSLFKEYPFDIPTEAFSFEIFKQAFVAVQSCVVHLQGV  193

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SL RRFALVPLGPPLL+Y SNCKAML A    V+L VDR YK GE I+VWCGPQPN++LL
Sbjct  194   SLPRRFALVPLGPPLLAYKSNCKAMLKAAGDLVRLEVDRAYKKGEQILVWCGPQPNTRLL  253

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVD DNP+DR+++EA+LNT DP YQ+KR+  Q+N + ++Q F ++ GREKE + EM
Sbjct  254   LNYGFVDPDNPHDRLSVEASLNTRDPFYQNKRIIVQKNNRLTIQNFQIFKGREKEAVLEM  313

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPYLRLG+VSDP  M+ V S++GP CPVS C ERAVLDQLA+YF+ R+ +Y TT+ ED A
Sbjct  314   LPYLRLGHVSDPYHMESVFSAEGPTCPVSACNERAVLDQLAQYFQERIAKYKTTIDEDRA  373

Query  502   lla--dndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVS-PCPAPYAPILK  335
             LL    +D++PK+RVATQL+ +EK IL+  L       +QLPD SV+ PC   + P LK
Sbjct  374   LLEDCSSDINPKQRVATQLLLIEKEILHNTLDVVNGFRNQLPDGSVAPPCCGDFVPKLK  432



>ref|XP_009370283.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Pyrus x bretschneideri]
Length=466

 Score =   387 bits (994),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             RAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA
Sbjct  224   RAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  283

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINY  854
             +RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLLINY
Sbjct  284   QRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLLINY  343

Query  853   GFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPY  674
             GFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQRNGK SVQ F VYVG+EKET+ +MLPY
Sbjct  344   GFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQRNGKLSVQTFQVYVGKEKETVFDMLPY  403

Query  673   LRLGYVSDPSEMQFVLSSQGPVCPV  599
             LRLGYVSDPSEMQ V+SSQGP+CP+
Sbjct  404   LRLGYVSDPSEMQSVISSQGPICPI  428



>ref|XP_010492229.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=432

 Score =   385 bits (989),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  222   VLERAEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  281

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDRPYK G+PIVVWCGPQPN+KLL
Sbjct  282   GLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRPYKAGDPIVVWCGPQPNAKLL  341

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EAALNTEDPQYQDKR+ AQRNGK S Q F V VG+E+E + +M
Sbjct  342   LNYGFVDEDNPYDRIIVEAALNTEDPQYQDKRMVAQRNGKLSQQIFQVRVGKEREAVQDM  401

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVS  596
             LPYLRLGY+SDPSEMQ V+SSQGPVCPVS
Sbjct  402   LPYLRLGYMSDPSEMQSVISSQGPVCPVS  430



>ref|XP_001762568.1| predicted protein [Physcomitrella patens]
 gb|EDQ72691.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   382 bits (982),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 223/296 (75%), Gaps = 3/296 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ER  GIKREY ELDTVWFMAGSLF+QYP+D+PTEAF FEIFKQAFVAVQSCVVHLQ V
Sbjct  135   VLERLAGIKREYEELDTVWFMAGSLFKQYPFDLPTEAFSFEIFKQAFVAVQSCVVHLQGV  194

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AV   VQL VD  YKTG+PI VWCGPQPNSKLL
Sbjct  195   SLARRFALVPLGPPLLAYKSNCKAMLKAVGDNVQLEVDHAYKTGDPIAVWCGPQPNSKLL  254

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNP+DR+ +EA+LNTEDP YQ KR   Q+N + ++Q F +Y G+E E + +M
Sbjct  255   LNYGFVDEDNPFDRLAVEASLNTEDPLYQQKRAVVQKNNRLTIQTFQIYKGKEMEAVRDM  314

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea  503
             LPY+RLG+++DP E++ V  +Q P+C VS C ERAVL+Q+  +F+ RL  Y ++ +    
Sbjct  315   LPYMRLGHLADPEEIETVSFAQEPLCYVSACNERAVLNQIEHFFERRLAGYKSSDTTKAV  374

Query  502   lladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
                 +    K+ VA +L+ +EK IL   L     LI +LPD ++SPC  PY P LK
Sbjct  375   DAKKDA---KRTVAKKLMSIEKNILRNALAAVHELIRELPDGAISPCIGPYLPNLK  427



>ref|XP_008353375.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=429

 Score =   380 bits (976),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V  RA GIKREY+ELDTVWFMAGSLFQQYPYDIPT+AFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  221   VHARAXGIKREYNELDTVWFMAGSLFQQYPYDIPTDAFPFEIFKQAFVAVQSCVVHLQKV  280

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLL+Y SNC+AML A+DGAVQLVVDRPYK GE I VWCGPQPNSKLL
Sbjct  281   SLAQRFALVPLGPPLLAYGSNCRAMLTAIDGAVQLVVDRPYKAGESIAVWCGPQPNSKLL  340

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVDEDN YDR+ +EAALNTEDPQYQDKR+ AQ NGK SVQ F VY G+EKET+ +M
Sbjct  341   INYGFVDEDNSYDRLVVEAALNTEDPQYQDKRMVAQGNGKLSVQTFQVYAGKEKETVFDM  400

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCPVS  596
             LPYLRLGYVSDPSEMQ V+SSQGP+CPVS
Sbjct  401   LPYLRLGYVSDPSEMQSVISSQGPICPVS  429



>ref|XP_008800377.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X4 [Phoenix dactylifera]
Length=432

 Score =   377 bits (968),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  224   LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  283

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRPYK GEPIVVWCGPQPNS+LL
Sbjct  284   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVKLVVDRPYKAGEPIVVWCGPQPNSRLL  343

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDRV +EA+LN EDPQ+Q+KR+ AQRNGK +VQ F VYVGREKE ISEM
Sbjct  344   LNYGFVDEDNPYDRVVVEASLNMEDPQFQEKRMVAQRNGKLAVQVFRVYVGREKEAISEM  403

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVCP  602
             LPY+RLGYVSDP+EMQ V+SSQGP+CP
Sbjct  404   LPYMRLGYVSDPAEMQSVISSQGPICP  430



>gb|KJB40695.1| hypothetical protein B456_007G073800 [Gossypium raimondii]
Length=417

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  202   VLERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  261

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
              LA+RFALVPLGPPLL+Y SNCKAML+AV+GAV+LVVDR  K GEPIVVWCGPQPNSKLL
Sbjct  262   PLAQRFALVPLGPPLLAYRSNCKAMLSAVNGAVELVVDRACKAGEPIVVWCGPQPNSKLL  321

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             INYGFVD+DN YDR+ +EAALNTEDPQYQDKRL  QRNGK SVQ FHVY G+EKE +S+M
Sbjct  322   INYGFVDDDNSYDRLVVEAALNTEDPQYQDKRLVVQRNGKLSVQVFHVYAGKEKEAVSDM  381

Query  682   LPYLRLGYVSDPSEMQFVLSSQG  614
             LPYLRLGYVSDPSEMQ VLSSQG
Sbjct  382   LPYLRLGYVSDPSEMQSVLSSQG  404



>dbj|BAJ99196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGIK+EY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  223   VVVRDEGIKKEYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQKV  282

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS+LL
Sbjct  283   SLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNSRLL  342

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYGFVDEDNPYDR+ +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F V VG+EK+TISEM
Sbjct  343   LNYGFVDEDNPYDRIAIEASLNTEDPQYQEKRMVAQRNGKLAIQKFQVCVGKEKQTISEM  402

Query  682   LPYLRLGYVSDPSEMQFVLSSQG  614
             LPYLRLGY+SDP EMQ +LSS+G
Sbjct  403   LPYLRLGYISDPDEMQCILSSEG  425



>ref|NP_001132025.1| hypothetical protein [Zea mays]
 gb|ACF80700.1| unknown [Zea mays]
 tpg|DAA58395.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
 tpg|DAA58396.1| TPA: hypothetical protein ZEAMMB73_027665 [Zea mays]
Length=252

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = -1

Query  1063  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  884
             ++  QKVSLARRFALVPLGPPLL+Y SNCKAML A   +V+LVVDRPYK GEPI++WCGP
Sbjct  10    LIQEQKVSLARRFALVPLGPPLLTYRSNCKAMLTADGDSVRLVVDRPYKAGEPIIIWCGP  69

Query  883   QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGRE  704
             Q NS+L++NYGFVDEDNP+DRV +EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+VYVG+E
Sbjct  70    QTNSRLVLNYGFVDEDNPFDRVAIEASLNTEDPQYQEKRMVAQRNGKLAIQNFNVYVGKE  129

Query  703   KETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
             K+T++EMLPYLRLGY+S+P EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPT
Sbjct  130   KQTVAEMLPYLRLGYISNPDEMQSILSSEGDTCPVSPCTERAVLDQLVGYLESRLAGYPT  189

Query  523   TlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAP  344
             TL EDEA+LAD +L+PKK VAT+LVRLEK++L+ CLQ T   I+ LPD +VSPCPAPYAP
Sbjct  190   TLDEDEAMLADGNLEPKKEVATRLVRLEKKMLHACLQATNEFINDLPDHTVSPCPAPYAP  249

Query  343   ILK  335
              LK
Sbjct  250   ELK  252



>gb|AFW83391.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
 gb|AFW83392.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
Length=252

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 208/243 (86%), Gaps = 0/243 (0%)
 Frame = -1

Query  1063  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  884
             ++  QKVSLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGP
Sbjct  10    LIQEQKVSLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGP  69

Query  883   QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGRE  704
             Q NS+L++NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+VYVG+E
Sbjct  70    QTNSRLVLNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYVGKE  129

Query  703   KETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
             K+T++EMLPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPT
Sbjct  130   KQTVAEMLPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLGGYLESRLAGYPT  189

Query  523   TlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAP  344
             TL+EDEA+LAD  L+PK+ VAT+LVRLEK++L+ CLQ T   I  LPD +VSPCPA YAP
Sbjct  190   TLNEDEAMLADGSLEPKQEVATRLVRLEKKMLHACLQATNEFITDLPDHTVSPCPAQYAP  249

Query  343   ILK  335
              +K
Sbjct  250   EMK  252



>ref|XP_010912843.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Elaeis guineensis]
Length=423

 Score =   349 bits (895),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 183/206 (89%), Gaps = 2/206 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ER EGIKREY+ELDTVWFMAGSLFQQYP+DIPTEAFPFEIFKQAFVA+QSCVVHLQKV
Sbjct  217   LLERDEGIKREYNELDTVWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAIQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             +LARRFALVPLGPPLL+Y SNCKAML AV  AV+LVVDRP+K GEPIVVWCGPQPNS+LL
Sbjct  277   NLARRFALVPLGPPLLAYKSNCKAMLTAVSDAVELVVDRPFKAGEPIVVWCGPQPNSRLL  336

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEM  683
             +NYG VDEDNPYDR+ +EA+LN EDPQYQ+KR+ AQRNGK +VQ FHV+VGREKE ISEM
Sbjct  337   LNYGLVDEDNPYDRIAVEASLNMEDPQYQEKRMVAQRNGKLAVQVFHVFVGREKEAISEM  396

Query  682   LPYLRLGYVSDPSEMQFVLSSQGPVC  605
             LPY+RLGY+S   E     SS GP C
Sbjct  397   LPYMRLGYLS--CEPVHGASSIGPTC  420



>gb|AFW83393.1| hypothetical protein ZEAMMB73_866859 [Zea mays]
Length=281

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 206/272 (76%), Gaps = 29/272 (11%)
 Frame = -1

Query  1063  VVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGP  884
             ++  QKVSLARRFALVPLGPPLL+Y SNCKAML     +V+LVVDRPYK GEPI++WCGP
Sbjct  10    LIQEQKVSLARRFALVPLGPPLLTYKSNCKAMLTVDGESVRLVVDRPYKAGEPIIIWCGP  69

Query  883   QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGRE  704
             Q NS+L++NYGFVDE+NP+DR+++EA+LNTEDPQYQ+KR+ AQRNGK ++Q F+VYVG+E
Sbjct  70    QTNSRLVLNYGFVDENNPFDRISIEASLNTEDPQYQEKRMVAQRNGKHAIQNFNVYVGKE  129

Query  703   KETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
             K+T++EMLPYLRLGY+SDP EMQ +LSS+G  CPVSPCTERAVLDQL  Y ++RL  YPT
Sbjct  130   KQTVAEMLPYLRLGYISDPDEMQSILSSEGDTCPVSPCTERAVLDQLGGYLESRLAGYPT  189

Query  523   Tlsedeallad-----------------------------ndlDPKKRVATQLVRLEKRI  431
             TL+EDEA++                                 L+PK+ VAT+LVRLEK++
Sbjct  190   TLNEDEAMVMSCDFLRVVSWSLYKLAECYGIGFGHCQLADGSLEPKQEVATRLVRLEKKM  249

Query  430   LNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             L+ CLQ T   I  LPD +VSPCPA YAP +K
Sbjct  250   LHACLQATNEFITDLPDHTVSPCPAQYAPEMK  281



>emb|CDX85607.1| BnaA02g02060D [Brassica napus]
Length=371

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ERAEGIKREYSELDTVWFMAGSLFQQYP+DIPTEAF FEIFKQAFVA+QSCVVHLQ V
Sbjct  198   VLERAEGIKREYSELDTVWFMAGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHLQNV  257

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+YCSNCKAML AVDGAV+LVVDR YK G+PIV WCGPQPN+KLL
Sbjct  258   SLARRFALVPLGPPLLAYCSNCKAMLTAVDGAVELVVDRAYKAGDPIVAWCGPQPNAKLL  317

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREK  701
             +NYGFVDEDNPYDR+ +EAAL+T+DPQYQDKRL AQRNGK S Q F V V +E+
Sbjct  318   LNYGFVDEDNPYDRIIVEAALSTDDPQYQDKRLVAQRNGKLSQQVFQVRVEKER  371



>gb|EPS58823.1| hypothetical protein M569_15990, partial [Genlisea aurea]
Length=370

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             +++RAEG+++EY ELDTVWFMAGSLF+QYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQKV
Sbjct  203   ILKRAEGVRKEYDELDTVWFMAGSLFKQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  262

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLA+RFALVPLGPPLLSY S CKAML  VDGAVQLVVDR YK+GEPIVVWCGPQPNSKLL
Sbjct  263   SLAKRFALVPLGPPLLSYGSKCKAMLTVVDGAVQLVVDRHYKSGEPIVVWCGPQPNSKLL  322

Query  862   INYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  719
             INYGFVDEDNPYDR+  E +LNTEDP YQDKRLAAQRNGK S+Q F V
Sbjct  323   INYGFVDEDNPYDRMVFEVSLNTEDPLYQDKRLAAQRNGKLSIQDFQV  370



>gb|EMT26543.1| hypothetical protein F775_31105 [Aegilops tauschii]
Length=257

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 181/239 (76%), Gaps = 29/239 (12%)
 Frame = -1

Query  1051  QKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  872
             QKVSLARRFALVPLGPPLL+Y SNCKAML AVDG+V+L+VDRPYK GEPI+VWCGPQPNS
Sbjct  48    QKVSLARRFALVPLGPPLLTYKSNCKAMLTAVDGSVRLLVDRPYKAGEPIIVWCGPQPNS  107

Query  871   KLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETI  692
             +LL+NYGFVDEDNPYDR+ +E                             V VG+EKETI
Sbjct  108   RLLLNYGFVDEDNPYDRIAIE-----------------------------VCVGKEKETI  138

Query  691   SEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlse  512
             SEMLPYLRLGY+SDP EMQ +LSS+G  CPVSPC+ERAVLDQL  Y K+RL  YPTTL E
Sbjct  139   SEMLPYLRLGYISDPDEMQCILSSEGDTCPVSPCSERAVLDQLVVYLKSRLAGYPTTLDE  198

Query  511   dealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
             DE++LAD  L+PKK VAT+LVRLEK++L+ CLQ     I  LPD +VSPCPA YAP LK
Sbjct  199   DESMLADGSLEPKKEVATRLVRLEKKMLHGCLQAANEFISGLPDHTVSPCPALYAPELK  257



>gb|KDO55673.1| hypothetical protein CISIN_1g008853mg [Citrus sinensis]
Length=355

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             ++ERAEGIKREY+ELDTVWFMAGSLFQQYPYDIPTEAF FEIFKQAFVAVQSCVVHLQKV
Sbjct  217   ILERAEGIKREYNELDTVWFMAGSLFQQYPYDIPTEAFTFEIFKQAFVAVQSCVVHLQKV  276

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLL  863
             SLARRFALVPLGPPLL+Y S CKAMLAAVD AVQLVVDRPYK GE IVVWCGPQPNSKLL
Sbjct  277   SLARRFALVPLGPPLLAYSSKCKAMLAAVDDAVQLVVDRPYKAGESIVVWCGPQPNSKLL  336

Query  862   INYGFVDEDNPYDRVTLE  809
             INYGFVDEDNPYDR+ +E
Sbjct  337   INYGFVDEDNPYDRLVVE  354



>ref|XP_005644855.1| hypothetical protein COCSUDRAFT_48681 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20311.1| hypothetical protein COCSUDRAFT_48681 [Coccomyxa subellipsoidea 
C-169]
Length=539

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 179/267 (67%), Gaps = 4/267 (1%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             + ER +GI++EY+ELDTVWFMAGSLF+ YPYD+PTEAF  ++F+Q F AVQ+ VVHLQ V
Sbjct  152   IKERLKGIEKEYAELDTVWFMAGSLFKSYPYDVPTEAFSLKLFRQGFAAVQASVVHLQGV  211

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSK  869
              L++RFALVPLGPPLLSY S  KAML     A  VQL VDR Y  GEPI  WCGPQPN +
Sbjct  212   PLSKRFALVPLGPPLLSYSSTAKAMLTYNREAKEVQLAVDRSYTKGEPIEAWCGPQPNRR  271

Query  868   LLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETIS  689
             LL+NYG V ++NP+D++ L   L   DP +Q KR   Q+N  S+ Q F +   R+K    
Sbjct  272   LLLNYGIVTDNNPHDKMALTVTLPHADPLFQAKRAVLQQNNLSTQQTFQLQ--RDKGLPE  329

Query  688   EMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsed  509
              +LPYLRL + +D + ++          P+SP  ER VL QLA + + RL RY TT  ED
Sbjct  330   LLLPYLRLAHCTDAASLKLATLDTCCAAPISPENERTVLHQLASHLQDRLDRYKTTCEED  389

Query  508   ealladndlDPKKRVATQLVRLEKRIL  428
             E ++      P+++VA +L+R+EK IL
Sbjct  390   EVIIRSTTAGPRQKVAARLLRIEKAIL  416



>ref|XP_002509559.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50946.1| conserved hypothetical protein [Ricinus communis]
Length=348

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  820  VTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSE  641
            V L+AALNTEDPQYQDKR+ AQRNGK S+Q F +YVG+EKE IS++LPYLRLGYVSDPSE
Sbjct  187  VHLQAALNTEDPQYQDKRMVAQRNGKLSIQVFQIYVGKEKEAISDILPYLRLGYVSDPSE  246

Query  640  MQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVA  461
            MQ V+SSQGP+CPVSPC E+AVLDQLA+YFK RL  YPT+L+EDE +LAD++L+PKKRVA
Sbjct  247  MQSVISSQGPICPVSPCMEQAVLDQLADYFKRRLAGYPTSLNEDELMLADHNLNPKKRVA  306

Query  460  TQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
            TQLVRLEK+ILN CLQ T  LI+QLPDLSVSPCPAPYAPILK
Sbjct  307  TQLVRLEKKILNACLQATADLINQLPDLSVSPCPAPYAPILK  348


 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  1049
             V+ERA+GIKREY ELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVA+QSCVVHLQ
Sbjct  133   VLERADGIKREYDELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAIQSCVVHLQ  190



>gb|KIY95099.1| hypothetical protein MNEG_12863, partial [Monoraphidium neglectum]
Length=281

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 176/272 (65%), Gaps = 12/272 (4%)
 Frame = -1

Query  1201  IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  1022
             +++EY  LD VWFMAGSLF +YP+DIPTEAFPFE F+QAF AVQ+ VVHLQ V+ +RRFA
Sbjct  1     MRKEYEALDGVWFMAGSLFNKYPFDIPTEAFPFERFRQAFAAVQASVVHLQGVAPSRRFA  60

Query  1021  LVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  848
             LVPLGPPLLSY S CKAML+  D A  V+LVVDR Y+ G+P+  WCGPQPNS+LL+NYG 
Sbjct  61    LVPLGPPLLSYSSTCKAMLSHNDAAKRVELVVDRDYQVGDPVYAWCGPQPNSRLLLNYGI  120

Query  847   VDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY-------VGREKETIS  689
             VDE NP+D++ L   L + DP Y+ KR    + G S++QA  ++       + R +    
Sbjct  121   VDESNPFDKLQLTVTLPSSDPLYKAKRDKLDKAGLSTMQARGLFFTISTFDLKRSEPLPP  180

Query  688   EMLPYLRLGYVSDPSEMQFV-LSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlse  512
              +LPY+RL +     +M  V L +  P  P+    E+     L+ + + RL  Y   L +
Sbjct  181   LLLPYMRLAFSRSAEQMAAVQLEAGAP--PIDAGIEQQAACALSGHLEKRLASYRRPLWK  238

Query  511   dealladndlDPKKRVATQLVRLEKRILNTCL  416
             D  +L D    P+++VA +L ++EK IL  CL
Sbjct  239   DLEILEDPKSTPRQKVAARLTKIEKSILQGCL  270



>ref|XP_011396833.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
 gb|KFM23955.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
Length=453

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 150/237 (63%), Gaps = 6/237 (3%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V ER +GI REY+ELDTVWFMAGSLF QYPYDIPTE F  E+F+QAF AVQSCVVHLQ V
Sbjct  183   VNERMKGIDREYAELDTVWFMAGSLFNQYPYDIPTEQFTPEVFRQAFAAVQSCVVHLQGV  242

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
              L++RFALVPLGPPLL+Y S   AML        VQL  DR Y+ GEP++ WCGPQPNS+
Sbjct  243   PLSQRFALVPLGPPLLTYSSTASAMLRYDPTSREVQLAADRAYRPGEPVLAWCGPQPNSR  302

Query  868   LLINYGFVDEDNPYDRVTLEAALNTEDPQYQDK--RLAAQRNGKSSVQAFHVYVGREKET  695
             LL+NYG VDE NPYDR+ LEA +   DP Y  K  RLA Q  G ++ Q F +  G     
Sbjct  303   LLLNYGIVDEANPYDRLPLEAIIPASDPLYSLKRGRLAEQGGGLATQQLFQLSRG-ATPL  361

Query  694   ISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
              + + P+LRL     P ++  V    G   P+   +E   L  L      RL RYP 
Sbjct  362   PAPLFPFLRLALARTPRDVWAVEFGPG-AGPLDGGSEARALGTLRTRLAARLARYPA  417



>ref|XP_005847730.1| hypothetical protein CHLNCDRAFT_57818 [Chlorella variabilis]
 gb|EFN55628.1| hypothetical protein CHLNCDRAFT_57818 [Chlorella variabilis]
Length=435

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 175/264 (66%), Gaps = 5/264 (2%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R +GI++EY ELDTVW++AGSLF + P+  PTE F F +F+QAF AVQS VVHLQ V+L 
Sbjct  146   RLQGIRKEYEELDTVWYLAGSLFNRQPFSPPTEQFSFPVFRQAFTAVQSSVVHLQGVALG  205

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
             +RFALVP+GPPLL+Y S  KAML        V+L VDR Y+ GE ++ WCGPQPNS+LLI
Sbjct  206   KRFALVPMGPPLLTYSSTAKAMLKFDPESHEVRLAVDRAYQPGEAVLAWCGPQPNSRLLI  265

Query  859   NYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEML  680
             NYG VDE NPYD++ L   + ++DP Y+ KR      G S+ Q F +         +++L
Sbjct  266   NYGIVDESNPYDKLPLSITIPSDDPLYRLKRDRLAERGLSTQQTFQLQAA--ASLPAQLL  323

Query  679   PYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedeal  500
             PYLRL + +  ++++ V   +    PV+P  E  VL+QL  + + R  RY TT+ EDEA+
Sbjct  324   PYLRLVHSTREADVEGV-KWEEEAGPVAPENELTVLNQLITHLRLRQSRYRTTIEEDEAI  382

Query  499   ladndlDPKKRVATQLVRLEKRIL  428
             +AD    P+  VA +L+++EK IL
Sbjct  383   IADPAKGPRPTVAARLLKIEKGIL  406



>gb|EMS66279.1| hypothetical protein TRIUR3_22444 [Triticum urartu]
Length=174

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 137/202 (68%), Gaps = 29/202 (14%)
 Frame = -1

Query  940  LVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLA  761
            +V+   Y  G    V CGPQPNS+LL+NYGFVDEDNPYDR+ +E                
Sbjct  2    VVMGNQYDRGVRAKVRCGPQPNSRLLLNYGFVDEDNPYDRIAIE----------------  45

Query  760  AQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTER  581
                         V VG+EKETISEMLPYLRLGY+SDP EMQ +LSS+G  CPVSPC+ER
Sbjct  46   -------------VCVGKEKETISEMLPYLRLGYISDPDEMQCILSSEGDTCPVSPCSER  92

Query  580  AVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLH  401
            AVLDQL  Y K+RL  YPTTL EDEA+LA+  L+PKK VAT+LVRLEK++L+ CLQ    
Sbjct  93   AVLDQLVVYLKSRLAGYPTTLDEDEAMLAEGSLEPKKEVATRLVRLEKKMLHGCLQAANE  152

Query  400  LIDQLPDLSVSPCPAPYAPILK  335
             I  LPD +VSPCPA YAP LK
Sbjct  153  FISGLPDHTVSPCPALYAPELK  174



>ref|XP_002955272.1| hypothetical protein VOLCADRAFT_76643 [Volvox carteri f. nagariensis]
 gb|EFJ43572.1| hypothetical protein VOLCADRAFT_76643 [Volvox carteri f. nagariensis]
Length=488

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 160/268 (60%), Gaps = 8/268 (3%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V +R  GI++EY  LDTVWFMAGSLF +YP+D+PTE F FE+F+QAF  VQ+ +VHLQ V
Sbjct  180   VRQRQAGIRKEYEALDTVWFMAGSLFNKYPFDLPTETFSFELFQQAFAVVQASIVHLQGV  239

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDG--AVQLVVDRPYKTGEPIVVWCGPQPNSK  869
              +A+RFALVPLGPPL++Y S  K M+   +   +V+LVV  P + G P+  WCGPQPNS+
Sbjct  240   PIAKRFALVPLGPPLMAYSSTSKNMMTYDEDSRSVRLVVSGPVEAGRPVAAWCGPQPNSR  299

Query  868   LLINYGFVDEDNPYDRVT--LEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKET  695
             LL+NYG VDE NP+D++       L T DP +  KR      G ++ Q+F V V R    
Sbjct  300   LLLNYGVVDEHNPFDKLQARFTFTLPTSDPLFPAKRAVLSEAGLATQQSFDVSVAR--PL  357

Query  694   ISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTls  515
               ++LPY+ L   + P ++  V  S           E A L  L  Y + R   Y   L 
Sbjct  358   PPQLLPYMMLALATTPEQVASVSFSD--TAGHDRELEAAALAALMAYVQRRTAAYAHPLW  415

Query  514   edealladndlDPKKRVATQLVRLEKRI  431
              D  ++ D    P+++VA +L ++EK I
Sbjct  416   RDLEIINDPSSTPRQKVAARLTKIEKSI  443



>gb|EPS66857.1| hypothetical protein M569_07920, partial [Genlisea aurea]
Length=132

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  724  HVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKT  545
             VYVG+EKE + +MLP LRLGYVSDPS++Q VL++QG  CPVSPCTERAVL+QL+EYF  
Sbjct  3    QVYVGKEKEAVMDMLPLLRLGYVSDPSDVQSVLAAQGRTCPVSPCTERAVLEQLSEYFVN  62

Query  544  RLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLHLIDQLPDLSVSP  365
            RL  YPT LSEDEALLA +DL+PK+RVAT+LVRLEK+IL   L+ T+ LI++LPD SVSP
Sbjct  63   RLAGYPTALSEDEALLAGSDLNPKRRVATRLVRLEKKILEASLKATVDLINELPDHSVSP  122

Query  364  CPAPYAPILK  335
            CPAPYAP +K
Sbjct  123  CPAPYAPTIK  132



>gb|KDD71504.1| hypothetical protein H632_c4901p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=168

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = -1

Query  1126  IPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA  947
             +PTE F   +F QAF AVQS VVHLQ V LARRFA+VPLGPPLL Y S C+A L   + +
Sbjct  1     MPTEQFDLPLFAQAFAAVQSSVVHLQGVPLARRFAIVPLGPPLLRYSSRCRAALRYDEES  60

Query  946   --VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
               V+L VDR    GE +V WCGPQPNS+LLINYGFVD DNPYD + L  +L++EDP +  
Sbjct  61    DQVRLAVDRDVAAGEALVAWCGPQPNSRLLINYGFVDPDNPYDMLELVVSLSSEDPLFHR  120

Query  772   KR  767
             KR
Sbjct  121   KR  122



>emb|CDX85606.1| BnaA02g02070D [Brassica napus]
Length=102

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  640  MQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVA  461
            MQ V+SSQGPVC +SPC ERAVLDQLA+YF TRL  YPTTL ED+ALLAD  L+P+KRVA
Sbjct  1    MQSVISSQGPVCSMSPCMERAVLDQLADYFMTRLSGYPTTLKEDDALLADPSLNPRKRVA  60

Query  460  TQLVRLEKRILNTCLQTTLHLIDQLPDLSVSPCPAPYAPILK  335
            T+LVRLEK++L  CL  T+  +++LPD ++SPCPA YAP LK
Sbjct  61   TRLVRLEKKMLAACLVATVDFLNELPDTTISPCPALYAPSLK  102



>gb|AFW83390.1| hypothetical protein ZEAMMB73_201403, partial [Zea mays]
Length=130

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQ  1049
             V+ R E I+REY+ELDT+WFMAGSLFQQYP+DIPTEAFPFEIFKQAFVAVQSCVVHLQ
Sbjct  71    VVARDEAIRREYNELDTLWFMAGSLFQQYPFDIPTEAFPFEIFKQAFVAVQSCVVHLQ  128



>gb|EMT26542.1| hypothetical protein F775_31104 [Aegilops tauschii]
Length=393

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V+ R EGI+REY+ELDT+WFMAGSLF+QYP+D+PTEAFPFEIFKQAFVAVQSCVVHLQ +
Sbjct  240   VVVRDEGIRREYNELDTLWFMAGSLFKQYPFDVPTEAFPFEIFKQAFVAVQSCVVHLQDL  299

Query  1042  S  1040
             +
Sbjct  300   N  300



>ref|XP_001754113.1| predicted protein [Physcomitrella patens]
 gb|EDQ81014.1| predicted protein [Physcomitrella patens]
Length=638

 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 137/289 (47%), Gaps = 22/289 (8%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
             V +R+  ++ EY +L        S F + P   P E F  E FK AF  + S  V+L   
Sbjct  207   VQQRSAALEGEYEDLQ-------SYFTKDPQAFPQEYFSLEAFKSAFSVILSRAVYLPSA  259

Query  1042  SLARRFALVPLGPPLLSYCSNCKAML--AAVDGAVQLVVDRPYKTGEPIVVWCG-PQPNS  872
              L   FALVP    L ++ ++ +A L  +  D AV   VDR YK GE +    G  + N+
Sbjct  260   DL---FALVPYADAL-NHRADSQAYLDYSMEDQAVVFPVDRNYKEGEQVFTSYGRERSNA  315

Query  871   KLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETI  692
              LLI YGFVDE+N  D + LE  L   D     K+   Q+    S Q F +Y+ R     
Sbjct  316   DLLITYGFVDENNAMDYLDLEVGLVDGDRLLVLKQQILQQAMLDSPQTFPLYLDR---FP  372

Query  691   SEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlse  512
             +++L Y+RL  + DP+    ++  +  +  +    E   L  L    +T+L  Y   + +
Sbjct  373   TQLLTYMRLSRLQDPALFPKIVFDKDIM--LDQANEYECLQLLMGECRTKLGNYEGGVDD  430

Query  511   dealladndlDPKKRVATQLVRLEKRILN---TCLQTTLHLIDQLPDLS  374
             +  LL +  +  ++RVA QL   EK+IL    T L+  L  I  +P  S
Sbjct  431   EIRLLKNKKISQRERVAAQLRLCEKKILTSTMTALRNRLAPIRGIPTKS  479



>ref|XP_002993188.1| hypothetical protein SELMODRAFT_449044 [Selaginella moellendorffii]
 gb|EFJ05708.1| hypothetical protein SELMODRAFT_449044 [Selaginella moellendorffii]
Length=600

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 136/306 (44%), Gaps = 22/306 (7%)
 Frame = -1

Query  1129  DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDG  950
             D P E F F  FK AF  V S  V+L    L   FALVP G  +    S         + 
Sbjct  195   DFPMEKFTFSAFKTAFSVVLSRAVYLPSAEL---FALVPFGDLINHESSRSLLDYDIEEQ  251

Query  949   AVQLVVDRPYKTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
              V+L VD+ YK G+ +   +     ++  LI YGF+DE +  D + +E  L + D     
Sbjct  252   KVKLAVDKRYKKGDQVFASYAQNLTSADFLIRYGFLDESDENDCIEIEVGLVSGDSLAPL  311

Query  772   KRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSP  593
             KR   Q  G +  Q F +Y+ R     +++L Y RL  + D      +   +  +  VS 
Sbjct  312   KREILQEVGLTVPQKFPLYLNR---FPTQLLTYTRLARIQDSGLFAKITFEKDLI--VSQ  366

Query  592   CTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILN---T  422
               E   L  L    +T+LL    T+ ++   L   +L  K+RVA QL   EKRIL    +
Sbjct  367   TNEYETLMLLMADCRTKLLSSSDTMEDEMQTLRRKNLSYKQRVAAQLRLKEKRILTDTMS  426

Query  421   CLQTTLHLIDQLPDLSVSPCPAPYAPILK**GIVQQRNKKKLFFQSENGRLLDAANTWCW  242
              L+  L  I  +P  S      P + I +   +V+QR   ++  ++ +  LL       W
Sbjct  427   ALRNRLAPIRGIPTKS-GNLKDPNSDIREMFDMVEQR---EVVNETVSKGLLQ------W  476

Query  241   NCWVLV  224
              CW+++
Sbjct  477   YCWMIL  482



>ref|XP_005705388.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
 gb|EME28868.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
Length=490

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 136/280 (49%), Gaps = 33/280 (12%)
 Frame = -1

Query  1195  REYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALV  1016
             REY+      ++  ++  Q P +  ++   F+ F+ AF  + S  +       ++R ALV
Sbjct  230   REYT------YLGKNIIPQIP-NFASKPIDFKQFQWAFGILFSRAICFPS---SKRIALV  279

Query  1015  PLGPPLLSYCSNCKAMLAAV-----DGAVQLVV--DRPYKTGEPIVVWCGPQPNSKLLIN  857
             P    LL++   C A +        +G  + VV  DR Y+  E + V  GP+ N +LL+ 
Sbjct  280   PYAD-LLNHSPFCSAFIDEEKIPFGNGVTEAVVYVDRLYEPYEQVYVSYGPRSNQELLLL  338

Query  856   YGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLP  677
             YGF  E NP+D V +   L+  DP Y +K    +  GKS +Q+F +Y+ R      EM  
Sbjct  339   YGFSLERNPFDCVEITIGLDKTDPLYLEKCRMLESYGKSPLQSFPLYMDRYP---VEMAE  395

Query  676   YLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedea--  503
             +LR   +   +++Q   +  G +  VS   E + LD+L  Y   +L +YPT+L +DE   
Sbjct  396   FLRFCCIDTETDLQ---ADFGTI--VSASNEESALDKLLNYIVDQLRKYPTSLEDDEKII  450

Query  502   --lladndlDPKKRVATQLVRLEKRILNTC---LQTTLHL  398
                     L+  +R+A +    EKRIL+     LQ + HL
Sbjct  451   RDRAMFQTLEKNQRMAIRQRLGEKRILHATWRNLQNSSHL  490



>ref|XP_002965462.1| hypothetical protein SELMODRAFT_406852 [Selaginella moellendorffii]
 gb|EFJ32882.1| hypothetical protein SELMODRAFT_406852 [Selaginella moellendorffii]
Length=481

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 107/239 (45%), Gaps = 9/239 (4%)
 Frame = -1

Query  1129  DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDG  950
             D P E F F  FK AF  V S  V+L    L   FALVP G  +    S         + 
Sbjct  195   DFPMEKFTFSAFKAAFSVVLSRAVYLPSAEL---FALVPFGDLINHESSRSLLDYDIEEQ  251

Query  949   AVQLVVDRPYKTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
              V+L VD+ YK G+ +   +     ++  LI YGF+DE +  D + +E  L + D     
Sbjct  252   KVKLAVDKRYKKGDQVFASYAQNLTSADFLIRYGFLDESDENDFIEIEVGLVSGDSLAPL  311

Query  772   KRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSP  593
             KR   Q  G +  Q F VY+ R     +++L Y RL  + D      +   +  +  V  
Sbjct  312   KREILQEVGLTVPQKFPVYLNR---FPTQLLTYTRLARIQDSGLFAKITFEKDLI--VCQ  366

Query  592   CTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCL  416
               E   L  L    +T+LL +  T+ +D   L   +L  K+RVA QL   EKRIL   +
Sbjct  367   TNEYETLMLLMADCRTKLLSFSDTMEDDMQTLKRKNLSYKQRVAAQLRLKEKRILTDTM  425



>ref|XP_002320530.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
 gb|EEE98845.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
Length=561

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 86/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   
Sbjct  258   AIERITNVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--  309

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++ S  +  L        V    DRPY+ GE + +  G + N +
Sbjct  310   SMDGRVALVPWAD-MLNHSSEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGRKSNGE  368

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV  +  NP D V L  +L   D  Y++K  A +++G S  Q F + V
Sbjct  369   LLLSYGFVPREGTNPSDSVELSLSLKKSDKCYKEKLEALKKHGLSVSQCFPLQV  422



>emb|CBJ29688.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Ectocarpus siliculosus]
Length=521

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/245 (29%), Positives = 107/245 (44%), Gaps = 20/245 (8%)
 Frame = -1

Query  1222  VIERAEGIKR----EYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVH  1055
             VI   E ++R    EY+ ++        L  ++P  +P E   +E F+ AF  + S  + 
Sbjct  228   VIAATESMRRKLEVEYATVEN------DLLDKFPEILPREVHTYEEFQWAFAMLFSRAIR  281

Query  1054  LQKVSLARRFALVPLG------PPLLSYC-SNCKAMLAAVDGAVQLVVDRPYKTGEPIVV  896
             L  +S     ALVP        P   SY  +  + +  +    V +  DR YK  E + +
Sbjct  282   LGGLSTGEAVALVPYADLFNHNPFANSYIDARQQGLFFSKTDEVVVYADRSYKKMEQVYI  341

Query  895   WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY  716
               GP+ NS LL+ YGF  + NPY+ V +  +L+  D  Y+ K+      G    +AF +Y
Sbjct  342   SYGPKGNSDLLLLYGFSLDRNPYNSVDVTVSLDENDELYERKKAFLSEAGLPPTKAFPLY  401

Query  715   VGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRLL  536
               R  +   E+L YLRL  ++        L         +   E  VLD L E  K  + 
Sbjct  402   NDRYPD---ELLQYLRLIQLNTDQLRGRTLEDLSFEKKQTDVNELMVLDSLVEACKATIA  458

Query  535   RYPTT  521
              YPTT
Sbjct  459   GYPTT  463



>ref|XP_011008074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Populus euphratica]
Length=503

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   
Sbjct  200   AIERITNVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--  251

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L        V    DRPY+ GE + +  G + N +
Sbjct  252   SMDGRVALVPWAD-MLNHSCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGRKSNGE  310

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F + V
Sbjct  311   LLLSYGFVPSEGTNPSDSVELPLSLKKSDKYYKEKLEALKKHGLSASQCFPLQV  364



>ref|XP_010464405.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  366



>ref|XP_002882542.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58801.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  198   RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  365



>ref|XP_004502116.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=503

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 86/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP   P E F  + FK +F  + S +V L   
Sbjct  200   AIERTNNVIGTYNDLRL------RIFSKYPDFFPEEVFNIDSFKWSFGILFSRMVRLP--  251

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  + ALVP    +L++  + +  L    V   +    DRPY+ GE + +  G + N +
Sbjct  252   SMDGKVALVPWAD-MLNHSCDVETFLDYDKVSKGIVFTTDRPYQPGEQVFISYGKKSNGE  310

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +LN  D  Y++K    ++ G S  Q F V +
Sbjct  311   LLLSYGFVPKEGTNPCDSVELSLSLNKSDESYEEKLELLKKYGLSGSQCFPVRI  364



>ref|XP_006297498.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
 gb|EOA30396.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
Length=498

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 87/171 (51%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P+  P E F  E FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELALSLRKTDECYKEKLDALKKHGLSTPQCFPVRI  366



>gb|KIZ05290.1| hypothetical protein MNEG_2664 [Monoraphidium neglectum]
Length=449

 Score = 76.6 bits (187),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 116/250 (46%), Gaps = 11/250 (4%)
 Frame = -1

Query  1153  SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL--LSYCSN  980
             + F + P       F    F +AF  V   + H   +  A  FAL+PL   L      + 
Sbjct  149   AFFSKDPARFDPATFNEAAFLRAFCVV---LAHASYLPSAELFALLPLAGQLGRTGNENG  205

Query  979   CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  800
             C     A  GAV L   RPY+ G+ +++  G +PN +LL+ +G V ++N  D +   A+L
Sbjct  206   CDLDYDAGSGAVVLKSARPYREGQEVLLNDG-RPNGELLLCFGTVQDNNLSDFLLFNASL  264

Query  799   NTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSS  620
                D  YQ K+   Q  G SS + F VY   +K  I ++L YLRL  + DP+   F  +S
Sbjct  265   VRADKYYQSKQQLLQAMGMSSEERFPVYA--DKFPI-QLLAYLRLSRIQDPA--LFAKAS  319

Query  619   QGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLE  440
                   V+   E  VL  L    + RL  Y T++ E+   L   DL    R+A +L   E
Sbjct  320   FDSDVVVTQMNEYEVLQLLMGDCRERLAAYKTSMEEEIKALQSPDLSGTARLAARLRMGE  379

Query  439   KRILNTCLQT  410
             KRIL+  +  
Sbjct  380   KRILSQFMDA  389



>gb|KCW89047.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=344

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  41    AIERITNVIGTYDDLRS------RIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--  92

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +
Sbjct  93    SMDGRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGE  151

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V +
Sbjct  152   LLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQI  205



>gb|AAC14296.1| putative methyltransferase [Arabidopsis thaliana]
Length=504

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198   RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>ref|NP_187424.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAF13085.1|AC009176_12 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAF21177.1|AC013483_1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAK76599.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAL85066.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AEE74585.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198   RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>gb|KCW89046.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=381

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  78    AIERITNVIGTYDDLRS------RIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--  129

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +
Sbjct  130   SMDGRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGE  188

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V +
Sbjct  189   LLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQI  242



>ref|XP_010524627.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=508

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 97/197 (49%), Gaps = 12/197 (6%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + L T   +   +F ++P   P E F  E F  +F  + S +V L   S+ 
Sbjct  202   RERAIERVTNVLGTYDDLRSRIFSKHPLLFPEEVFNVETFIWSFGILFSRLVRLP--SMD  259

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    K  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  260   GRFALVPWAD-MLNHNCEVKTFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  318

Query  859   NYGFV--DEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISE  686
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G ++ Q F +   R      E
Sbjct  319   SYGFVPGEGTNPSDSVELSVSLRKTDKCYKEKLDALRKHGLTTPQCFPI---RVTGWPLE  375

Query  685   MLPYLRLGYVSDPSEMQ  635
             ++ Y  L  V+ PS+M+
Sbjct  376   LMAYAYL--VASPSDMR  390



>gb|AAM61650.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
Length=504

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  198   RERAIERITNVVGTYEDLRSRIFSKHPQLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  255

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  256   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVIFTTDRPYQPGEQVFISYGNKSNGELLL  314

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   SYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFPVRI  365



>ref|XP_006407809.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
 gb|ESQ49262.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
Length=506

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETYLDYDTSSKGVVFTADRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELAMSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  366



>ref|XP_010486336.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=507

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  E FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  366



>ref|XP_010252799.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=502

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 86/172 (50%), Gaps = 17/172 (10%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP+  P E F  E FK +F  + S +V L   
Sbjct  199   AIERITDVTGTYNDLRL------RIFSKYPHLFPEEVFNMETFKWSFGILFSRLVRLP--  250

Query  1042  SLARRFALVPLGPPLLSYCSNCKA-MLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPN  875
             S+  R ALVP    L     NC+       D + Q +V   D+PY+ GE + +  G + N
Sbjct  251   SMDGRVALVPWADML---NHNCEVETYLDYDKSSQGIVFTTDQPYQPGEQVFISYGKKSN  307

Query  874   SKLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  725
              +LL++YGFV  +  NP D V L  +LN  D  Y++K  A +++G S  Q F
Sbjct  308   GELLLSYGFVPREGTNPNDMVELPLSLNKSDKCYREKSEALRKHGLSVSQRF  359



>gb|KCW89043.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
 gb|KCW89044.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=439

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  136   AIERITNVIGTYDDLRS------RIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--  187

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +
Sbjct  188   SMDGRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGE  246

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V +
Sbjct  247   LLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQI  300



>ref|XP_009124214.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=507

 Score = 75.5 bits (184),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 82/173 (47%), Gaps = 11/173 (6%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  203   AIERITNVVGTYEDLRS------RIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--  254

Query  1042  SLARRFALVPLGPPLLSYCS-NCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  866
             S+  RFALVP    L   C              V    DRPY+ GE + +  G + N +L
Sbjct  255   SMDGRFALVPWADMLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGEL  314

Query  865   LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             L++YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   LLSYGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFPVRI  367



>gb|KCW89045.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=464

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  136   AIERITNVIGTYDDLRS------RIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--  187

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +
Sbjct  188   SMDGRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGE  246

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V +
Sbjct  247   LLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQI  300



>ref|XP_010048281.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic 
[Eucalyptus grandis]
Length=506

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  203   AIERITNVIGTYDDLRS------RIFSKHPELFPEEVFNLETFKWSFGILFSRLVRLP--  254

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  R ALVP    +L++    +  L   +    +    DRPY+ GE + +  G + N +
Sbjct  255   SMDGRVALVPWAD-MLNHSCEVETFLDYDSSSRGIVFTTDRPYQAGEQVFISYGRKSNGE  313

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y  K  A +++G S+ Q F V +
Sbjct  314   LLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFPVQI  367



>emb|CDY22127.1| BnaC01g39740D [Brassica napus]
Length=507

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 82/173 (47%), Gaps = 11/173 (6%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y +L +       +F ++P   P E F  E FK +F  + S +V L   
Sbjct  203   AIERITNVVVTYEDLRS------RIFSKHPNLFPKEVFNDETFKWSFGILFSRLVRLP--  254

Query  1042  SLARRFALVPLGPPLLSYCS-NCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  866
             S+  RFALVP    L   C              V    DRPY+ GE + +  G + N +L
Sbjct  255   SMDGRFALVPWADMLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGEL  314

Query  865   LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             L++YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  315   LLSYGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFPVRI  367



>ref|XP_010456598.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  + FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDDTFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRI  366



>gb|KFK38228.1| hypothetical protein AALP_AA3G085300 [Arabis alpina]
Length=506

 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F ++P   P E F  + FK +F  + S +V L   S+ 
Sbjct  199   RERAIERITNVVGTYEDLRSRIFSKHPNLFPKEVFNDDTFKWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              RFALVP    +L++    +  L        V    DRPY+ GE + +  G + N +LL+
Sbjct  257   GRFALVPWAD-MLNHNCEVETYLDYDKSSKGVVFTADRPYQPGEQVFISYGNKSNGELLL  315

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV  +  NP D V L  +L   D  Y++K  A +++G S+ Q F V +
Sbjct  316   SYGFVPREGTNPSDSVELAVSLRKNDACYKEKLDALKKHGLSTPQCFPVRI  366



>ref|XP_001754252.1| predicted protein [Physcomitrella patens]
 gb|EDQ80702.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 93/181 (51%), Gaps = 13/181 (7%)
 Frame = -1

Query  1162  MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCS  983
             +  ++F ++P   P++ +    FK AF  + S +V L  V    + ALVP    +L++  
Sbjct  154   LRATIFLKHPEVFPSQVYTLAAFKWAFGILFSRLVRLPSVG---KLALVPWAD-MLNHSP  209

Query  982   NCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPYDRVT  815
                + L       + VV   DR Y++GE + +  G + + +L + YGF+  E N +D V 
Sbjct  210   QVDSFLDFDQNNAKSVVTVTDRAYQSGEQVFISYGKRSSGELFLAYGFIPSELNVHDSVE  269

Query  814   LEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRL--GYVSDPSE  641
             LE  ++++DP ++ K  AA   G SS Q F V   R+    +++L Y RL     SDP++
Sbjct  270   LEMEIDSDDPSFEAKLRAANEQGLSSPQRFPV---RKDGFPAQLLAYARLIASRTSDPAQ  326

Query  640   M  638
             +
Sbjct  327   L  327



>emb|CBI28466.3| unnamed protein product [Vitis vinifera]
Length=497

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 89/175 (51%), Gaps = 15/175 (9%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F ++P+  P E F  E FK +F  + S +V L   
Sbjct  194   AIERINDVTGTYNDLRL------RIFSKHPHLFPEEVFNMETFKWSFGILFSRLVRLP--  245

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNS  872
             S+  + ALVP    +L++    +  L   D + Q VV   DR Y+  E + +  G + N 
Sbjct  246   SMDEKIALVPWAD-MLNHSCEVETFLD-YDKSSQGVVFTTDRTYQPSEQVFISYGKKSNG  303

Query  871   KLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +LL++YGFV  +  NP D+V L  +L   D  Y++K  A +++G S+ Q F + +
Sbjct  304   ELLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFPIQI  358



>gb|KHN39942.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=409

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 83/174 (48%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   
Sbjct  111   AIERINNVIGTYNDLRL------RIFSKYPDLFPDEVFNIESFKWSFGILFSRLVRLP--  162

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+    ALVP    +L++  + +  L        +    DRPY+ GE + +  G + N +
Sbjct  163   SMGGNVALVPWAD-MLNHSCDVETFLDYDKTSKGIVFTTDRPYQPGEQVFISYGKKSNGE  221

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y++K    +  G S+ Q F + +
Sbjct  222   LLLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFPIQI  275



>ref|XP_002267469.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Vitis vinifera]
Length=577

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 15/174 (9%)
 Frame = -1

Query  1219  IERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVS  1040
             IER   +   Y++L         +F ++P+  P E F  E FK +F  + S +V L   S
Sbjct  275   IERINDVTGTYNDLRL------RIFSKHPHLFPEEVFNMETFKWSFGILFSRLVRLP--S  326

Query  1039  LARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSK  869
             +  + ALVP    +L++    +  L   D + Q VV   DR Y+  E + +  G + N +
Sbjct  327   MDEKIALVPWAD-MLNHSCEVETFLD-YDKSSQGVVFTTDRTYQPSEQVFISYGKKSNGE  384

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV  +  NP D+V L  +L   D  Y++K  A +++G S+ Q F + +
Sbjct  385   LLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFPIQI  438



>ref|XP_007146016.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
 gb|ESW18010.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
Length=492

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 85/174 (49%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   
Sbjct  189   AIERINNVIGTYNDLRL------RIFSKYPDLFPEEVFNIESFKWSFGILFSRLVRLP--  240

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+  + ALVP    +L++    +  L        +    DRPY+ GE + +  G + N +
Sbjct  241   SMDGQVALVPWAD-MLNHSCEVETFLDYDKQSKGIVFTTDRPYQPGEQVFISYGKKSNGE  299

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y++K +  ++ G S+ Q F + +
Sbjct  300   LLLSYGFVPKEGGNPSDSVELSLSLKKSDASYKEKLVLLKKYGLSASQCFPIQI  353



>ref|XP_003542190.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine max]
Length=499

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 83/174 (48%), Gaps = 13/174 (7%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F +YP   P E F  E FK +F  + S +V L   
Sbjct  196   AIERINNVIGTYNDLRL------RIFSKYPDLFPDEVFNIESFKWSFGILFSRLVRLP--  247

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSK  869
             S+    ALVP    +L++  + +  L        +    DRPY+ GE + +  G + N +
Sbjct  248   SMGGNVALVPWAD-MLNHSCDVETFLDYDKTSKGIVFTTDRPYQPGEQVFISYGKKSNGE  306

Query  868   LLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             LL++YGFV ++  NP D V L  +L   D  Y++K    +  G S+ Q F + +
Sbjct  307   LLLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFPIQI  360



>ref|XP_003601528.1| SET domain-containing protein [Medicago truncatula]
 gb|AES71779.1| rubisco methyltransferase family protein [Medicago truncatula]
 gb|AFK38105.1| unknown [Medicago truncatula]
Length=497

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   M   +F +YP   P E F  E FK +F  + S +V L   S+ 
Sbjct  191   RERAIERTNNVIGTYNDMRVRIFSKYPDFFPEEVFNIESFKWSFGILFSRMVRLP--SMD  248

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  860
              + ALVP    ++++    +  L     +  +V   DRPY+ GE + +  G + N +LL+
Sbjct  249   GKNALVPWAD-MMNHSCEVETFLDYDKSSKGIVFPTDRPYQPGEQVFISYGKKSNGELLL  307

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +L   D  Y++K    ++ G S  Q F + V
Sbjct  308   SYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFPIRV  358



>ref|XP_003605258.1| SET domain-containing protein [Medicago truncatula]
Length=494

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   M   +F +YP   P E F  E FK +F  + S +V L   S+ 
Sbjct  188   RERAIERTNNVIGTYNDMRVRIFSKYPDFFPEEVFNIESFKWSFGILFSRMVRLP--SMD  245

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  860
              + ALVP    ++++    +  L     +  +V   DRPY+ GE + +  G + N +LL+
Sbjct  246   GKNALVPWAD-MMNHSCEVETFLDYDKSSKGIVFPTDRPYQPGEQVFISYGKKSNGELLL  304

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +L   D  Y++K    ++ G S  Q F + V
Sbjct  305   SYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFPIRV  355



>ref|XP_002286075.1| rubisco small subunit small subunit n-methyltransferase [Thalassiosira 
pseudonana CCMP1335]
 gb|EED95716.1| rubisco small subunit small subunit n-methyltransferase, partial 
[Thalassiosira pseudonana CCMP1335]
Length=434

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 123/289 (43%), Gaps = 34/289 (12%)
 Frame = -1

Query  1201  IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  1022
             ++REY   D +      L  ++P   P E F +E +  AF  + S  + L+ + +  R A
Sbjct  153   LRREY---DALLGGQDGLIAKFPDRFPAEHFTYENWVWAFTMLFSRAIRLRNLQVGERLA  209

Query  1021  LVPLGPPLLSYCSNCKAMLAAVDGA----------VQLVVDRPYKTGEPIVVWCGPQPNS  872
             +VP    L+++ +   A + A +            V L  DR Y+  E + +  G + N+
Sbjct  210   MVPYAD-LINHSAFSGAFIDARESGDWLFKNGEEEVILYADRGYRQMEQVYISYGQKSNA  268

Query  871   KLLINYGFVDEDNPYDRVTLEAALNTE-------------DPQYQDKRLAAQRNGKSSVQ  731
             +LL+ YGF  E NPY+ V +  ++                DP  Q+K       G+    
Sbjct  269   ELLLLYGFALERNPYNSVDVTVSIAPRTAALAAANEGIEVDPLAQEKVEFLASVGRDQTV  328

Query  730   AFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYF  551
              F  Y  R      EML +LRL  ++        L+       +SP  E AVL  + E  
Sbjct  329   DFPCYADRYP---VEMLEFLRLMMMTPEDTRGKPLADFDYSRTISPANEAAVLSSVVEAV  385

Query  550   KTRLLRYPTTlsedealladndlDP----KKRVATQLVRLEKRILNTCL  416
             K +L  YP +  +D  ++ D  L       +R+A +  R EKR+L   L
Sbjct  386   KYQLNLYPQSEEDDANIIKDKALFRLLSYNQRMAVRHRRNEKRLLKRTL  434



>ref|XP_010088354.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB34472.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=527

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 87/173 (50%), Gaps = 11/173 (6%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R  + + T   +   +F +YP+  P E +  E F  +F  + S +V L   S+ 
Sbjct  196   RERAIERVTNVIGTYKDLRLRIFSKYPHLFPEEVYNLETFSWSFGILFSRLVRLP--SMD  253

Query  1033  RRFALVPLGPPLLSYCSNCKA-MLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKL  866
              +FALVP    L     NC+       D + Q V+   DRPY+ GE + +  G + N +L
Sbjct  254   GKFALVPWADML---NHNCEVETFLDYDKSSQGVLFTTDRPYQPGEQVFISYGKKSNGEL  310

Query  865   LINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             L++YGFV ++  NP D V L  +L+  D  Y+ K  A +++G    Q + + +
Sbjct  311   LLSYGFVPKEGTNPSDSVELSLSLSKSDKCYKQKLAALRKHGLQVSQRYPIRI  363



>gb|EEC73918.1| hypothetical protein OsI_08761 [Oryza sativa Indica Group]
Length=502

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++    P E +  E F+ +F  + S +V L   S+ 
Sbjct  196   RERAIQRITDVVGTYNDLRDRIFSKHSDLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  253

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              R ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  254   GRVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  312

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +LN  D  Y++K  A +RNG S  ++F + V
Sbjct  313   SYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESFPLRV  363



>ref|NP_001047982.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAD12920.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD13045.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09896.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAG96165.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57721.1| hypothetical protein OsJ_08208 [Oryza sativa Japonica Group]
Length=502

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++    P E +  E F+ +F  + S +V L   S+ 
Sbjct  196   RERAIQRITDVVGTYNDLRDRIFSKHSDLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  253

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
              R ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  254   GRVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  312

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +LN  D  Y++K  A +RNG S  ++F + V
Sbjct  313   SYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESFPLRV  363



>ref|XP_006649004.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Oryza brachyantha]
Length=551

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 84/171 (49%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++ Y  P E +  E F+ +F  + S +V L   S+ 
Sbjct  245   RERAIQRITDVIGTYNDLRDRIFSKHSYLFPEEVYNLETFRWSFGILFSRLVRLP--SMD  302

Query  1033  RRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
                ALVP    +L++    +  L      G +    DR Y+ GE + +  G + + +LL+
Sbjct  303   GNVALVPWAD-MLNHSPEVETFLDYDKSSGGIVFTTDRSYQPGEQVFISYGKKSSGELLL  361

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +L   D  Y++K  A +RNG S  ++F + V
Sbjct  362   SYGFVPKEGTNPNDSVELFVSLKKSDECYKEKLQALKRNGLSEFESFPLRV  412



>ref|XP_002185762.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65232.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Phaeodactylum tricornutum CCAP 1055/1]
Length=575

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 124/291 (43%), Gaps = 36/291 (12%)
 Frame = -1

Query  1201  IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  1022
             ++REY   D +      L  +YP   P EAF F+ ++ AF  + S  + L+ +      A
Sbjct  234   LRREY---DALLGGEDGLLAKYPDRFPAEAFNFKAWEWAFTMLFSRAIRLRSLKQGETLA  290

Query  1021  LVPLGPPLLSYC----------SNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  872
             LVP    L+++            N   +  + D  V L  DR Y+  E I +  GP+ N+
Sbjct  291   LVPYAD-LINHSPFSQAYIDARQNGDWLFKSGDEEVILYADRGYRRMEQIYISYGPKSNA  349

Query  871   KLLINYGFVDEDNPYDRVTLEAALNTE---------------DPQYQDKRLAAQRNGKSS  737
             +LL+ YGF  E NP++ V +  ++                  DP  ++K    ++ G+ +
Sbjct  350   ELLLLYGFAVERNPFNSVDVTVSIAPRTASFVKELDDDTIPVDPLAEEKAAFLEQVGRDA  409

Query  736   VQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAE  557
                F  Y  R      EML YLRL  ++        L+       +S   E AVL  +  
Sbjct  410   TVDFPCYADRYP---VEMLEYLRLMQMTPEDTRGKPLAEFDYSRTISLGNEAAVLTSVIT  466

Query  556   YFKTRLLRYPTTlsedealladndlDP----KKRVATQLVRLEKRILNTCL  416
                 +L  YP +  +D AL+ D  L       +R+A +  R EKR+L   +
Sbjct  467   AVSRQLSNYPQSEEDDAALIKDKSLFRLLSYNQRMAVRHRRNEKRLLKRTI  517



>gb|EJK62256.1| hypothetical protein THAOC_17139 [Thalassiosira oceanica]
Length=648

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 74/289 (26%), Positives = 131/289 (45%), Gaps = 34/289 (12%)
 Frame = -1

Query  1201  IKREYSELDTVWFMAG--SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARR  1028
             ++REY +L     + G   L  ++P   P E + FE ++ AF  + S  + L+ + +  R
Sbjct  313   LRREYDDL-----LGGPDGLVAKFPLRFPAEHYTFENWEWAFTMLFSRAIRLRNLQVGER  367

Query  1027  FALVPLGPPLLSYCSNCKAMLAAVDGA----------VQLVVDRPYKTGEPIVVWCGPQP  878
              A+VP    L+++ +  +A + A +            V L  DR Y+  E + +  G + 
Sbjct  368   LAMVPYAD-LINHSAFSQAFIDARESGDWLFKSGEEEVILYADRGYRQMEQVYISYGQKS  426

Query  877   NSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQ-AFHVYVGREK  701
             N++LL+ YGF  E NPY+ V +  ++     Q  +     + +  +  +  F + VGR+ 
Sbjct  427   NAELLLLYGFALERNPYNSVDVTVSIAPRTKQIAEANEGVEEDPLADEKLEFLLSVGRD-  485

Query  700   ETIS----------EMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVLDQLAEYF  551
             +T+           EML YLRL  ++        LS       +S   E +VL  +    
Sbjct  486   QTVDFPCYADRYPVEMLEYLRLMMMTPEDTRGKPLSDFDYSRTISSANEASVLRSVVAAV  545

Query  550   KTRLLRYPTTlsedealladndlDP----KKRVATQLVRLEKRILNTCL  416
             K +L  +P T  +D A++ D  +       +R+A +  R EKR+L   L
Sbjct  546   KYQLGLFPQTEEDDAAIIKDKGMFRLFSYNQRMAVRHRRNEKRLLKRTL  594



>ref|XP_010236007.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brachypodium 
distachyon]
Length=506

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (51%), Gaps = 9/172 (5%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I R    + T   +   +F ++P   P E +  E F+ +F  + S +V L   S+ 
Sbjct  199   RERAISRIGDVIGTYNDLRDRIFSKHPELFPEEVYNMENFRWSFGILFSRLVRLP--SMD  256

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  863
              + ALVP    +L++     A L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  257   GKVALVPWAD-MLNHNPEVDAFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  314

Query  862   INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             ++YGFV ++  NP D V    +LN  D  Y++K  A +R+G S  ++F + V
Sbjct  315   LSYGFVPKEGTNPNDSVEFSVSLNKSDDCYREKLQALKRHGLSESESFPLRV  366



>ref|XP_005719244.1| unnamed protein product [Chondrus crispus]
 emb|CDF39333.1| unnamed protein product [Chondrus crispus]
Length=464

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (47%), Gaps = 10/161 (6%)
 Frame = -1

Query  1126  IPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA  947
              P + F ++ ++ AF  + S  + L   +  +R ALVP    LL++   C   +   +  
Sbjct  211   FPDDVFTWDQWEWAFAILFSRAIML---TAEQRIALVPYAD-LLNHNPFCSTYIDVQEKQ  266

Query  946   ------VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDP  785
                   V L  DRPY   + + V  GP+ N  LL+ YGF+ + NPYD V L  AL+ ED 
Sbjct  267   LTGKRFVTLYTDRPYAQMDQVFVTYGPKSNGDLLLLYGFITDRNPYDSVELVVALSDEDE  326

Query  784   QYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLG  662
              ++ K+     +G  +   F +Y  R    + E L +   G
Sbjct  327   LFERKKKYLDESGVGTTATFPLYSDRYPMELIEFLRFCVAG  367



>ref|NP_001140387.1| uncharacterized protein LOC100272441 [Zea mays]
 gb|ACF83720.1| unknown [Zea mays]
 gb|AFW63676.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++P   P E +  E F  +F  + S +V L   S+ 
Sbjct  197   RKRAIQRITDVIGTYNDLRDRIFSRHPDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  860
              R ALVP    +L++    +  L     +  +V   DR Y+ GE + +  G + + +LL+
Sbjct  255   GRVALVPWAD-MLNHSPEVETFLDFDKSSRGIVFTTDRSYQPGEQVFISYGKKSSGELLL  313

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F + V
Sbjct  314   SYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESFPLRV  364



>ref|XP_010689223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=500

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 85/175 (49%), Gaps = 15/175 (9%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER+  +   Y++L         +F ++P   P E F  E F+ +F  + S +V L   
Sbjct  197   AIERSNDVIGTYNDLKL------RIFSKHPDLFPEEVFNMETFRWSFGILFSRLVRLP--  248

Query  1042  SLARRFALVPLGPPLLSYCSNCKAML---AAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  872
             S+  + ALVP    +L++    +  L    + +G V     RPY+ GE + +  G + N 
Sbjct  249   SMDGKVALVPWAD-MLNHSCEVETYLDYDKSSEGIV-FTTGRPYQPGEQVFISYGKKSNG  306

Query  871   KLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +LL++YGFV ++  NP D   L  +L   D  Y++K  A  + G S  Q F + V
Sbjct  307   ELLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCFPLQV  361



>ref|XP_010689224.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 85/175 (49%), Gaps = 15/175 (9%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER+  +   Y++L         +F ++P   P E F  E F+ +F  + S +V L   
Sbjct  110   AIERSNDVIGTYNDLKL------RIFSKHPDLFPEEVFNMETFRWSFGILFSRLVRLP--  161

Query  1042  SLARRFALVPLGPPLLSYCSNCKAML---AAVDGAVQLVVDRPYKTGEPIVVWCGPQPNS  872
             S+  + ALVP    +L++    +  L    + +G V     RPY+ GE + +  G + N 
Sbjct  162   SMDGKVALVPWAD-MLNHSCEVETYLDYDKSSEGIV-FTTGRPYQPGEQVFISYGKKSNG  219

Query  871   KLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +LL++YGFV ++  NP D   L  +L   D  Y++K  A  + G S  Q F + V
Sbjct  220   ELLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCFPLQV  274



>ref|XP_004953752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004953753.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004953754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Setaria italica]
Length=503

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 9/172 (5%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++    P E +  E F  +F  + S +V L   S+ 
Sbjct  197   RERAIQRITDVIGTYNDLRDRIFSKHSDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  863
              R ALVP    +L++    +  L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  255   GRVALVPWAD-MLNHSPEVETFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  312

Query  862   INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             ++YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S+ ++F + V
Sbjct  313   LSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSASESFPLRV  364



>ref|XP_006857756.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Amborella trichopoda]
 gb|ERN19223.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
Length=541

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 15/171 (9%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L+        +F +     P E +  + F+ +F  + S +V L   
Sbjct  236   AIERITDVTGTYNDLNL------RIFSKQRDLFPEEVYNMDTFRWSFGILFSRLVKLP--  287

Query  1042  SLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNS  872
             S+  R  LVP    +L++ S  +  L   D + Q +V   DR Y+ GE + +  G + N 
Sbjct  288   SMDGRVTLVPWAD-MLNHSSEVETFLD-YDKSSQGIVFTTDRSYQPGEQVFISYGKKSNG  345

Query  871   KLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF  725
             +LL++YGFV  +  NP D V +  ++N  DP Y +K  A  ++G S+ Q F
Sbjct  346   ELLLSYGFVSREGTNPNDSVDVAMSINKSDPCYVEKVEALMKHGLSTPQRF  396



>gb|ACG45124.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 85/171 (50%), Gaps = 7/171 (4%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++P   P E +  E F  +F  + S +V L   S+ 
Sbjct  197   RKRAIQRITDVIGTYNDLRDRIFSRHPDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  254

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLV--VDRPYKTGEPIVVWCGPQPNSKLLI  860
              R  LVP    +L++    +  L     +  +V   DR Y+ GE + +  G + + +LL+
Sbjct  255   GRVVLVPWAD-MLNHSPEVETFLDFDKSSRGIVFTTDRSYQPGEQVFISYGKKSSGELLL  313

Query  859   NYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             +YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F + V
Sbjct  314   SYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESFPLRV  364



>ref|XP_002454362.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
 gb|EES07338.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
Length=499

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 87/172 (51%), Gaps = 9/172 (5%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA  1034
             R   I+R    + T   +   +F ++    P E +  E F  +F  + S +V L   S+ 
Sbjct  193   RKRAIQRITDVIGTYNDLRDRIFSRHSDLFPEEVYNIETFLWSFGILFSRLVRLP--SMD  250

Query  1033  RRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLL  863
              + ALVP    +L++    +  L   D + Q +V   DR Y+ GE + +  G + + +LL
Sbjct  251   EKVALVPWAD-MLNHSPEVETFLD-FDKSSQGIVFTTDRSYQPGEQVFISYGKKSSGELL  308

Query  862   INYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYV  713
             ++YGFV ++  NP D V L  +L+  D  Y++K  A +RNG S  ++F + V
Sbjct  309   LSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSESESFPLRV  360



>ref|XP_009033030.1| hypothetical protein AURANDRAFT_61181 [Aureococcus anophagefferens]
 gb|EGB11917.1| hypothetical protein AURANDRAFT_61181 [Aureococcus anophagefferens]
Length=516

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 105/242 (43%), Gaps = 18/242 (7%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPL-----GPPLLSYCSNCKAMLAAV-  956
             E F FE ++ AF  + S  + L+        A+VP        P  S   + + +  A  
Sbjct  247   EIFTFEAWQWAFTNLFSRAIRLKASRAGELLAMVPYVDFINHSPFSSSYVDAREVPKAFP  306

Query  955   ----DGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTED  788
                 +  V L  DR YK  E + +  GP+ N+ LL+ YGF  + NP++ V L    + +D
Sbjct  307   WEEKEDEVVLFADRAYKKFEQVFISYGPKSNADLLLLYGFALDRNPFNSVDLAVGASKDD  366

Query  787   PQYQDKRLAAQRNGKS-SVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSS-QG  614
               Y  K   A+  G+  S  AF +Y  R  +   E++ +LR+   ++       L     
Sbjct  367   ALYDAKERFARGAGRDVSSAAFPLYADRFPD---ELVQFLRMACATEDHLGARPLDDPDN  423

Query  613   PVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKR  434
              V  +S   E AVLD + +     +  YP    +D      +     +R+A +LV  EKR
Sbjct  424   YVDILSLDNELAVLDTIRDACDAAVAAYPAKSGDDVPDAFLSR---NQRMAKRLVNTEKR  480

Query  433   IL  428
             IL
Sbjct  481   IL  482



>gb|KJB22703.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=489

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 81/152 (53%), Gaps = 9/152 (6%)
 Frame = -1

Query  1150  LFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKA  971
             +  ++P+  P E F    F+ +F  + S +++L   S+  + ALVP    +L++    + 
Sbjct  216   ILSKHPHLFPKEIFNLVTFRWSFGILLSRLIYLS--SMDGKVALVPWAD-MLNHSCEVET  272

Query  970   MLAAVDGAVQLVV---DRPYKTGEPIVVWCGPQPNSKLLINYGFVDED--NPYDRVTLEA  806
              L   D + Q VV   DR Y++GE + +  G + N++LL++YGFV ++  N  D V L  
Sbjct  273   YLN-YDKSSQAVVFTTDRAYQSGEQVFISYGKKSNAELLLSYGFVPKEGTNLNDSVELPL  331

Query  805   ALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVG  710
             +L   D  Y+ K  A +++G S+ Q + + + 
Sbjct  332   SLKISDKCYKQKLKALKKHGLSASQCYTIQIS  363



>ref|XP_002974548.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
 gb|EFJ24068.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
Length=467

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 78/156 (50%), Gaps = 6/156 (4%)
 Frame = -1

Query  1177  DTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL  998
             DT   +   +F +   + P E F  E FK AF  + S +V L   SL ++ AL+P G  +
Sbjct  174   DTFNDLNKQVFMKNREEFPPEVFNLESFKWAFGILFSRLVRLP--SLGQKLALIPFGD-M  230

Query  997   LSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPY  827
             L++ +     L    G+  +   +DR Y++ + + +  G + N +LL+ YGFV    N  
Sbjct  231   LNHDTEVTTFLDFDSGSKSITCTLDRGYESNKEVFISYGKRSNGELLVAYGFVPSGKNSE  290

Query  826   DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  719
             D V++   L+  D  Y+ K  A + +G S  Q++ +
Sbjct  291   DSVSITLGLDPADEMYEAKLGALKEHGLSPQQSYPI  326



>ref|XP_003081307.1| putative methyltransferase (ISS) [Ostreococcus tauri]
Length=505

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = -1

Query  1096  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  917
              + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  218   LRWAFDILFSRLIRLD--AMGGELALVPW-ADMLNHKPGCAAFIDLNGSAVNLTTDRAYA  274

Query  916   TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
              GE +    G +P+S+LLI+YGF  E  +NP D  +L   ++  DP  Q K    +R G 
Sbjct  275   AGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGL  334

Query  742   SSVQAF  725
             S V+ F
Sbjct  335   SPVETF  340



>ref|XP_004305682.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=498

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 82/181 (45%), Gaps = 27/181 (15%)
 Frame = -1

Query  1222  VIERAEGIKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKV  1043
              IER   +   Y++L         +F ++P   P E F  E FK +F  + S +V L   
Sbjct  195   AIERVTNVVGTYNDLRL------RIFSKHPDLFPEEVFNIETFKWSFGILFSRLVRLP--  246

Query  1042  SLARRFALVPLGPPL---------LSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWC  890
             S+  + ALVP    L         L Y  + K ++    G        PY+ GE + +  
Sbjct  247   SMDGKVALVPWADMLNHSCEVDTFLDYDQSSKGVVFTTAG--------PYQPGEQVFISY  298

Query  889   GPQPNSKLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY  716
             G + N +LL++YGFV     NP D V L  +L   D  Y++K  A ++ G S+ + F V 
Sbjct  299   GKKSNGELLLSYGFVPSKGANPSDSVELSVSLLKSDKCYEEKVEALRKYGLSARECFPVR  358

Query  715   V  713
             +
Sbjct  359   I  359



>emb|CEF99133.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=531

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = -1

Query  1096  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  917
              + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  244   LRWAFDILFSRLIRLD--AMGGELALVPW-ADMLNHKPGCAAFIDLNGSAVNLTTDRAYA  300

Query  916   TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
              GE +    G +P+S+LLI+YGF  E  +NP D  +L   ++  DP  Q K    +R G 
Sbjct  301   AGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGL  360

Query  742   SSVQAF  725
             S V+ F
Sbjct  361   SPVETF  366



>gb|AFK46204.1| unknown [Lotus japonicus]
Length=271

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 67/134 (50%), Gaps = 7/134 (5%)
 Frame = -1

Query  1102  EIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVD  929
             E FK +F  + S +V L   S+  + ALVP    +L++  + +  L        +    D
Sbjct  2     ESFKWSFGILFSRMVRLP--SMDGKVALVPWAD-MLNHSCDVETFLDYDKQSKGIVFTTD  58

Query  928   RPYKTGEPIVVWCGPQPNSKLLINYGFVDED--NPYDRVTLEAALNTEDPQYQDKRLAAQ  755
             RPY+ GE + +  G + N +LL++YGFV  +  NP D V L  +L   D  Y++K    +
Sbjct  59    RPYQPGEQVFISYGKKSNGELLLSYGFVTREGANPSDSVELSLSLKKSDGSYKEKLELLK  118

Query  754   RNGKSSVQAFHVYV  713
             + G S  Q F + +
Sbjct  119   KYGLSGSQCFPIRI  132



>ref|XP_005718157.1| unnamed protein product [Chondrus crispus]
 emb|CDF38272.1| unnamed protein product [Chondrus crispus]
Length=978

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 69/155 (45%), Gaps = 21/155 (14%)
 Frame = -1

Query  1201  IKREYSELDTVWFM---AGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLAR  1031
             ++ E  E+   WF+      L + YP D  T    FE F +A   ++S    ++ V++  
Sbjct  263   LRGEIDEMYKEWFLPYAVNRLPETYPADFCT----FETFMRAHAVIESRAFKIESVTMLA  318

Query  1030  RFALVPLGPPLLSYCSNCKAM-LAAVD-------------GAVQLVVDRPYKTGEPIVVW  893
              FA +    P+ S C N KA    AVD             G    V DR  + GE I + 
Sbjct  319   PFADMANHQPVESECRNAKARGWIAVDSPESVVDRNVSDLGLELHVGDRLVRQGEEICIS  378

Query  892   CGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTED  788
              G  PN +LL++YGF    NP D V L  ++  ED
Sbjct  379   YGALPNWQLLLHYGFAMPSNPADSVLLSLSIPEED  413



>ref|XP_006661223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=338

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 71/254 (28%), Positives = 117/254 (46%), Gaps = 28/254 (11%)
 Frame = -1

Query  1126  IPTEAFP----FEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAA  959
             +  E FP    F+ F  AF  ++S V    +     + AL+PL   L+++  +  +  ++
Sbjct  50    VNKELFPDTVTFDDFLWAFGILRSRVFAGLR---GDKLALIPLAD-LVNHSDDIASNESS  105

Query  958   --VDGAVQLVVDRPYKTGEPIVVWCGPQ---------PNSKLLINYGFVDEDNPYDRVTL  812
               + G      D  +    P+ V  G Q          N++L ++YGF + ++  D  TL
Sbjct  106   WEIKGKGLFGRDVVFSLRTPVGVKSGEQIYIQYDLDKSNAELALDYGFTEPNSSRDSYTL  165

Query  811   EAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETI-SEMLPYLRLGYVSDPS---  644
                ++  DP Y DK   A+ NG      F + +G   E++  +MLPYLRL  +       
Sbjct  166   TLEISESDPFYDDKLDIAELNGMGETAYFDIVLG---ESLPPQMLPYLRLLCIGGTDAFL  222

Query  643   -EMQFVLSSQGPV-CPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKK  470
              E  F  S  G +  P+S   E A+   +    K+ L  Y TT+ EDE LL   +L P+ 
Sbjct  223   LEALFRNSVWGHLELPLSSDNEEAICQVIRNACKSALGAYHTTVEEDEELLKSKNLQPRL  282

Query  469   RVATQLVRLEKRIL  428
             ++A Q+   EK++L
Sbjct  283   QIAIQVRAGEKKVL  296



>ref|XP_002963244.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
 gb|EFJ35115.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
Length=467

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/156 (28%), Positives = 76/156 (49%), Gaps = 6/156 (4%)
 Frame = -1

Query  1177  DTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPL  998
             DT   +   +F +   + P E F  + FK AF  + S +V L   SL ++ AL+P G  +
Sbjct  174   DTFNDLNKQVFMKNREEFPPEVFNLKSFKWAFGILFSRLVRLP--SLGQKLALIPFGD-M  230

Query  997   LSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPY  827
             L++ +     L    G+  +   +DR Y++   + +  G + N +LL+ YGFV    N  
Sbjct  231   LNHDTEVTTFLDFDSGSKSITCTLDRGYESNREVFISYGKRSNGELLVAYGFVPSGKNSE  290

Query  826   DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHV  719
             D V++   L+  D  Y+ K    + +G S  Q++ +
Sbjct  291   DSVSITLGLDPADEMYEAKLGTLKEHGLSPQQSYPI  326



>gb|EWM24078.1| ribulose- -bisphosphate carboxylase oxygenase small subunit n-methyltransferase 
i [Nannochloropsis gaditana]
Length=647

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 87/177 (49%), Gaps = 7/177 (4%)
 Frame = -1

Query  946  VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKR  767
            + +  D+ YK  E + +  GP+ N+ LL+ YGF  + NP++ V L  AL  +DP +++KR
Sbjct  448  ITIYADKDYKKMEQVYISYGPKSNADLLLLYGFCLDRNPFNSVDLTVALLPDDPLFEEKR  507

Query  766  LAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCT  587
                +  +   +AF ++  R     +E+  YLRL Y++        L       P+S   
Sbjct  508  AFLAQAERREKEAFPLFADRYP---NELFEYLRLVYLTKEDMGGRALREMEFTDPISLEN  564

Query  586  ERAVLDQLAEYFKTRLLRYPTTlsedealladnd---lDPK-KRVATQLVRLEKRIL  428
            E A +  +    +  L  Y T   +D  L+ D+    + PK +R+A +  R EKR+L
Sbjct  565  ELAAMASIEGACEEALASYSTKEEDDARLINDSKLFNMFPKTQRMAIKHRRSEKRLL  621



>ref|XP_002508524.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO69782.1| set domain protein [Micromonas sp. RCC299]
Length=425

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 5/126 (4%)
 Frame = -1

Query  1096  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  917
              + AF  + S ++ L     A   ALVP    +L++   C A +    GAV L  DR YK
Sbjct  150   LRWAFDVLFSRLIRLPNRGGA--LALVPWAD-MLNHRPGCDAYIDDTGGAVCLSPDRRYK  206

Query  916   TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
              GE +    GP+P+S+LLI+YGF     +NP D   +   ++  D     K  A +R G 
Sbjct  207   PGEQVYASYGPRPSSELLISYGFAPAVGENPDDEFEVVLGIDPNDRHADAKADALRRIGL  266

Query  742   SSVQAF  725
             S V+AF
Sbjct  267   SPVEAF  272



>ref|XP_001783777.1| predicted protein [Physcomitrella patens]
 gb|EDQ51429.1| predicted protein, partial [Physcomitrella patens]
Length=395

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 24/188 (13%)
 Frame = -1

Query  1150  LFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKA  971
             + Q+ P+ I  E      FKQA+   +S      + S   R   VP      ++ SNC+A
Sbjct  116   VLQKCPH-IFGERVLHSKFKQAYATGKSL-----RRSSNTRILTVPF-VDFFNHDSNCRA  168

Query  970   MLAAVD--GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALN  797
             +L+  +     +++ D+ Y  GE +V+  G  PN+ L +++GF    NPYD+V +  AL+
Sbjct  169   LLSYDEERACAEVIADKNYARGEQVVISYGRLPNTTLALDFGFTISCNPYDQVEVWMALS  228

Query  796   TEDPQYQDKRLAAQRNGKSSV----------QAFHV-----YVGREKETISEMLPYLRLG  662
               DP  + K      +G  +V            FH+       GR K     +  + R+ 
Sbjct  229   HRDPLRKMKLALLHAHGMPTVVHADGSDSGGNGFHLREVKSVTGRGKGIPHALRAFARVL  288

Query  661   YVSDPSEM  638
               + P E+
Sbjct  289   CATTPQEL  296



>ref|XP_007510589.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18122.1| predicted protein [Bathycoccus prasinos]
Length=543

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 84/185 (45%), Gaps = 27/185 (15%)
 Frame = -1

Query  1213  RAEGIKREYSELDTVWFMAGS--LFQQYPYDIPTEAFPFEI-----------FKQAFVAV  1073
             R+ G   E+ E D    +AGS  LF          A   EI            + AF  +
Sbjct  197   RSTGSVLEWPESDVRTLLAGSPSLFSALERRASVAAAIAEIRVNFPELNEKTLQWAFDIL  256

Query  1072  QSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA--VQLVVDRPYKTGEPIV  899
              S ++ L+  SL    ALVP    +L++   C+A +    G+  V L  DR Y+ GE + 
Sbjct  257   FSRLIRLE--SLGGNLALVPWAD-MLNHQPGCEAFIDLDRGSRKVCLTTDRSYEPGEQVW  313

Query  898   VWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDK--RLAAQRNGKSSVQ  731
                G +P+S+LLI+YGF     DNP D   L   ++ EDP    K   LA+Q     ++Q
Sbjct  314   ASYGQRPSSELLISYGFAPAVGDNPDDEYALNLQIDEEDPFASAKVNALASQ-----NIQ  368

Query  730   AFHVY  716
             AF  +
Sbjct  369   AFETF  373



>dbj|BAD28364.1| putative ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAH01674.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 89/171 (52%), Gaps = 10/171 (6%)
 Frame = -1

Query  919  KTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
            K+GE I + +   + N++L ++YGF + ++  D  TL   ++  DP Y DK   A+ NG 
Sbjct  286  KSGEQIYIQYDLDKSNAELALDYGFTESNSSRDAYTLTLEISESDPFYDDKLDIAELNGM  345

Query  742  SSVQAFHVYVGREKETI-SEMLPYLRL----GYVSDPSEMQFVLSSQGPV-CPVSPCTER  581
                 F + +G   E++  +MLPYLRL    G  +   E  F  +  G +  PVS   E 
Sbjct  346  GETAYFDIVLG---ESLPPQMLPYLRLLCLGGTDAFLLEALFRNAVWGHLELPVSQDNEE  402

Query  580  AVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
            A+   +    K+ L  Y TT+ EDE LL   +L P+ ++A ++   EK++L
Sbjct  403  AICQVIRNACKSALGAYHTTIEEDEELLGSENLQPRLQIAVEVRAGEKKVL  453



>gb|AFP65462.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Chroomonas mesostigmatica CCMP1168]
Length=464

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 59/123 (48%), Gaps = 8/123 (7%)
 Frame = -1

Query  1123  PTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGP-----PLLSYCSNCKAMLAA  959
             P + F  + ++ A   + S  + LQ +   ++ ALVP        P  +   N K +  +
Sbjct  219   PEKIFNLQSWEWAISLLLSRAIFLQNM---KKIALVPYADFINHNPFSTSYINSKKIAFS  275

Query  958   VDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQY  779
              +  + +  D+ Y   + I    G + N +LL+ YGF+ E NP+D + L  AL+T+D  Y
Sbjct  276   ENNEIVMYADKDYNKFDQIFTTYGQKTNLELLVLYGFIIERNPFDSIELRVALSTKDELY  335

Query  778   QDK  770
               K
Sbjct  336   NKK  338



>ref|NP_001175834.1| Os09g0411650 [Oryza sativa Japonica Group]
 dbj|BAH94562.1| Os09g0411650, partial [Oryza sativa Japonica Group]
Length=206

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 9/158 (6%)
 Frame = -1

Query  883  QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGRE  704
            + N++L ++YGF + ++  D  TL   ++  DP Y DK   A+ NG      F + +G  
Sbjct  10   KSNAELALDYGFTESNSSRDAYTLTLEISESDPFYDDKLDIAELNGMGETAYFDIVLG--  67

Query  703  KETI-SEMLPYLRL----GYVSDPSEMQFVLSSQGPV-CPVSPCTERAVLDQLAEYFKTR  542
             E++  +MLPYLRL    G  +   E  F  +  G +  PVS   E A+   +    K+ 
Sbjct  68   -ESLPPQMLPYLRLLCLGGTDAFLLEALFRNAVWGHLELPVSQDNEEAICQVIRNACKSA  126

Query  541  LLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
            L  Y TT+ EDE LL   +L P+ ++A ++   EK++L
Sbjct  127  LGAYHTTIEEDEELLGSENLQPRLQIAVEVRAGEKKVL  164



>ref|XP_001419603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97896.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 5/126 (4%)
 Frame = -1

Query  1096  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYK  917
              + AF  + S ++ L   ++    ALVP    +L++   C A +     AV L  DR Y 
Sbjct  235   LRWAFDILFSRLIRLD--AMGGELALVPW-ADMLNHKPGCAAFIDLNGDAVNLTTDRSYV  291

Query  916   TGEPIVVWCGPQPNSKLLINYGFVDE--DNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
              GE +    G +P+S+LLI+YGF  E  +NP D   L   ++  DP    K    +  G 
Sbjct  292   KGEQVWASYGQRPSSELLISYGFAPEVGENPDDEYALTLGVDVNDPLADAKAQVLRDMGL  351

Query  742   SSVQAF  725
             S V+ F
Sbjct  352   SPVETF  357



>ref|XP_008617921.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
 gb|EQC28729.1| hypothetical protein SDRG_13603 [Saprolegnia diclina VS20]
Length=400

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 97/224 (43%), Gaps = 22/224 (10%)
 Frame = -1

Query  1171  VWF--MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRF---ALVPLG  1007
              W+  +   LF+ YP      +F FE F+ A+  +Q+        +  RR    ALVPL 
Sbjct  143   TWYERLTDRLFRLYPEPFNATSFSFETFRFAWQTIQAR-------TFGRRLPWTALVPLA  195

Query  1006  PPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPY  827
               +L++ +N   + A  +   +      YK G+ +    G +PN +LL++YGF   +N +
Sbjct  196   D-MLNH-ANHATIYAYENKTFEWHSSVGYKRGDQVFNSYGRRPNHQLLLDYGFALRENEW  253

Query  826   DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAF-HVYVGREKETISEMLPYLRLGYVSD  650
             D + ++  L T  P    K        K+ +  F + +      +I+ +LPY R  +++ 
Sbjct  254   DYLDMDLHLETSYPSVLSKTERRAVLIKAHLMPFKNRFRLMHDMSIASLLPYFRCHFLTA  313

Query  649   PSEMQFVLSSQGPVCPVSPC-TERAVLDQLAEYFKTRLLRYPTT  521
               E   V       CP+S    E   +  L E  +     YPT+
Sbjct  314   YCEDVDV------SCPISDVRVETRAITVLIEVLEELAAAYPTS  351



>gb|EEC84567.1| hypothetical protein OsI_31339 [Oryza sativa Indica Group]
Length=649

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 89/171 (52%), Gaps = 10/171 (6%)
 Frame = -1

Query  919  KTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
            K+GE I + +   + N++L ++YGF + ++  D  TL   ++  DP Y DK   A+ NG 
Sbjct  440  KSGEQIYIQYDLDKSNAELALDYGFTESNSSRDAYTLTLEISESDPFYDDKLDIAELNGM  499

Query  742  SSVQAFHVYVGREKETI-SEMLPYLRL----GYVSDPSEMQFVLSSQGPV-CPVSPCTER  581
                 F + +G   E++  +MLPYLRL    G  +   E  F  +  G +  PVS   E 
Sbjct  500  GETAYFDIVLG---ESLPPQMLPYLRLLCLGGTDAFLLEALFRNAVWGHLELPVSQDNEE  556

Query  580  AVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
            A+   +    K+ L  Y TT+ EDE LL   +L P+ ++A ++   EK++L
Sbjct  557  AICQVIRNACKSALGAYHTTIEEDEELLGSENLQPRLQIAVEVRAGEKKVL  607



>ref|XP_001774257.1| predicted protein [Physcomitrella patens]
 gb|EDQ60893.1| predicted protein [Physcomitrella patens]
Length=458

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 64/130 (49%), Gaps = 7/130 (5%)
 Frame = -1

Query  1153  SLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCK  974
             ++  +YP ++  E    E FK A+    S    ++ +       +VP    + ++ S+ +
Sbjct  176   AVVNKYP-ELFGETVTLESFKHAYCVASSRSWGVEALG---SITMVPF-VDMFNHDSSAR  230

Query  973   AMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  800
             A+LA    +G  ++V D+ Y  G  +V+  G  PNS L +++GF   DNP+D V +    
Sbjct  231   ALLAYYEEEGYAEVVADKDYNQGSQVVITYGTLPNSSLALDFGFTLPDNPHDEVQIWMEA  290

Query  799   NTEDPQYQDK  770
              + DP   +K
Sbjct  291   PSGDPLRAEK  300



>gb|AAI35195.1| LOC549331 protein [Xenopus (Silurana) tropicalis]
Length=507

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 114/252 (45%), Gaps = 23/252 (9%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQSCVVHLQKVSLAR-RFALVPLGPPLLSYCSNCKAMLAA----VD  953
             ++F F+ ++ A  +V +    +     +R   AL+PL       C++  +++       D
Sbjct  162   DSFTFDDYRWAVSSVMTRQNQIPTEDGSRVTLALIPL----WDMCNHTNSLITTGYNLED  217

Query  952   GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
                + V  + +K+GE I ++ G + N++ +I+ GF  E+N +DRV ++  ++  D  Y  
Sbjct  218   DRCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFFFENNLHDRVKIKLGVSKSDRLYAM  277

Query  772   KRLAAQRNG--KSSVQAFHVYVGREKETISEMLPYLRL---------GYVSDPSEMQFVL  626
             K     R G   SSV A HV    E    +++L +LR+         G++     +  + 
Sbjct  278   KAEVLARAGIPTSSVFALHV---TEPPISAQLLAFLRVFCMNEDELKGHLIGDHAIDKIF  334

Query  625   SSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVR  446
             +      PVS   E  +   L       L  Y TT+ +D  +L   D+     +A +L R
Sbjct  335   TLGNSEFPVSWENEIKLWTFLEARASLLLKTYKTTVEDDNKVLEQPDMTFHSAMAIKLRR  394

Query  445   LEKRILNTCLQT  410
             +EK IL   L++
Sbjct  395   VEKEILEKALKS  406



>ref|XP_007222120.1| hypothetical protein PRUPE_ppa004634mg [Prunus persica]
 gb|EMJ23319.1| hypothetical protein PRUPE_ppa004634mg [Prunus persica]
Length=499

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 102/223 (46%), Gaps = 26/223 (12%)
 Frame = -1

Query  1036  ARRFALVPLGPPLLSYCSNCKAMLAA--VDGAVQLVV-DRPYKTGEPIVVWCGPQ-----  881
              +   L+PL   L+++ S+      A  + GA  L   D  +    P+ +  G Q     
Sbjct  240   GQNLVLIPLAD-LINHSSSITTEEHAWEIKGAAGLFSWDYLFSIRSPVALKAGEQVFIQY  298

Query  880   ----PNSKLLINYGFVDEDNPY-DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY  716
                  N++  ++YGF+D  N   D  TL   ++  DP Y DK   A+ NG  +   F ++
Sbjct  299   DINKSNAEFALDYGFIDSSNANRDAFTLTLEISESDPFYGDKLDIAESNGLGATAYFDIF  358

Query  715   VGREKETISEMLPYLRLGYVSDPSEMQFVLSS------QGPV-CPVSPCTERAVLDQLAE  557
             + R       ++PYLRL  V+      F+L S       G +  PVSP  E  +   + E
Sbjct  359   LDRS--LPPALIPYLRL--VALGGTDAFLLESIFRNTIWGHLELPVSPANEELICRVVRE  414

Query  556   YFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
               K+ L  YPTT  E++  L ++ LDP+  +A  +   EK++L
Sbjct  415   ACKSALSAYPTT-IEEDEKLKESKLDPRLEIAVGIRHGEKKVL  456



>gb|ETS04896.1| SET domain-containing protein [Trichoderma reesei RUT C-30]
Length=460

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 9/147 (6%)
 Frame = -1

Query  1201  IKREYSELDTVWFMAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFA  1022
             IK +Y +L      A  LF Q+P   P + F  E +K A   V S  +       +    
Sbjct  135   IKDDYRQL------AVRLFAQHPDLFPLQKFTIEDYKWALCTVWSRSMDFTLPDGSSIRL  188

Query  1021  LVPLGPPLLSYCSNCKAMLA--AVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  848
             L P    +L++ S  K   A     G + +   + Y+ G+ + ++ GP PN++LL  YGF
Sbjct  189   LAPFAD-MLNHSSEVKQCHAYDVKSGDLSVFAGKDYEIGDQVYIYYGPIPNNRLLRLYGF  247

Query  847   VDEDNPYDRVTLEAALNTEDPQYQDKR  767
             V  DNP D   L    +   P Y+ K+
Sbjct  248   VIPDNPNDSYDLVLTTHPMAPFYEQKQ  274



>ref|XP_005831105.1| hypothetical protein GUITHDRAFT_109909 [Guillardia theta CCMP2712]
 gb|EKX44125.1| hypothetical protein GUITHDRAFT_109909 [Guillardia theta CCMP2712]
Length=442

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 56/129 (43%), Gaps = 3/129 (2%)
 Frame = -1

Query  1129  DIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLA---RRFALVPLGPPLLSYCSNCKAMLAA  959
             D+P   +  + FK A+  + +    +   S     R+  + P+                A
Sbjct  210   DLPKAIYSLKEFKWAYATIFARAFDVDGKSFGFSGRQRIMAPMADLFNHGDVKTSYTFNA  269

Query  958   VDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQY  779
               G  +L   + +  GE I +    + N++ L+ YGFV E NP+D V + A++  + P Y
Sbjct  270   ASGHFELFTQQFFSRGEQIFMNYDSKNNAEFLLQYGFVIESNPHDYVGIAASIGNDQPFY  329

Query  778   QDKRLAAQR  752
             +DK L   R
Sbjct  330   RDKSLDCLR  338



>ref|XP_008221574.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Prunus mume]
Length=498

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 102/223 (46%), Gaps = 26/223 (12%)
 Frame = -1

Query  1036  ARRFALVPLGPPLLSYCSNCKAMLAA--VDGAVQLVV-DRPYKTGEPIVVWCGPQ-----  881
              +   L+PL   L+++ S+      A  + GA  L   D  +    P+ +  G Q     
Sbjct  239   GQNLVLIPLAD-LINHSSSITTEEHAWEIKGAAGLFSWDYLFSIRSPVALKAGEQVFIQY  297

Query  880   ----PNSKLLINYGFVDEDNPY-DRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVY  716
                  N++  ++YGF+D  N   D  TL   ++  DP Y DK   A+ NG  +   F ++
Sbjct  298   DINKSNAEFALDYGFIDSSNANRDAFTLTLEISESDPFYGDKLDIAESNGLGATAYFDIF  357

Query  715   VGREKETISEMLPYLRLGYVSDPSEMQFVLSS------QGPV-CPVSPCTERAVLDQLAE  557
             + R       ++PYLRL  V+      F+L S       G +  PVSP  E  +   + E
Sbjct  358   LDRS--LPPALIPYLRL--VALGGTDAFLLESIFRNTIWGHLELPVSPANEELICRVVRE  413

Query  556   YFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
               K+ L  YPTT  E++  L ++ LDP+  +A  +   EK++L
Sbjct  414   ACKSALSAYPTT-IEEDEKLKESKLDPRLEIAVGIRHGEKKVL  455



>sp|B7ZUF3.1|SETD3_XENTR RecName: Full=Histone-lysine N-methyltransferase setd3; AltName: 
Full=SET domain-containing protein 3 [Xenopus (Silurana) 
tropicalis]
 gb|AAI71209.1| LOC549331 protein [Xenopus (Silurana) tropicalis]
Length=582

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 113/252 (45%), Gaps = 23/252 (9%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQSCVVHLQKVSLAR-RFALVPLGPPLLSYCSNCKAMLAA----VD  953
             ++F F+ ++ A  +V +    +     +R   AL+PL       C++   ++       D
Sbjct  237   DSFTFDDYRWAVSSVMTRQNQIPTEDGSRVTLALIPL----WDMCNHTNGLITTGYNLED  292

Query  952   GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
                + V  + +K+GE I ++ G + N++ +I+ GF  E+N +DRV ++  ++  D  Y  
Sbjct  293   DRCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFFFENNLHDRVKIKLGVSKSDRLYAM  352

Query  772   KRLAAQRNG--KSSVQAFHVYVGREKETISEMLPYLRL---------GYVSDPSEMQFVL  626
             K     R G   SSV A HV    E    +++L +LR+         G++     +  + 
Sbjct  353   KAEVLARAGIPTSSVFALHV---TEPPISAQLLAFLRVFCMNEDELKGHLIGDHAIDKIF  409

Query  625   SSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVR  446
             +      PVS   E  +   L       L  Y TT+ +D  +L   D+     +A +L R
Sbjct  410   TLGNSEFPVSWENEIKLWTFLEARASLLLKTYKTTVEDDNKVLEQPDMTFHSAMAIKLRR  469

Query  445   LEKRILNTCLQT  410
             +EK IL   L++
Sbjct  470   VEKEILEKALKS  481



>emb|CAN82664.1| hypothetical protein VITISV_015206 [Vitis vinifera]
Length=507

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 89/191 (47%), Gaps = 16/191 (8%)
 Frame = -1

Query  958  VDGAVQLVVDRPYKTGEPIVVWCGPQ---------PNSKLLINYGFVDEDNPYDRVTLEA  806
            + GA     D+ +    P+ V  G Q          N++L ++YGF++     +  TL  
Sbjct  253  IKGAGLFSRDQLFSLRTPVSVKAGEQVLIQYDLDKSNAELALDYGFIESRPNRNSYTLTL  312

Query  805  ALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPS----EM  638
             ++  DP + DK   A+ NG S +  F + +G  +   + MLPYLRL  +  P     E 
Sbjct  313  EISESDPFFGDKLDIAESNGLSEIAYFDIVLG--QSLPAAMLPYLRLVALGGPDAFLLES  370

Query  637  QFVLSSQGPV-CPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVA  461
             F  +  G +  PVS   E  +   + +  K+ L  Y TT+ EDE L  + +L P+  +A
Sbjct  371  IFRNTIWGHLELPVSRANEELICQVIQDACKSALSGYLTTIEEDEKLKEEGNLHPRLEIA  430

Query  460  TQLVRLEKRIL  428
              +   EK++L
Sbjct  431  VGVRTGEKKVL  441



>ref|NP_001016577.1| histone-lysine N-methyltransferase setd3 [Xenopus (Silurana) 
tropicalis]
 emb|CAJ81720.1| novel protein containing a SET domain [Xenopus (Silurana) tropicalis]
Length=581

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 62/252 (25%), Positives = 113/252 (45%), Gaps = 23/252 (9%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQSCVVHLQKVSLAR-RFALVPLGPPLLSYCSNCKAMLAA----VD  953
             ++F F+ ++ A  +V +    +     +R   AL+PL       C++   ++       D
Sbjct  236   DSFTFDDYRWAVSSVMTRQNQIPTEDGSRVTLALIPL----WDMCNHTNGLITTGYNLED  291

Query  952   GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
                + V  + +K+GE I ++ G + N++ +I+ GF  E+N +DRV ++  ++  D  Y  
Sbjct  292   DRCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFFFENNLHDRVKIKLGVSKSDRLYAM  351

Query  772   KRLAAQRNG--KSSVQAFHVYVGREKETISEMLPYLRL---------GYVSDPSEMQFVL  626
             K     R G   SSV A HV    E    +++L +LR+         G++     +  + 
Sbjct  352   KAEVLARAGIPTSSVFALHV---TEPPISAQLLAFLRVFCMNEDELKGHLIGDHAIDKIF  408

Query  625   SSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVR  446
             +      PVS   E  +   L       L  Y TT+ +D  +L   D+     +A +L R
Sbjct  409   TLGNSEFPVSWENEIKLWTFLEARASLLLKTYKTTVEDDNKVLEQPDMTFHSAMAIKLRR  468

Query  445   LEKRILNTCLQT  410
             +EK IL   L++
Sbjct  469   VEKEILEKALKS  480



>ref|XP_002267249.1| PREDICTED: fructose-bisphosphate aldolase-lysine N-methyltransferase, 
chloroplastic [Vitis vinifera]
 emb|CBI35049.3| unnamed protein product [Vitis vinifera]
Length=484

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 113/251 (45%), Gaps = 26/251 (10%)
 Frame = -1

Query  1120  TEAFPFEI----FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAA--  959
             ++ FPF +    F  AF  ++S      +    +   L+PL   L+++  +      A  
Sbjct  197   SQLFPFPVTLDDFLWAFGILRSRAFSRLR---GQNLVLIPLAD-LINHSPSITTEEYAWE  252

Query  958   VDGAVQLVVDRPYKTGEPIVVWCGPQ---------PNSKLLINYGFVDEDNPYDRVTLEA  806
             + GA     D+ +    P+ V  G Q          N++L ++YGF++     +  TL  
Sbjct  253   IKGAGLFSRDQLFSLRTPVSVKAGEQVLIQYDLDKSNAELALDYGFIESRPNRNSYTLTL  312

Query  805   ALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPS----EM  638
              ++  DP + DK   A+ NG S +  F + +G  +   + MLPYLRL  +  P     E 
Sbjct  313   EISESDPFFGDKLDIAESNGLSEIAYFDIVLG--QSLPAAMLPYLRLVALGGPDAFLLES  370

Query  637   QFVLSSQGPV-CPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVA  461
              F  +  G +  PVS   E  +   + +  K+ L  Y TT+ EDE L  + +L P+  +A
Sbjct  371   IFRNTIWGHLELPVSRANEELICQVIQDACKSALSGYLTTIEEDEKLKEEGNLHPRLEIA  430

Query  460   TQLVRLEKRIL  428
               +   EK++L
Sbjct  431   VGVRTGEKKVL  441



>dbj|GAA97699.1| hypothetical protein E5Q_04377 [Mixia osmundae IAM 14324]
 gb|KEI36285.1| hypothetical protein L969DRAFT_97486 [Mixia osmundae IAM 14324]
Length=347

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 4/107 (4%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQS-CV-VHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDGA-  947
             E   F+ F+ A++ V S CV + L   +    F LVPL   + ++ S C       D A 
Sbjct  122   EIIDFDAFRWAWLCVNSRCVWLDLDYEAHEENFTLVPL-LDMANHSSTCANATVKYDHAH  180

Query  946   VQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEA  806
              +L + RP K GE IV   G    + L   YGF++  NP++R+ L A
Sbjct  181   FELKLTRPVKRGEEIVFEYGGHDQATLWAEYGFIESSNPHERIDLTA  227



>ref|XP_001696900.1| rubisco small subunit N-methyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00592.1| rubisco small subunit N-methyltransferase [Chlamydomonas reinhardtii]
Length=411

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 80/174 (46%), Gaps = 14/174 (8%)
 Frame = -1

Query  904  IVVWCGP---------QPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQR  752
            +VVW G          +PN +LL+  G + ++N  D ++  A L   D  Y  K    + 
Sbjct  174  VVVWDGAGSEMLLNDGRPNGELLLATGTLQDNNSSDFLSWPAGLVPADRYYMMKSQVLES  233

Query  751  NGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPVCPVSPCTERAVL  572
             G S+ + F VY  R      ++L YLRL  V+DP+ +            +S   E  +L
Sbjct  234  MGYSAAEEFPVYADR---MPIQLLAYLRLSRVADPALLAKCTFEAD--VELSQMNEYEIL  288

Query  571  DQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCLQT  410
              L    + RL  Y  +  ED  +   +DL PK+R+A +L   EKRI+N  ++ 
Sbjct  289  QILMGDCRERLASYTKSYEEDVKIAQQSDLSPKERLAVKLRLGEKRIINATMEA  342



>ref|XP_011449702.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Crassostrea 
gigas]
Length=504

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 104/217 (48%), Gaps = 26/217 (12%)
 Frame = -1

Query  1027  FALVPLGPPLLSYCSNCKAMLAA----VDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLI  860
             FAL+P+       C++C   +           +    R ++  E I ++ G + N++LLI
Sbjct  273   FALIPM----WDMCNHCNGTITTDYNLEKDCSECFALRNFQAKEQIFIFYGARSNAELLI  328

Query  859   NYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEML  680
             + GFV  +N  DR+ +   ++  DP Y+ K    ++ G S ++ F+++ G       +++
Sbjct  329   HNGFVYPENELDRIAIRLGISKGDPLYEQKNELLKKLGLSVLRNFYIHTGM-IPVDPQLM  387

Query  679   PYLRLGYVSDPS--EMQFVLSSQGPV-------CPVSPCTERAVLDQLAEYFKTR---LL  536
              +LR+  +S+ +  E+     S+           PVS   E    ++   + +TR   LL
Sbjct  388   AFLRVFCMSEENLKELNSKELSEADADRLGDIDVPVSEENE----EKAWAFLQTRTALLL  443

Query  535   R-YPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
             R Y T+  ED  LL   D++  +R+A QL   EKRIL
Sbjct  444   RAYETSEEEDIELLKKEDMNIHERLAVQLRMCEKRIL  480



>ref|XP_001448054.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80657.1| unnamed protein product [Paramecium tetraurelia]
Length=581

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (41%), Gaps = 30/191 (16%)
 Frame = -1

Query  1024  ALVPLG-------PPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKL  866
             A VPL        P L S+C       +       +  D     G+ I    G + NS+ 
Sbjct  317   AFVPLADMLNHKRPKLTSWC------YSEEKQGFIIETDEKIDRGQMIFDSYGRKCNSRF  370

Query  865   LINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGRE------  704
             L+NYGFV +DN  + V +  A    DP  Q K  A +   K   + F + +  +      
Sbjct  371   LLNYGFVVDDNDANEVNVTVAAEFNDPLIQLKEDATEEQLKQP-KTFRLIMDTDGINEIT  429

Query  703   ---KETISEMLPYLRLGYVSDPSEMQFVLSSQ-------GPVCPVSPCTERAVLDQLAEY  554
                + T+ E + Y+R   + D +++QF+L+ +         + P+    E  + D +   
Sbjct  430   HFLEATVMEFMSYIRFLVIRDQTQLQFLLNERESKYIKPTKIQPLGIHNELDMWDLIRRI  489

Query  553   FKTRLLRYPTT  521
                 L RYPTT
Sbjct  490   CYVSLSRYPTT  500



>ref|NP_001168589.1| hypothetical protein [Zea mays]
 gb|ACN28781.1| unknown [Zea mays]
 tpg|DAA61405.1| TPA: hypothetical protein ZEAMMB73_723554 [Zea mays]
Length=489

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 84/170 (49%), Gaps = 8/170 (5%)
 Frame = -1

Query  919  KTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
            K+G+ I + +   + N++L ++YGFV+ +   D  T+   ++  DP Y DK   A+ NG 
Sbjct  281  KSGQQIYIQYDLDKSNAELALDYGFVESNPSRDSFTVTLEISESDPFYGDKLDIAEANGL  340

Query  742  SSVQAFHVYVGREKETISEMLPYLRLGYVSDPS----EMQFVLSSQGPV-CPVSPCTERA  578
                 F V +   +    +MLPYLRL  +        E  F  S  G +  P+SP  E +
Sbjct  341  GETAYFDVIL--NEPLPPQMLPYLRLLCIGGTDAFLLEALFRNSVWGHLELPLSPDNEES  398

Query  577  VLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
            +   + +  K+ L  Y TT+ EDE L    +L P+  +A  +   EK++L
Sbjct  399  ICQAMRDACKSALADYHTTIEEDEELSGRENLQPRLAIAIGVRAGEKKVL  448



>gb|EXX65722.1| Efm1p [Rhizophagus irregularis DAOM 197198w]
Length=450

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/266 (25%), Positives = 109/266 (41%), Gaps = 21/266 (8%)
 Frame = -1

Query  1162  MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCS  983
             +  +LF ++P   P E F    +  A  A+ S  +  Q     ++F  +     +L++  
Sbjct  147   LLNNLFSKHPDLFPLEKFTQNDYMWALCAIWSRGMDFQLP--GKQFRCIAPFADMLNHSP  204

Query  982   N---CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTL  812
             +   C       D ++Q++  + Y  GE + +  G  PN++LL  YGFV  +NPYD   L
Sbjct  205   DVQLCHTYNPQSD-SLQILAGKDYTIGEQVFINYGSVPNNRLLRLYGFVLPNNPYDTYDL  263

Query  811   EAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLP-----YLRLGYVSDP  647
                 +   P Y  K    +  G      F +       T+S+ LP     YLR+  +S  
Sbjct  264   VLTTHPLAPLYAQKVTLLESAGLQVNATFPL-------TLSDPLPLDVLRYLRIQRLSS-  315

Query  646   SEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRL--LRYPTTlsedealladndlDPK  473
             SE+  V + +G    VS   E  +L  L E  ++ L     P    E     +       
Sbjct  316   SEISTVEAKRGARNIVSARNEAEILKALIEACESLLDGFSVPLEKLEANIASSVYQKSDN  375

Query  472   KRVATQLVRLEKRILNTCLQTTLHLI  395
             K  A  +   E++I+   LQ T  L+
Sbjct  376   KWAAAHVSIGEQKIIKMTLQKTRELL  401



>gb|ERZ96724.1| hypothetical protein GLOINDRAFT_12309 [Rhizophagus irregularis 
DAOM 181602]
Length=446

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/266 (25%), Positives = 109/266 (41%), Gaps = 21/266 (8%)
 Frame = -1

Query  1162  MAGSLFQQYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCS  983
             +  +LF ++P   P E F    +  A  A+ S  +  Q     ++F  +     +L++  
Sbjct  147   LLNNLFSKHPDLFPLEKFTQNDYMWALCAIWSRGMDFQLP--GKQFRCIAPFADMLNHSP  204

Query  982   N---CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTL  812
             +   C       D ++Q++  + Y  GE + +  G  PN++LL  YGFV  +NPYD   L
Sbjct  205   DVQLCHTYNPQSD-SLQILAGKDYTIGEQVFINYGSVPNNRLLRLYGFVLPNNPYDTYDL  263

Query  811   EAALNTEDPQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLP-----YLRLGYVSDP  647
                 +   P Y  K    +  G      F +       T+S+ LP     YLR+  +S  
Sbjct  264   VLTTHPLAPLYAQKVTLLESAGLQVNATFPL-------TLSDPLPLDVLRYLRIQRLSS-  315

Query  646   SEMQFVLSSQGPVCPVSPCTERAVLDQLAEYFKTRL--LRYPTTlsedealladndlDPK  473
             SE+  V + +G    VS   E  +L  L E  ++ L     P    E     +       
Sbjct  316   SEISTVEAKRGARNIVSARNEAEILKALIEACESLLDGFSVPLEKLEANIASSVYQKSDN  375

Query  472   KRVATQLVRLEKRILNTCLQTTLHLI  395
             K  A  +   E++I+   LQ T  L+
Sbjct  376   KWAAAHVSIGEQKIIKMTLQKTRELL  401



>ref|XP_004335535.1| SET domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR13522.1| SET domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=568

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 83/181 (46%), Gaps = 10/181 (6%)
 Frame = -1

Query  1150  LFQQYPYDIPTEAFPFEIFKQAFVAV---QSCVVHLQKVSLARRFALVPLGPPLLSYCSN  980
             LFQ     +   AF ++ F  A  AV   Q+ V      +L+  +AL+P          +
Sbjct  215   LFQIRKDILHINAFTWDEFIWAMSAVGSRQNQVPQWGHNALSE-YALIPAWDMCNHDHGD  273

Query  979   CKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAAL  800
              +        + +    R YK GE + ++ GP+PNS LL++ GFV E+N +D + +   L
Sbjct  274   LQTFWDVNSDSTESHAMRAYKKGEQVYIFYGPRPNSDLLLHAGFVYENNRFDALAIRVRL  333

Query  799   NTEDPQYQDK-RLAAQRNGKSSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLS  623
               +    +DK RL    N K   Q +   +G       +++ +LR+ +  +  E+Q VL 
Sbjct  334   APDAEHIKDKLRLLHLNNMKMDSQYYLYGLG----LAVDLMAFLRI-HAMNEQELQQVLG  388

Query  622   S  620
             +
Sbjct  389   A  389



>ref|XP_003057276.1| set domain protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH58921.1| set domain protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = -1

Query  1027  FALVPLGPPLLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGF  848
              ALVP    +L++   C A +    G V L  DR YK GE +    G +P+++LLI+YGF
Sbjct  172   LALVPWAD-MLNHKPGCNAYIDDSGGKVCLQPDRAYKPGEQVFASYGQRPSAELLISYGF  230

Query  847   VDE--DNPYDRVTLEAALNTEDPQYQDKRLAA-QRNGKSSVQAF  725
               E  +NP D   +   ++  D +Y D + AA ++ G   V++F
Sbjct  231   APEVGENPDDEYEITLGIDPND-RYADAKAAALEKIGLRPVESF  273



>ref|XP_002988920.1| hypothetical protein SELMODRAFT_129035, partial [Selaginella 
moellendorffii]
 gb|EFJ09949.1| hypothetical protein SELMODRAFT_129035, partial [Selaginella 
moellendorffii]
Length=389

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = -1

Query  1096  FKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCKAMLAAVDG--AVQLVVDRP  923
             FK A+  V S    ++ +   +  ALVP      ++ +NC+AML+  +     ++V DR 
Sbjct  133   FKHAYATVCSRAWGIETI---KSLALVPF-VDFFNHDANCRAMLSYDEDRHCAEVVSDRD  188

Query  922   YKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVT-LEAALNTEDPQYQDKRL  764
             Y TG+ +V+  G   N+ L +++GF    NP+D+V  +  +L+ +DP  +D +L
Sbjct  189   YATGDQVVISYGQLSNATLALDFGFALPFNPHDQVAGIWLSLSEKDP-LRDSKL  241



>ref|XP_008361779.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
Length=491

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 88/172 (51%), Gaps = 13/172 (8%)
 Frame = -1

Query  919  KTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
            K GE + + +   + N++  ++YGF+D +   +  TL   ++  DP Y+DK   A+ NG 
Sbjct  282  KAGEQVFIQYDINKSNAEFALDYGFLDSNANRNGFTLTLEISESDPFYEDKLDIAETNGL  341

Query  742  SSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSS------QGPV-CPVSPCTE  584
             +   F +++  E      ++PYLRL  V+      F+L S       G +  PVSP  E
Sbjct  342  GATAYFDIFL--ESSLPPALIPYLRL--VALGGTDAFLLESIFRNDIWGHLQLPVSPANE  397

Query  583  RAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRIL  428
              +   + +  K+ L  YPTT  E++  L ++ LDP+  +A  + + EK++L
Sbjct  398  ELICRVVQDACKSALSGYPTT-IEEDEKLKESKLDPRLEIAVGIRQGEKKVL  448



>ref|XP_001759585.1| predicted protein [Physcomitrella patens]
 gb|EDQ75497.1| predicted protein [Physcomitrella patens]
Length=340

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 94/212 (44%), Gaps = 28/212 (13%)
 Frame = -1

Query  1000 LLSYCSNCKAMLAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDR  821
            LL + S  +++       +++V ++  + GE +V+  GP  N  LL++YGFV   NP DR
Sbjct  123  LLQHSSESQSL-----PVLEVVAEKDLEKGENVVLNYGPLSNDILLLDYGFVMPKNPNDR  177

Query  820  VTLE------------AALNTE---DPQYQDKRLAAQRN--GKSSVQAFHVYVGREKETI  692
            V L             A +N +   DP      L  + N  G SS Q   V +G  +   
Sbjct  178  VELRYDDQLLHMACLVAKVNIDSFKDPTTSQLALLTRLNLHGPSSSQM--VTLGGTELVE  235

Query  691  SEMLPYLRLGYVSDPSEMQFV----LSSQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
              +L  +R+ +  DP E+  V    L +     P+    ER  +  L       L  +PT
Sbjct  236  GRLLAAVRVMHAQDPMELLDVDLEALQTWNQSPPLGVLNERKTIRTLIGLGMLALASFPT  295

Query  523  TlsedealladndlDPKKRVATQLVRLEKRIL  428
             + ED++ L   D+    R+A Q   L+KR+L
Sbjct  296  EIEEDQSELVKGDISENHRLAIQFRMLKKRLL  327



>gb|KJK75253.1| hypothetical protein H634G_09600 [Metarhizium anisopliae BRIP 
53293]
 gb|KJK85580.1| hypothetical protein H633G_10573 [Metarhizium anisopliae BRIP 
53284]
Length=477

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 88/213 (41%), Gaps = 16/213 (8%)
 Frame = -1

Query  1141  QYPYDIPTEAFPFEIFKQAFVAVQSCVVHLQKVSLARRFALVPLGPPLLSYCSNCK--AM  968
             QYP   P + F    +K A  AV S  +  Q    +    L P    +L++ S  K   +
Sbjct  164   QYPDLFPLDKFTLHHYKWALCAVWSRAMDFQLSDGSSIRLLAPFAD-MLNHSSESKQCHV  222

Query  967   LAAVDGAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTED  788
               A  G + ++  + Y+ G+ + +  G  PN +LL  YGF+   NP D   L  A +   
Sbjct  223   YDASSGDLSVLAGKDYEAGDQVYIHYGSIPNHRLLRLYGFIIPGNPNDSYDLVLATHPLA  282

Query  787   PQYQDKRLAAQRNGKSSVQAFHVYVGREKETISEMLP-----YLRLGYVSDPSEMQFVLS  623
             P ++ K+      G  S     +       T+++ LP     YLR+  + D S++  +  
Sbjct  283   PFFEQKQKLWALAGLDSTCTISL-------TLTDPLPKNVIRYLRIQRL-DESDLASIAL  334

Query  622   SQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPT  524
              Q     +S   E  VL  L E   + L  + T
Sbjct  335   RQAADEKISNSNEVQVLQSLVESIASLLGSFGT  367



>gb|AAI55279.1| SET domain containing 3 [Danio rerio]
Length=596

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/158 (26%), Positives = 75/158 (47%), Gaps = 14/158 (9%)
 Frame = -1

Query  1117  EAFPFEIFKQAFVAVQSCVVHLQKVSLAR-RFALVPLGPPLLSYCSNCKAMLAA----VD  953
             +AF F+ ++ A  +V +    +     +R   AL+PL       C++   ++       D
Sbjct  237   DAFTFDDYRWAVSSVMTRQNQIPTADGSRVTLALIPL----WDMCNHTNGLITTGYNLED  292

Query  952   GAVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQD  773
                + V  + YK GE I ++ G + N++ +I+ GF  EDN +DRV ++  ++  +  Y  
Sbjct  293   DRCECVALKDYKEGEQIYIFYGTRSNAEFVIHNGFFFEDNAHDRVKIKLGVSKSERLYAM  352

Query  772   KRLAAQRNG--KSSVQAFHVYVGREKETISEMLPYLRL  665
             K     R G   SS+ A H     E    +++L +LR+
Sbjct  353   KAEVLARAGIPASSIFALHC---SEPPISAQLLAFLRV  387



>ref|WP_002621005.1| hypothetical protein [Cystobacter fuscus]
 gb|EPX56666.1| hypothetical protein D187_008008 [Cystobacter fuscus DSM 2262]
Length=445

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 89/192 (46%), Gaps = 13/192 (7%)
 Frame = -1

Query  955  DG-AVQLVVDRPYKTGEPIVVWCGPQPNSKLLINYGFV-DEDNPYDRVTLEAALNTEDPQ  782
            DG   +++  R    G  I    G + +   L++ GFV D +   D V L   L   DP 
Sbjct  214  DGQTFRMIAQRAVPAGTEIHTHYGAKSSDVFLLHSGFVPDGNEENDEVYLSVGLPPGDPL  273

Query  781  YQDKRLAAQRNGKSSVQAFHVY-VGREKETISE--MLPYLRLGYVSDPSEM----QFVLS  623
               K+   Q  G +S  A H + V R+ + ++   +  +LR+ + S P E       +LS
Sbjct  274  ASVKQ---QMFGLASATAKHPFKVSRQGKYLASWSVFSFLRMAHAS-PDEFLALSNRLLS  329

Query  622  SQGPVCPVSPCTERAVLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRL  443
                + PVS   E  VL  LA   + RL  +PTTL EDE LL +  L P +R    L R 
Sbjct  330  GTKTIAPVSVACEERVLGTLAAACEERLKAFPTTLEEDERLLREGPLSPNERSCVLLRRQ  389

Query  442  EKRILNTCLQTT  407
            EKR+L   L+ T
Sbjct  390  EKRLLGDYLELT  401



>dbj|BAJ90193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 97/224 (43%), Gaps = 24/224 (11%)
 Frame = -1

Query  919  KTGEPIVV-WCGPQPNSKLLINYGFVDEDNPYDRVTLEAALNTEDPQYQDKRLAAQRNGK  743
            K+GE I V +   + N++L ++YGF + ++  D  TL   ++  DP Y+DK   A+ NG 
Sbjct  240  KSGEQIYVQYDLDKSNAELALDYGFTESNSSRDSYTLTLEISESDPFYEDKLDIAELNGM  299

Query  742  SSVQAFHVYVGREKETISEMLPYLRLGYVSDPSEMQFVLSSQGPV-----CPVSPCTERA  578
                 F V +G  +    +M+ YLRL  +            +  V      PVS   E +
Sbjct  300  GETAYFDVVLG--ESLPPQMITYLRLLCLGGTDAFLLEALFRNKVWEHLELPVSRDNEES  357

Query  577  VLDQLAEYFKTRLLRYPTTlsedealladndlDPKKRVATQLVRLEKRILNTCLQTTLHL  398
            +   +    K+ L  Y TT+ EDE LL   DL  + ++A ++   EK++L          
Sbjct  358  ICQVIQNACKSALAAYHTTIEEDEELLEREDLQSRHQIAVEVRVGEKKVLEQINDIFKER  417

Query  397  IDQLPDLSVSPCPAPYAPILK**GIVQQRNKKKLFFQSENGRLL  266
              +L DL                   Q+R  K L F  +NG ++
Sbjct  418  EQELDDLEY----------------YQERRLKDLGFIGDNGDII  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3434935870995