BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6768

Length=935
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762498.1|  PREDICTED: probable sulfate transporter 3.3        382   8e-129   Nicotiana sylvestris
ref|XP_009592943.1|  PREDICTED: probable sulfate transporter 3.3 ...    381   8e-127   Nicotiana tomentosiformis
ref|XP_009592942.1|  PREDICTED: probable sulfate transporter 3.3 ...    382   8e-127   Nicotiana tomentosiformis
ref|XP_009604001.1|  PREDICTED: probable sulfate transporter 3.3        384   3e-125   Nicotiana tomentosiformis
ref|XP_009802339.1|  PREDICTED: probable sulfate transporter 3.3        381   7e-124   Nicotiana sylvestris
ref|XP_006355098.1|  PREDICTED: probable sulfate transporter 3.3-...    358   3e-115   Solanum tuberosum [potatoes]
ref|XP_004238829.1|  PREDICTED: probable sulfate transporter 3.3        357   8e-115   Solanum lycopersicum
ref|XP_007045150.1|  Sulfate transporter 91                             352   1e-112   Theobroma cacao [chocolate]
gb|KDO64646.1|  hypothetical protein CISIN_1g006141mg                   352   2e-112   Citrus sinensis [apfelsine]
ref|XP_006469182.1|  PREDICTED: probable sulfate transporter 3.3-...    352   2e-112   Citrus sinensis [apfelsine]
ref|XP_006448250.1|  hypothetical protein CICLE_v10014538mg             352   2e-112   Citrus clementina [clementine]
gb|KHF99906.1|  putative sulfate transporter 3.3 -like protein          343   3e-112   Gossypium arboreum [tree cotton]
ref|XP_010044186.1|  PREDICTED: probable sulfate transporter 3.3 ...    348   2e-111   Eucalyptus grandis [rose gum]
gb|KDP38061.1|  hypothetical protein JCGZ_04704                         343   2e-111   Jatropha curcas
ref|XP_010044185.1|  PREDICTED: probable sulfate transporter 3.3 ...    348   3e-111   Eucalyptus grandis [rose gum]
gb|KJB15435.1|  hypothetical protein B456_002G178600                    346   3e-110   Gossypium raimondii
ref|XP_002526028.1|  sulfate transporter, putative                      343   4e-109   Ricinus communis
ref|XP_006379763.1|  hypothetical protein POPTR_0008s12940g             342   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_012072227.1|  PREDICTED: probable sulfate transporter 3.3        340   4e-108   Jatropha curcas
gb|ABK35747.1|  sulfate transporter                                     337   1e-107   Populus tremula x Populus alba [gray poplar]
ref|XP_002314803.2|  sulfate transporter 3.3 family protein             339   1e-107   
gb|KJB50368.1|  hypothetical protein B456_008G166800                    338   2e-107   Gossypium raimondii
ref|XP_011038634.1|  PREDICTED: probable sulfate transporter 3.3        338   2e-107   Populus euphratica
gb|KJB15439.1|  hypothetical protein B456_002G178600                    338   3e-107   Gossypium raimondii
gb|ABK35748.1|  sulfate transporter                                     337   4e-107   Populus tremula x Populus alba [gray poplar]
gb|ABK35746.2|  sulfate transporter                                     337   6e-107   Populus tremula x Populus alba [gray poplar]
ref|XP_011023507.1|  PREDICTED: probable sulfate transporter 3.3        336   1e-106   Populus euphratica
ref|XP_011075526.1|  PREDICTED: probable sulfate transporter 3.3        335   2e-106   Sesamum indicum [beniseed]
ref|XP_002280766.1|  PREDICTED: probable sulfate transporter 3.3        336   3e-106   Vitis vinifera
emb|CBI26897.3|  unnamed protein product                                335   3e-106   Vitis vinifera
ref|XP_010274709.1|  PREDICTED: probable sulfate transporter 3.3        334   8e-106   Nelumbo nucifera [Indian lotus]
ref|XP_002312444.2|  sulfate transporter 3.3 family protein             333   2e-105   
ref|XP_004140467.1|  PREDICTED: probable sulfate transporter 3.3        332   1e-104   Cucumis sativus [cucumbers]
ref|XP_006583911.1|  PREDICTED: probable sulfate transporter 3.3-...    330   2e-104   Glycine max [soybeans]
ref|XP_008454781.1|  PREDICTED: probable sulfate transporter 3.3        331   3e-104   Cucumis melo [Oriental melon]
ref|XP_003529415.1|  PREDICTED: probable sulfate transporter 3.3-...    330   3e-104   Glycine max [soybeans]
ref|XP_007157749.1|  hypothetical protein PHAVU_002G095300g             328   3e-103   Phaseolus vulgaris [French bean]
gb|KJB15438.1|  hypothetical protein B456_002G178600                    327   3e-103   Gossypium raimondii
ref|XP_003556073.1|  PREDICTED: probable sulfate transporter 3.3-...    327   6e-103   Glycine max [soybeans]
gb|KEH30847.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    326   2e-102   Medicago truncatula
ref|XP_010552708.1|  PREDICTED: probable sulfate transporter 3.3        324   3e-102   Tarenaya hassleriana [spider flower]
gb|KHN43014.1|  Putative sulfate transporter 3.3                        322   6e-101   Glycine soja [wild soybean]
ref|XP_010088531.1|  putative sulfate transporter 3.3                   321   2e-100   
ref|XP_004505279.1|  PREDICTED: probable sulfate transporter 3.3-...    320   3e-100   Cicer arietinum [garbanzo]
ref|XP_004297375.2|  PREDICTED: probable sulfate transporter 3.3        319   2e-99    Fragaria vesca subsp. vesca
gb|EYU43824.1|  hypothetical protein MIMGU_mgv1a019207mg                309   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_003528541.2|  PREDICTED: probable sulfate transporter 3.3-...    317   7e-99    Glycine max [soybeans]
emb|CAG28415.1|  plasma membrane sulphate transporter                   305   1e-98    Brassica oleracea var. viridis [collards]
ref|XP_006416126.1|  hypothetical protein EUTSA_v10007442mg             311   2e-98    
gb|KHN08075.1|  Putative sulfate transporter 3.3                        315   2e-98    Glycine soja [wild soybean]
dbj|BAA75015.1|  sulfate transporter                                    313   6e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY04744.1|  BnaC05g18450D                                          313   7e-98    
gb|KFK44398.1|  hypothetical protein AALP_AA1G252200                    313   8e-98    Arabis alpina [alpine rockcress]
ref|NP_173722.1|  sulfate transporter 3.3                               313   8e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAN77009.1|  hypothetical protein VITISV_036877                     313   1e-97    Vitis vinifera
ref|XP_002893261.1|  hypothetical protein ARALYDRAFT_472562             312   1e-97    
gb|KEH30849.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    313   2e-97    Medicago truncatula
ref|XP_006306275.1|  hypothetical protein CARUB_v10012133mg             311   3e-97    Capsella rubella
emb|CDY21415.1|  BnaA09g30120D                                          311   4e-97    Brassica napus [oilseed rape]
ref|XP_009115564.1|  PREDICTED: probable sulfate transporter 3.3        311   4e-97    Brassica rapa
ref|XP_010460085.1|  PREDICTED: probable sulfate transporter 3.3        310   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010498811.1|  PREDICTED: probable sulfate transporter 3.3        310   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010477593.1|  PREDICTED: probable sulfate transporter 3.3        310   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_008243372.1|  PREDICTED: probable sulfate transporter 3.3        310   3e-96    
ref|XP_007157748.1|  hypothetical protein PHAVU_002G095200g             308   7e-96    Phaseolus vulgaris [French bean]
emb|CAJ86330.1|  OSIGBa0113E10.13                                       305   6e-95    Oryza sativa [red rice]
emb|CAE03539.2|  OSJNBa0060D06.5                                        305   1e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ37975.1|  hypothetical protein OsJ_22321                          305   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054098.1|  Os04g0652400                                       305   2e-94    
ref|XP_007225166.1|  hypothetical protein PRUPE_ppa002313mg             305   2e-94    
ref|XP_009103199.1|  PREDICTED: probable sulfate transporter 3.3 ...    303   6e-94    Brassica rapa
gb|EMT11015.1|  Putative sulfate transporter 3.3                        301   1e-93    
ref|XP_006652928.1|  PREDICTED: probable sulfate transporter 3.3-...    302   2e-93    
gb|EMS65870.1|  putative sulfate transporter 3.3                        299   5e-93    Triticum urartu
emb|CDP00782.1|  unnamed protein product                                299   6e-93    Coffea canephora [robusta coffee]
dbj|BAJ85696.1|  predicted protein                                      301   1e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169671.1|  uncharacterized protein LOC100383552               300   2e-92    Zea mays [maize]
ref|XP_002448662.1|  hypothetical protein SORBIDRAFT_06g030980          297   3e-91    Sorghum bicolor [broomcorn]
ref|XP_009339687.1|  PREDICTED: probable sulfate transporter 3.3        296   4e-91    
ref|XP_004505276.1|  PREDICTED: probable sulfate transporter 3.3-...    296   6e-91    Cicer arietinum [garbanzo]
gb|EYU31826.1|  hypothetical protein MIMGU_mgv1a0030181mg               285   3e-90    Erythranthe guttata [common monkey flower]
ref|XP_010943102.1|  PREDICTED: probable sulfate transporter 3.3 ...    291   2e-89    Elaeis guineensis
ref|XP_004977057.1|  PREDICTED: probable sulfate transporter 3.3-...    292   3e-89    Setaria italica
ref|XP_008775815.1|  PREDICTED: probable sulfate transporter 3.3        291   3e-89    
ref|XP_008339548.1|  PREDICTED: probable sulfate transporter 3.3        291   4e-89    Malus domestica [apple tree]
ref|XP_008389211.1|  PREDICTED: probable sulfate transporter 3.3        290   3e-88    
dbj|BAK05364.1|  predicted protein                                      289   3e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009351474.1|  PREDICTED: probable sulfate transporter 3.3        289   4e-88    Pyrus x bretschneideri [bai li]
ref|XP_009403141.1|  PREDICTED: probable sulfate transporter 3.3        288   6e-88    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT11939.1|  Putative sulfate transporter 3.3                        287   2e-87    
gb|ERM94085.1|  hypothetical protein AMTR_s00010p00108760               285   5e-87    Amborella trichopoda
ref|XP_006826848.2|  PREDICTED: probable sulfate transporter 3.3        285   6e-87    
gb|KHG23018.1|  putative sulfate transporter 3.3 -like protein          281   1e-85    Gossypium arboreum [tree cotton]
ref|XP_004505277.1|  PREDICTED: probable sulfate transporter 3.3-...    281   2e-85    
ref|XP_006844344.2|  PREDICTED: probable sulfate transporter 3.4        273   1e-82    
ref|XP_009381462.1|  PREDICTED: probable sulfate transporter 3.3        273   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|ERN06019.1|  hypothetical protein AMTR_s00142p00027860               273   3e-82    Amborella trichopoda
emb|CAA65536.1|  sulphate transporter protein                           270   7e-81    Sporobolus stapfianus [resurrection grass]
ref|XP_003580696.2|  PREDICTED: LOW QUALITY PROTEIN: probable sul...    267   5e-80    
ref|XP_010254168.1|  PREDICTED: probable sulfate transporter 3.4 ...    267   7e-80    Nelumbo nucifera [Indian lotus]
gb|KDP37199.1|  hypothetical protein JCGZ_06255                         257   2e-78    Jatropha curcas
ref|XP_010249813.1|  PREDICTED: probable sulfate transporter 3.4        262   5e-78    
gb|KHG20994.1|  putative sulfate transporter 3.4 -like protein          259   6e-77    Gossypium arboreum [tree cotton]
ref|XP_009338984.1|  PREDICTED: probable sulfate transporter 3.4        258   1e-76    Pyrus x bretschneideri [bai li]
ref|XP_004505280.1|  PREDICTED: probable sulfate transporter 3.3-...    258   1e-76    
gb|KJB13141.1|  hypothetical protein B456_002G059100                    258   1e-76    Gossypium raimondii
gb|KJB56717.1|  hypothetical protein B456_009G132900                    258   2e-76    Gossypium raimondii
gb|KJB13144.1|  hypothetical protein B456_002G059100                    257   3e-76    Gossypium raimondii
gb|KJB13142.1|  hypothetical protein B456_002G059100                    257   3e-76    Gossypium raimondii
ref|XP_010545727.1|  PREDICTED: probable sulfate transporter 3.4        257   4e-76    Tarenaya hassleriana [spider flower]
gb|KHN43015.1|  Putative sulfate transporter 3.3                        256   4e-76    Glycine soja [wild soybean]
ref|XP_007135701.1|  hypothetical protein PHAVU_010G151000g             256   9e-76    Phaseolus vulgaris [French bean]
emb|CDY30127.1|  BnaC05g37350D                                          256   1e-75    Brassica napus [oilseed rape]
ref|XP_012073326.1|  PREDICTED: probable sulfate transporter 3.4        256   1e-75    Jatropha curcas
gb|EYU24685.1|  hypothetical protein MIMGU_mgv1a002778mg                255   1e-75    Erythranthe guttata [common monkey flower]
ref|XP_008342718.1|  PREDICTED: probable sulfate transporter 3.4        256   1e-75    
gb|AGW45462.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    254   1e-75    Reaumuria trigyna
ref|XP_009146179.1|  PREDICTED: probable sulfate transporter 3.4 ...    255   1e-75    Brassica rapa
ref|XP_009146178.1|  PREDICTED: probable sulfate transporter 3.4 ...    255   2e-75    Brassica rapa
emb|CDO98069.1|  unnamed protein product                                255   2e-75    Coffea canephora [robusta coffee]
gb|ABB59575.1|  putative sulfate transporter                            254   2e-75    Populus tremula x Populus alba [gray poplar]
ref|XP_007217635.1|  hypothetical protein PRUPE_ppa002586mg             255   2e-75    Prunus persica
ref|XP_006297165.1|  hypothetical protein CARUB_v10013170mg             254   3e-75    Capsella rubella
ref|XP_002303279.2|  sulfate transporter 3.4 family protein             254   3e-75    
emb|CDX97715.1|  BnaA05g23640D                                          254   3e-75    
ref|XP_002528191.1|  sulfate transporter, putative                      254   3e-75    Ricinus communis
ref|XP_010098035.1|  putative sulfate transporter 3.4                   255   5e-75    
ref|XP_007024090.1|  Sulfate transporter 3,4                            254   5e-75    
ref|XP_008228574.1|  PREDICTED: probable sulfate transporter 3.4        254   6e-75    Prunus mume [ume]
gb|ABB59576.1|  putative sulfate transporter                            253   7e-75    Populus tremula x Populus alba [gray poplar]
gb|KHG08777.1|  putative sulfate transporter 3.4 -like protein          254   7e-75    Gossypium arboreum [tree cotton]
gb|KFK38950.1|  hypothetical protein AALP_AA3G181100                    253   1e-74    Arabis alpina [alpine rockcress]
ref|XP_006451104.1|  hypothetical protein CICLE_v10010204mg             253   1e-74    
gb|KDO54167.1|  hypothetical protein CISIN_1g005883mg                   253   1e-74    Citrus sinensis [apfelsine]
gb|EYU21552.1|  hypothetical protein MIMGU_mgv1a002572mg                252   2e-74    Erythranthe guttata [common monkey flower]
ref|XP_010691282.1|  PREDICTED: probable sulfate transporter 3.4        253   2e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002882970.1|  SULTR3_4                                           252   2e-74    
ref|XP_006476102.1|  PREDICTED: probable sulfate transporter 3.4-...    253   2e-74    Citrus sinensis [apfelsine]
emb|CAN70927.1|  hypothetical protein VITISV_043810                     252   3e-74    Vitis vinifera
emb|CBI36164.3|  unnamed protein product                                251   3e-74    Vitis vinifera
ref|XP_010487443.1|  PREDICTED: probable sulfate transporter 3.4        252   3e-74    Camelina sativa [gold-of-pleasure]
ref|XP_003632863.1|  PREDICTED: probable sulfate transporter 3.4        252   3e-74    Vitis vinifera
emb|CAG28416.1|  plasma membrane sulphate transporter                   252   3e-74    Brassica oleracea var. viridis [collards]
ref|XP_011000828.1|  PREDICTED: probable sulfate transporter 3.4        251   8e-74    Populus euphratica
ref|XP_011000827.1|  PREDICTED: probable sulfate transporter 3.4        251   8e-74    Populus euphratica
gb|ABK24712.1|  unknown                                                 246   1e-73    Picea sitchensis
ref|XP_003529722.1|  PREDICTED: probable sulfate transporter 3.4-...    250   1e-73    Glycine max [soybeans]
gb|KHN39335.1|  Putative sulfate transporter 3.4                        250   2e-73    Glycine soja [wild soybean]
ref|XP_010503650.1|  PREDICTED: probable sulfate transporter 3.4        250   2e-73    Camelina sativa [gold-of-pleasure]
ref|NP_188220.1|  putative sulfate transporter 3;4                      249   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002696.1|  PREDICTED: probable sulfate transporter 3.4 ...    249   3e-73    Populus euphratica
emb|CDY21893.1|  BnaC01g35550D                                          249   4e-73    Brassica napus [oilseed rape]
gb|ABB59574.1|  putative sulfate transporter                            248   5e-73    Populus tremula x Populus alba [gray poplar]
gb|KEH39568.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    248   5e-73    Medicago truncatula
ref|XP_004486722.1|  PREDICTED: probable sulfate transporter 3.4-...    248   5e-73    Cicer arietinum [garbanzo]
ref|XP_004302921.1|  PREDICTED: probable sulfate transporter 3.4        249   6e-73    Fragaria vesca subsp. vesca
ref|XP_011072325.1|  PREDICTED: probable sulfate transporter 3.4        249   6e-73    Sesamum indicum [beniseed]
ref|XP_003531685.1|  PREDICTED: probable sulfate transporter 3.4-...    248   6e-73    Glycine max [soybeans]
ref|XP_010465599.1|  PREDICTED: probable sulfate transporter 3.4 ...    248   1e-72    Camelina sativa [gold-of-pleasure]
gb|ABR16213.1|  unknown                                                 248   1e-72    Picea sitchensis
ref|XP_010465597.1|  PREDICTED: probable sulfate transporter 3.4 ...    248   2e-72    Camelina sativa [gold-of-pleasure]
ref|XP_008793448.1|  PREDICTED: probable sulfate transporter 3.4        247   2e-72    Phoenix dactylifera
ref|XP_009115084.1|  PREDICTED: probable sulfate transporter 3.4        247   3e-72    Brassica rapa
ref|XP_009773435.1|  PREDICTED: probable sulfate transporter 3.4        247   3e-72    Nicotiana sylvestris
ref|XP_003546346.1|  PREDICTED: probable sulfate transporter 3.4-...    246   3e-72    Glycine max [soybeans]
ref|XP_009598569.1|  PREDICTED: probable sulfate transporter 3.4        246   6e-72    Nicotiana tomentosiformis
ref|XP_010033888.1|  PREDICTED: probable sulfate transporter 3.4        246   6e-72    Eucalyptus grandis [rose gum]
ref|XP_009358236.1|  PREDICTED: LOW QUALITY PROTEIN: probable sul...    240   8e-72    Pyrus x bretschneideri [bai li]
gb|KHM98769.1|  Putative sulfate transporter 3.4                        245   1e-71    Glycine soja [wild soybean]
ref|XP_009381146.1|  PREDICTED: probable sulfate transporter 3.4        245   1e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004506859.1|  PREDICTED: probable sulfate transporter 3.4-...    244   3e-71    Cicer arietinum [garbanzo]
ref|XP_007150669.1|  hypothetical protein PHAVU_005G171800g             244   3e-71    Phaseolus vulgaris [French bean]
emb|CDY10952.1|  BnaA03g46110D                                          242   3e-71    Brassica napus [oilseed rape]
gb|KEH28773.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    243   5e-71    Medicago truncatula
gb|KJB15440.1|  hypothetical protein B456_002G178600                    242   6e-71    Gossypium raimondii
ref|XP_002281235.1|  PREDICTED: probable sulfate transporter 3.4 ...    243   7e-71    Vitis vinifera
emb|CBI28093.3|  unnamed protein product                                243   7e-71    Vitis vinifera
ref|XP_009135468.1|  PREDICTED: probable sulfate transporter 3.4        243   9e-71    Brassica rapa
ref|XP_003543650.1|  PREDICTED: probable sulfate transporter 3.4-...    242   1e-70    Glycine max [soybeans]
gb|KHN32600.1|  Putative sulfate transporter 3.4                        242   1e-70    Glycine soja [wild soybean]
ref|XP_008462141.1|  PREDICTED: probable sulfate transporter 3.4        242   1e-70    Cucumis melo [Oriental melon]
emb|CDX82421.1|  BnaA03g34000D                                          241   2e-70    
ref|XP_002298140.1|  sulfate transporter 3.4 family protein             242   4e-70    
ref|XP_009137368.1|  PREDICTED: probable sulfate transporter 3.4        240   6e-70    Brassica rapa
ref|XP_010943103.1|  PREDICTED: probable sulfate transporter 3.3 ...    239   7e-70    
ref|XP_011081670.1|  PREDICTED: probable sulfate transporter 3.4        241   1e-69    
ref|XP_006465559.1|  PREDICTED: probable sulfate transporter 3.4-...    239   2e-69    Citrus sinensis [apfelsine]
ref|XP_004252331.1|  PREDICTED: probable sulfate transporter 3.4        239   2e-69    Solanum lycopersicum
ref|XP_004141780.1|  PREDICTED: probable sulfate transporter 3.4        239   2e-69    Cucumis sativus [cucumbers]
ref|XP_009408945.1|  PREDICTED: probable sulfate transporter 3.4        239   3e-69    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75862.1|  BnaC03g39450D                                          237   1e-68    
ref|XP_009768935.1|  PREDICTED: probable sulfate transporter 3.4        236   4e-68    Nicotiana sylvestris
ref|XP_010915047.1|  PREDICTED: probable sulfate transporter 3.4 ...    235   5e-68    Elaeis guineensis
ref|XP_006346582.1|  PREDICTED: probable sulfate transporter 3.4-...    234   1e-67    Solanum tuberosum [potatoes]
ref|XP_010688173.1|  PREDICTED: probable sulfate transporter 3.4        233   6e-67    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009615183.1|  PREDICTED: probable sulfate transporter 3.4        231   2e-66    Nicotiana tomentosiformis
gb|ACF85430.1|  unknown                                                 219   2e-65    Zea mays [maize]
emb|CBK55662.1|  sulphate transporter                                   228   3e-65    Astragalus drummondii
ref|XP_011042845.1|  PREDICTED: probable sulfate transporter 3.3        214   5e-65    Populus euphratica
emb|CBK55659.1|  sulphate transporter                                   226   9e-65    Astragalus bisulcatus
emb|CBK55654.1|  sulphate transporter                                   226   1e-64    Astragalus racemosus
ref|XP_008366542.1|  PREDICTED: sulfate transporter 3.1-like            226   2e-64    Malus domestica [apple tree]
ref|XP_009393046.1|  PREDICTED: sulfate transporter 3.1-like            226   2e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008359389.1|  PREDICTED: sulfate transporter 3.1-like            221   2e-64    
gb|ABL85048.1|  sulfate transporter                                     225   2e-64    Brachypodium sylvaticum
ref|XP_009367588.1|  PREDICTED: sulfate transporter 3.1-like            224   5e-64    Pyrus x bretschneideri [bai li]
gb|EAZ35804.1|  hypothetical protein OsJ_20097                          223   7e-64    Oryza sativa Japonica Group [Japonica rice]
gb|KJB15437.1|  hypothetical protein B456_002G178600                    222   8e-64    Gossypium raimondii
gb|ABK35756.1|  sulfate transporter                                     220   8e-64    Populus tremula x Populus alba [gray poplar]
ref|XP_008780888.1|  PREDICTED: sulfate transporter 1.2-like            224   8e-64    Phoenix dactylifera
ref|XP_004964529.1|  PREDICTED: probable sulfate transporter 3.4-...    224   8e-64    Setaria italica
gb|EPS70563.1|  hypothetical protein M569_04193                         218   1e-63    Genlisea aurea
ref|XP_009398827.1|  PREDICTED: probable sulfate transporter 3.4        223   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008368821.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    223   1e-63    
ref|XP_010515628.1|  PREDICTED: sulfate transporter 3.1-like isof...    223   2e-63    Camelina sativa [gold-of-pleasure]
gb|EEC79974.1|  hypothetical protein OsI_21599                          223   2e-63    Oryza sativa Indica Group [Indian rice]
dbj|BAJ34524.1|  unnamed protein product                                223   2e-63    Eutrema halophilum
gb|KJB56718.1|  hypothetical protein B456_009G132900                    223   2e-63    Gossypium raimondii
ref|XP_006403870.1|  hypothetical protein EUTSA_v10010178mg             223   2e-63    Eutrema salsugineum [saltwater cress]
ref|NP_001056778.1|  Os06g0143700                                       223   2e-63    
ref|XP_010426769.1|  PREDICTED: sulfate transporter 3.1 isoform X1      223   3e-63    Camelina sativa [gold-of-pleasure]
ref|XP_003557209.1|  PREDICTED: probable sulfate transporter 3.4        223   3e-63    Brachypodium distachyon [annual false brome]
ref|XP_002877831.1|  sulfate transporter                                223   3e-63    Arabidopsis lyrata subsp. lyrata
emb|CDX90628.1|  BnaA03g41530D                                          222   4e-63    
ref|XP_008356897.1|  PREDICTED: probable sulfate transporter 3.4        213   4e-63    
dbj|BAA25175.1|  sulfate transporter                                    222   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|NP_190758.2|  sulfate transporter 3;1                               222   5e-63    Arabidopsis thaliana [mouse-ear cress]
gb|EMS52732.1|  putative sulfate transporter 3.4                        221   5e-63    Triticum urartu
dbj|BAA21657.1|  sulfate transporter                                    222   6e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503899.1|  PREDICTED: sulfate transporter 3.1-like            222   6e-63    Camelina sativa [gold-of-pleasure]
emb|CAN70402.1|  hypothetical protein VITISV_039695                     219   7e-63    Vitis vinifera
ref|XP_004235704.1|  PREDICTED: probable sulfate transporter 3.4        221   1e-62    Solanum lycopersicum
ref|XP_006655780.1|  PREDICTED: probable sulfate transporter 3.4-...    221   1e-62    Oryza brachyantha
gb|EYU46548.1|  hypothetical protein MIMGU_mgv1a002543mg                221   1e-62    Erythranthe guttata [common monkey flower]
gb|AAC14417.1|  unknown                                                 222   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KHG13885.1|  Sulfate transporter 3                                   216   2e-62    Gossypium arboreum [tree cotton]
ref|XP_011026981.1|  PREDICTED: sulfate transporter 3.1-like            220   2e-62    Populus euphratica
ref|XP_010102377.1|  Sulfate transporter 3.1                            221   2e-62    Morus notabilis
ref|XP_009136641.1|  PREDICTED: sulfate transporter 3.1-like            221   2e-62    Brassica rapa
gb|EMT18395.1|  Putative sulfate transporter 3.4                        220   2e-62    
ref|XP_008798427.1|  PREDICTED: sulfate transporter 1.3-like            220   2e-62    
ref|XP_008807263.1|  PREDICTED: sulfate transporter 3.1-like            220   3e-62    Phoenix dactylifera
ref|XP_009409847.1|  PREDICTED: sulfate transporter 1.2-like            219   3e-62    
ref|XP_009370789.1|  PREDICTED: sulfate transporter 3.1-like            220   3e-62    Pyrus x bretschneideri [bai li]
ref|XP_002314667.1|  hypothetical protein POPTR_0010s09280g             220   3e-62    
ref|XP_006343117.1|  PREDICTED: probable sulfate transporter 3.4-...    220   3e-62    Solanum tuberosum [potatoes]
ref|XP_011002697.1|  PREDICTED: probable sulfate transporter 3.4 ...    219   3e-62    Populus euphratica
ref|XP_003632327.1|  PREDICTED: sulfate transporter 3.1-like            219   4e-62    Vitis vinifera
emb|CBI28733.3|  unnamed protein product                                219   4e-62    Vitis vinifera
gb|AAN06871.1|  Putative sulfate transporter ATST1                      219   5e-62    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88641.1|  hypothetical protein OsI_10116                          219   5e-62    Oryza sativa Indica Group [Indian rice]
emb|CDY29052.1|  BnaC07g32580D                                          221   5e-62    Brassica napus [oilseed rape]
dbj|BAJ91790.1|  predicted protein                                      219   5e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011079899.1|  PREDICTED: sulfate transporter 3.1                 219   5e-62    Sesamum indicum [beniseed]
ref|NP_001049042.1|  Os03g0161200                                       219   6e-62    
ref|XP_006649437.1|  PREDICTED: sulfate transporter 3.1-like            219   6e-62    Oryza brachyantha
ref|XP_006290679.1|  hypothetical protein CARUB_v10016772mg             219   6e-62    
ref|XP_002517080.1|  sulfate transporter, putative                      218   6e-62    
gb|EYU40896.1|  hypothetical protein MIMGU_mgv1a002568mg                219   8e-62    Erythranthe guttata [common monkey flower]
ref|XP_010926258.1|  PREDICTED: sulfate transporter 1.2-like            219   8e-62    Elaeis guineensis
ref|NP_001141114.1|  uncharacterized protein LOC100273198               218   1e-61    Zea mays [maize]
ref|XP_002312546.2|  hypothetical protein POPTR_0008s15640g             218   1e-61    
ref|XP_011030640.1|  PREDICTED: sulfate transporter 3.1-like            218   2e-61    Populus euphratica
gb|KJB42155.1|  hypothetical protein B456_007G139400                    215   2e-61    Gossypium raimondii
emb|CDP03663.1|  unnamed protein product                                218   2e-61    Coffea canephora [robusta coffee]
ref|XP_011006147.1|  PREDICTED: sulfate transporter 1.2-like            218   2e-61    Populus euphratica
ref|XP_012069690.1|  PREDICTED: sulfate transporter 3.1-like            218   2e-61    Jatropha curcas
emb|CDX78046.1|  BnaA09g32410D                                          216   3e-61    
gb|KJB72262.1|  hypothetical protein B456_011G167600                    217   3e-61    Gossypium raimondii
ref|XP_008451304.1|  PREDICTED: sulfate transporter 3.1-like            209   3e-61    Cucumis melo [Oriental melon]
ref|XP_007201737.1|  hypothetical protein PRUPE_ppa002556mg             217   4e-61    Prunus persica
gb|KHN45351.1|  Sulfate transporter 1.3                                 216   5e-61    Glycine soja [wild soybean]
ref|XP_010917792.1|  PREDICTED: sulfate transporter 3.1-like            216   5e-61    Elaeis guineensis
ref|XP_007018858.1|  Sulfate transporter 1,3 isoform 2                  216   5e-61    
ref|XP_002465820.1|  hypothetical protein SORBIDRAFT_01g046410          216   6e-61    Sorghum bicolor [broomcorn]
ref|XP_008809388.1|  PREDICTED: sulfate transporter 3.1-like            216   6e-61    Phoenix dactylifera
ref|XP_007018857.1|  Sulfate transporter 1,3 isoform 1                  217   6e-61    
ref|XP_011015979.1|  PREDICTED: sulfate transporter 1.2-like            216   7e-61    Populus euphratica
ref|XP_010552755.1|  PREDICTED: sulfate transporter 3.1 isoform X1      216   7e-61    Tarenaya hassleriana [spider flower]
ref|XP_010092428.1|  Sulfate transporter 3.1                            216   9e-61    
gb|ABK35750.1|  sulfate transporter                                     214   1e-60    
ref|XP_009115890.1|  PREDICTED: sulfate transporter 3.1                 216   1e-60    
ref|NP_001105050.1|  sulfate permease1                                  216   1e-60    
ref|XP_009404054.1|  PREDICTED: sulfate transporter 1.2-like            215   1e-60    
ref|NP_001061769.1|  Os08g0406400                                       207   1e-60    
ref|XP_002437812.1|  hypothetical protein SORBIDRAFT_10g003050          216   1e-60    
ref|XP_006489450.1|  PREDICTED: sulfate transporter 3.1-like            215   2e-60    
gb|ABB59577.2|  putative sulfate transporter                            215   2e-60    
gb|KEH23810.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    215   2e-60    
ref|XP_008648264.1|  PREDICTED: sulfate permease1 isoform X1            215   2e-60    
emb|CAD55695.1|  sulphate transporter                                   215   2e-60    
gb|ABK35751.2|  sulfate transporter                                     214   2e-60    
ref|XP_008438625.1|  PREDICTED: sulfate transporter 3.1                 214   2e-60    
ref|XP_004134124.2|  PREDICTED: sulfate transporter 3.1                 214   2e-60    
ref|XP_012092183.1|  PREDICTED: sulfate transporter 3.1-like            214   2e-60    
ref|XP_010932803.1|  PREDICTED: sulfate transporter 3.1-like isof...    212   3e-60    
ref|XP_010552756.1|  PREDICTED: sulfate transporter 3.1 isoform X2      214   3e-60    
ref|XP_008235373.1|  PREDICTED: sulfate transporter 3.1-like            214   3e-60    
ref|XP_010916916.1|  PREDICTED: sulfate transporter 1.3-like            214   3e-60    
gb|KJB42154.1|  hypothetical protein B456_007G139400                    214   3e-60    
ref|XP_010939616.1|  PREDICTED: sulfate transporter 1.3-like            214   4e-60    
gb|KFK34430.1|  hypothetical protein AALP_AA5G143800                    214   4e-60    
dbj|BAJ89607.1|  predicted protein                                      214   5e-60    
ref|XP_008790803.1|  PREDICTED: sulfate transporter 1.3-like            214   5e-60    
gb|EPS65934.1|  hypothetical protein M569_08843                         213   5e-60    
ref|XP_002307394.1|  high affinity sulfate transporter family pro...    214   5e-60    
ref|XP_010652002.1|  PREDICTED: sulfate transporter 3.1-like            213   7e-60    
gb|KDO74470.1|  hypothetical protein CISIN_1g006373mg                   213   7e-60    
ref|XP_006420023.1|  hypothetical protein CICLE_v10004520mg             213   8e-60    
emb|CAE46442.1|  sulphate transporter                                   213   8e-60    
ref|XP_011090680.1|  PREDICTED: sulfate transporter 3.1-like            213   8e-60    
emb|CDX73683.1|  BnaC08g23200D                                          213   9e-60    
ref|XP_006838985.1|  PREDICTED: sulfate transporter 3.1                 213   1e-59    
ref|NP_001148179.1|  sulfate transporter 3.4                            213   1e-59    
gb|ABB59579.1|  putative sulfate transporter                            211   1e-59    
emb|CAB42985.1|  putative high affinity sulfate transporter             213   1e-59    
ref|XP_004290627.1|  PREDICTED: sulfate transporter 3.1                 213   1e-59    
ref|XP_003526594.1|  PREDICTED: sulfate transporter 1.3-like isof...    213   1e-59    
ref|XP_004973399.1|  PREDICTED: sulfate transporter 1.2-like isof...    213   1e-59    
gb|AFW89362.1|  hypothetical protein ZEAMMB73_695392                    213   1e-59    
ref|XP_009620841.1|  PREDICTED: sulfate transporter 3.1-like isof...    212   1e-59    
ref|XP_010939615.1|  PREDICTED: sulfate transporter 1.3-like            212   2e-59    
ref|XP_006659385.1|  PREDICTED: sulfate transporter 1.2-like            212   2e-59    
ref|XP_007034842.1|  Sulfate transporter, putative isoform 1            212   2e-59    
ref|XP_004237882.1|  PREDICTED: sulfate transporter 1.3                 212   2e-59    
ref|XP_011082583.1|  PREDICTED: sulfate transporter 3.1-like            212   2e-59    
ref|XP_009773834.1|  PREDICTED: sulfate transporter 3.1-like isof...    211   2e-59    
gb|ABB59578.1|  putative sulfate transporter                            210   2e-59    
ref|XP_009620840.1|  PREDICTED: sulfate transporter 3.1-like isof...    212   3e-59    
emb|CDO99099.1|  unnamed protein product                                212   3e-59    
ref|XP_006354018.1|  PREDICTED: sulfate transporter 1.3-like            212   3e-59    
ref|XP_007225118.1|  hypothetical protein PRUPE_ppa002648mg             212   3e-59    
ref|XP_009773833.1|  PREDICTED: sulfate transporter 3.1-like isof...    212   3e-59    
ref|XP_009804926.1|  PREDICTED: sulfate transporter 3.1-like            212   3e-59    
ref|XP_007050523.1|  Sulfate transporter 3,1                            211   3e-59    
ref|XP_010256149.1|  PREDICTED: sulfate transporter 3.1-like isof...    211   4e-59    
ref|XP_007136221.1|  hypothetical protein PHAVU_009G028500g             211   4e-59    
ref|XP_006472647.1|  PREDICTED: sulfate transporter 1.3-like isof...    211   4e-59    
gb|EMT20444.1|  High affinity sulfate transporter 2                     213   5e-59    
ref|XP_004150525.1|  PREDICTED: sulfate transporter 1.3-like            211   5e-59    
ref|XP_010932801.1|  PREDICTED: sulfate transporter 3.1-like isof...    211   5e-59    
gb|AAA97952.1|  high affinity sulfate transporter HVST1                 211   5e-59    
emb|CAA65291.1|  high affinity sulphate transporter                     211   5e-59    
ref|XP_002468339.1|  hypothetical protein SORBIDRAFT_01g044090          211   5e-59    
ref|XP_003558765.1|  PREDICTED: sulfate transporter 3.1-like            211   6e-59    
ref|XP_010256148.1|  PREDICTED: sulfate transporter 3.1-like isof...    211   6e-59    
ref|XP_009335285.1|  PREDICTED: sulfate transporter 3.1-like            211   7e-59    
ref|XP_009778206.1|  PREDICTED: sulfate transporter 3.1-like            211   7e-59    
ref|XP_006649558.1|  PREDICTED: sulfate transporter 1.2-like            211   7e-59    
gb|AGI96996.1|  putative high-affinity sulfate transporter              211   7e-59    
ref|XP_011032651.1|  PREDICTED: sulfate transporter 3.1-like            211   8e-59    
gb|AAM14588.1|AF493790_1  putative sulphate transporter                 211   8e-59    
ref|NP_001049259.1|  Os03g0195800                                       211   8e-59    
ref|NP_001132356.1|  uncharacterized protein LOC100193800               206   9e-59    
ref|XP_010229044.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    210   1e-58    
ref|XP_002464158.1|  hypothetical protein SORBIDRAFT_01g013290          210   1e-58    
ref|XP_008224259.1|  PREDICTED: sulfate transporter 3.1-like            210   1e-58    
gb|EYU43602.1|  hypothetical protein MIMGU_mgv1a019382mg                210   1e-58    
ref|XP_010070167.1|  PREDICTED: sulfate transporter 3.1-like            210   2e-58    
ref|XP_008390930.1|  PREDICTED: sulfate transporter 3.1-like            209   2e-58    
ref|XP_009612528.1|  PREDICTED: sulfate transporter 3.1-like            210   2e-58    
ref|XP_002283184.2|  PREDICTED: sulfate transporter 3.1-like            210   2e-58    
ref|XP_010422555.1|  PREDICTED: sulfate transporter 3.2-like            201   2e-58    
ref|XP_008444099.1|  PREDICTED: sulfate transporter 1.3-like            209   2e-58    
ref|XP_006349709.1|  PREDICTED: sulfate transporter 3.1-like            209   2e-58    
ref|XP_006444002.1|  hypothetical protein CICLE_v10019207mg             209   2e-58    
ref|XP_002307605.1|  Sulfate transporter 3.2 family protein             209   2e-58    
emb|CAD55701.1|  sulphate transporter                                   209   2e-58    
gb|EYU39155.1|  hypothetical protein MIMGU_mgv1a002721mg                209   3e-58    
emb|CBI26298.3|  unnamed protein product                                209   3e-58    
dbj|BAK00729.1|  predicted protein                                      209   3e-58    
emb|CAD55702.1|  sulphate transporter                                   209   3e-58    
ref|XP_008677620.1|  PREDICTED: uncharacterized protein LOC100383...    206   3e-58    
emb|CAD54674.1|  sulphate transporter                                   209   4e-58    
emb|CAD55698.1|  sulphate transporter                                   209   4e-58    
gb|KDO80894.1|  hypothetical protein CISIN_1g006132mg                   209   4e-58    
gb|EMS54293.1|  High affinity sulfate transporter 2                     209   4e-58    
ref|XP_007144655.1|  hypothetical protein PHAVU_007G174100g             209   4e-58    
gb|KHG29534.1|  Sulfate transporter 3                                   209   4e-58    
gb|KHG01733.1|  Sulfate transporter 3                                   209   4e-58    
ref|XP_003518908.2|  PREDICTED: sulfate transporter 3.1-like            208   5e-58    
ref|XP_010261215.1|  PREDICTED: sulfate transporter 1.3-like            208   5e-58    
ref|XP_004146971.1|  PREDICTED: sulfate transporter 3.1-like            208   5e-58    
gb|KHN03817.1|  Sulfate transporter 3.1                                 208   5e-58    
ref|XP_003521258.1|  PREDICTED: sulfate transporter 3.1-like            208   6e-58    
ref|XP_003536673.1|  PREDICTED: sulfate transporter 3.1-like            208   6e-58    
ref|XP_009392358.1|  PREDICTED: sulfate transporter 3.1-like            208   6e-58    
ref|XP_011026121.1|  PREDICTED: sulfate transporter 3.1-like            208   6e-58    
ref|XP_003590594.1|  Sulfate/bicarbonate/oxalate exchanger and tr...    208   6e-58    
ref|XP_002300821.2|  Sulfate transporter 3.2 family protein             208   7e-58    
ref|XP_006434033.1|  hypothetical protein CICLE_v10000528mg             208   7e-58    
ref|XP_003532966.1|  PREDICTED: high affinity sulfate transporter...    208   8e-58    
emb|CBA11528.1|  sulphate transporter                                   208   9e-58    
gb|EYU36528.1|  hypothetical protein MIMGU_mgv1a002617mg                207   9e-58    
ref|XP_003554265.1|  PREDICTED: sulfate transporter 3.1-like            207   1e-57    
ref|XP_009609980.1|  PREDICTED: sulfate transporter 3.1-like            207   1e-57    
ref|XP_009103200.1|  PREDICTED: probable sulfate transporter 3.3 ...    206   1e-57    
ref|XP_010234741.1|  PREDICTED: sulfate transporter 3.1-like            207   1e-57    
ref|XP_006649560.1|  PREDICTED: sulfate transporter 1.2-like isof...    207   1e-57    
ref|XP_006649559.1|  PREDICTED: sulfate transporter 1.2-like isof...    207   1e-57    
gb|AGI96997.1|  putative high-affinity sulfate transporter              207   2e-57    
ref|XP_010105878.1|  Sulfate transporter 1.3                            207   2e-57    
ref|XP_011098138.1|  PREDICTED: sulfate transporter 1.2-like            206   2e-57    
ref|XP_010259124.1|  PREDICTED: sulfate transporter 3.1-like            206   2e-57    
gb|KHN33509.1|  High affinity sulfate transporter 2                     206   3e-57    
ref|XP_009371954.1|  PREDICTED: sulfate transporter 3.1-like            206   3e-57    
ref|XP_004140373.1|  PREDICTED: sulfate transporter 1.3-like            206   3e-57    
ref|XP_010030061.1|  PREDICTED: sulfate transporter 1.3-like            206   3e-57    
gb|EAZ06949.1|  hypothetical protein OsI_29191                          206   3e-57    
ref|XP_009405950.1|  PREDICTED: sulfate transporter 3.1-like            206   3e-57    
ref|XP_006360746.1|  PREDICTED: sulfate transporter 3.1-like            206   3e-57    
ref|XP_004985351.1|  PREDICTED: sulfate transporter 1.2-like isof...    206   3e-57    
ref|XP_009419196.1|  PREDICTED: sulfate transporter 3.1-like            206   3e-57    
gb|EPS63999.1|  hypothetical protein M569_10782                         206   3e-57    
emb|CDO97472.1|  unnamed protein product                                206   4e-57    
ref|XP_004985349.1|  PREDICTED: sulfate transporter 1.2-like isof...    206   4e-57    
gb|KJB46949.1|  hypothetical protein B456_008G002800                    206   4e-57    
gb|ACG46907.1|  sulfate transporter 1.2                                 206   4e-57    
dbj|BAC98594.1|  putative high affinity sulfate transporter             206   4e-57    
ref|XP_004247192.1|  PREDICTED: sulfate transporter 3.1                 206   4e-57    
ref|XP_008677618.1|  PREDICTED: uncharacterized protein LOC100383...    206   5e-57    
ref|XP_004301997.1|  PREDICTED: sulfate transporter 1.3-like            206   5e-57    
gb|ABM17059.2|  sulfate transporter                                     205   7e-57    
ref|XP_010664070.1|  PREDICTED: sulfate transporter isoform X1          205   8e-57    
ref|XP_004985613.1|  PREDICTED: sulfate transporter 3.1-like            205   8e-57    
ref|XP_004247591.1|  PREDICTED: sulfate transporter 3.1-like            205   8e-57    
ref|XP_010030063.1|  PREDICTED: sulfate transporter 1.3-like            205   1e-56    
ref|NP_001049261.1|  Os03g0196000                                       205   1e-56    
gb|EAZ25923.1|  hypothetical protein OsJ_09766                          204   1e-56    
ref|XP_010667626.1|  PREDICTED: sulfate transporter 1.2-like isof...    205   1e-56    
ref|XP_007162459.1|  hypothetical protein PHAVU_001G154200g             204   1e-56    
ref|XP_010024227.1|  PREDICTED: sulfate transporter 3.1-like            204   1e-56    
ref|XP_010667625.1|  PREDICTED: sulfate transporter 1.2-like isof...    205   1e-56    
gb|EMS55614.1|  Sulfate transporter 1.2                                 204   2e-56    
gb|EMT11843.1|  High affinity sulfate transporter 2                     204   3e-56    
emb|CAD54673.1|  sulphate transporter                                   204   3e-56    
ref|XP_010917827.1|  PREDICTED: sulfate transporter 3.1-like            194   3e-56    
ref|XP_008390998.1|  PREDICTED: sulfate transporter 3.1-like isof...    202   3e-56    
ref|XP_004490362.1|  PREDICTED: sulfate transporter 1.3-like isof...    203   3e-56    
emb|CAD55697.1|  sulphate transporter                                   204   3e-56    
ref|XP_003574460.1|  PREDICTED: sulfate transporter 1.2                 203   4e-56    
ref|XP_004495176.1|  PREDICTED: sulfate transporter 3.1-like            203   4e-56    
gb|KEH36439.1|  high affinity sulfate transporter type 1                203   4e-56    
gb|AES63416.2|  high affinity sulfate transporter type 1                203   4e-56    
gb|EMT20443.1|  High affinity sulfate transporter 2                     203   4e-56    
ref|XP_010556774.1|  PREDICTED: sulfate transporter 3.2 isoform X1      203   5e-56    
emb|CAD55700.1|  sulphate transporter                                   203   5e-56    
gb|KHN41502.1|  Sulfate transporter 1.3                                 203   5e-56    
ref|XP_003614968.1|  Sulfate transporter                                203   5e-56    
ref|XP_009362511.1|  PREDICTED: sulfate transporter 1.3-like            203   6e-56    
gb|ACN39795.1|  unknown                                                 203   6e-56    
ref|XP_010088847.1|  putative sulfate transporter 3.4                   202   6e-56    
ref|XP_002980841.1|  hypothetical protein SELMODRAFT_113596             202   6e-56    
ref|XP_011087851.1|  PREDICTED: sulfate transporter 1.3-like isof...    202   7e-56    
emb|CAB42986.1|  putative high affinity sulfate transporter             202   7e-56    
emb|CAD55696.1|  sulphate transporter                                   202   7e-56    
ref|XP_003547605.1|  PREDICTED: high affinity sulfate transporter...    202   8e-56    
ref|XP_002534156.1|  sulfate transporter, putative                      202   8e-56    
ref|XP_003593165.1|  Sulfate transporter                                203   8e-56    
ref|XP_010455991.1|  PREDICTED: sulfate transporter 3.2-like            201   9e-56    
ref|XP_006341835.1|  PREDICTED: sulfate transporter 1.3                 202   1e-55    
ref|NP_001275426.1|  high affinity sulfate transporter type 1           202   1e-55    
ref|XP_012078104.1|  PREDICTED: sulfate transporter 1.3-like            202   1e-55    
gb|KDP32700.1|  hypothetical protein JCGZ_11992                         201   1e-55    
ref|XP_007141140.1|  hypothetical protein PHAVU_008G170800g             202   1e-55    
ref|XP_008390997.1|  PREDICTED: sulfate transporter 3.1-like isof...    202   1e-55    
sp|P53391.1|SUT1_STYHA  RecName: Full=High affinity sulfate trans...    202   2e-55    
sp|P53392.1|SUT2_STYHA  RecName: Full=High affinity sulfate trans...    202   2e-55    
ref|XP_011074140.1|  PREDICTED: sulfate transporter 1.3                 201   2e-55    
ref|XP_011087852.1|  PREDICTED: sulfate transporter 1.3-like isof...    201   2e-55    
gb|AAK62820.1|  high affinity sulfate transporter                       201   2e-55    
ref|XP_010679106.1|  PREDICTED: sulfate transporter 3.1                 201   2e-55    
ref|XP_010327388.1|  PREDICTED: sulfate transporter 1 isoform X1        201   2e-55    
ref|XP_003543770.2|  PREDICTED: sulfate transporter 1.3-like isof...    201   2e-55    
tpg|DAA43466.1|  TPA: hypothetical protein ZEAMMB73_358631              195   2e-55    
emb|CBK55663.1|  sulphate transporter                                   201   3e-55    
ref|XP_007043016.1|  Sulfate transporter 1,3 isoform 1                  201   4e-55    
ref|XP_004485559.1|  PREDICTED: high affinity sulfate transporter...    200   4e-55    
ref|XP_002989364.1|  hypothetical protein SELMODRAFT_184503             200   5e-55    
ref|XP_008460486.1|  PREDICTED: sulfate transporter 1.2-like isof...    197   6e-55    
emb|CBK55660.1|  sulphate transporter                                   200   6e-55    
ref|XP_010269183.1|  PREDICTED: sulfate transporter 1.2-like            199   8e-55    
emb|CBK55651.1|  sulphate transporter                                   199   1e-54    
emb|CAN61401.1|  hypothetical protein VITISV_011489                     199   1e-54    
ref|NP_001234565.1|  sulfate transporter 1                              199   1e-54    
ref|XP_004493701.1|  PREDICTED: sulfate transporter 3.1-like            199   2e-54    
ref|NP_192179.1|  sulfate transporter 3.2                               199   2e-54    
ref|XP_010430049.1|  PREDICTED: sulfate transporter 3.2 isoform X1      198   2e-54    
ref|XP_010430059.1|  PREDICTED: sulfate transporter 3.2 isoform X2      198   2e-54    
ref|XP_010521202.1|  PREDICTED: sulfate transporter 1.2-like            198   2e-54    
ref|XP_011091968.1|  PREDICTED: probable sulfate transporter 3.5        198   3e-54    
gb|KFK32123.1|  hypothetical protein AALP_AA6G201100                    198   3e-54    
ref|XP_006352762.1|  PREDICTED: sulfate transporter 3.1-like            198   3e-54    
gb|KJB79699.1|  hypothetical protein B456_013G062700                    198   3e-54    
ref|XP_004242345.1|  PREDICTED: sulfate transporter 3.1-like            198   3e-54    
gb|KJB79700.1|  hypothetical protein B456_013G062700                    198   3e-54    
ref|XP_011092411.1|  PREDICTED: sulfate transporter 1.3-like            198   3e-54    
ref|XP_008361631.1|  PREDICTED: sulfate transporter 1.2-like            198   4e-54    
gb|KJB32009.1|  hypothetical protein B456_005G218600                    197   4e-54    
ref|XP_008460483.1|  PREDICTED: sulfate transporter 1.3-like isof...    197   5e-54    



>ref|XP_009762498.1| PREDICTED: probable sulfate transporter 3.3, partial [Nicotiana 
sylvestris]
Length=315

 Score =   382 bits (981),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 214/233 (92%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILGAIIVTAV+GLIDI AAY IWK+DKFDF+VLLCAFFGV FISVQ+GLAI
Sbjct  86   PLFQYTPNVILGAIIVTAVIGLIDISAAYQIWKIDKFDFVVLLCAFFGVIFISVQDGLAI  145

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQITRPKT+MLGNIPGT IYR+LDHYKEA++ PGFLILSIEAP+NF NTT
Sbjct  146  AVGISIFKVLLQITRPKTVMLGNIPGTRIYRNLDHYKEALSVPGFLILSIEAPINFANTT  205

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRW+   E E  +TKKQS+L++VVLD+SA+SAIDTSGIS FKDL M LEKK +E
Sbjct  206  YLKERISRWM--EEYESGETKKQSELKYVVLDLSAVSAIDTSGISLFKDLSMVLEKKSLE  263

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNP+GEVLEKLQRA++TKD++ +D LFLTVGEAV+++SSTIK+Q+PA HV
Sbjct  264  LVLVNPIGEVLEKLQRADDTKDMMGTDCLFLTVGEAVASVSSTIKYQIPA-HV  315



>ref|XP_009592943.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Nicotiana 
tomentosiformis]
Length=435

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 213/233 (91%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNVILGAIIVTAV+GLIDI AAY IWK+DKFDFIVLLCAFFGV FISVQNGLAI
Sbjct  206  PLFKYTPNVILGAIIVTAVIGLIDISAAYQIWKIDKFDFIVLLCAFFGVIFISVQNGLAI  265

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQITRPKT++LGNIPGT IYR+LDHYKEA++ PGFLILSIEAP+NF NTT
Sbjct  266  AVGISIFKVLLQITRPKTVLLGNIPGTRIYRNLDHYKEALSVPGFLILSIEAPINFANTT  325

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRW+   E E  +TKKQS+LR+VVLD+SA+SAIDTSGIS FKDLRM LEKK +E
Sbjct  326  YLKERISRWM--EEYESGETKKQSELRYVVLDLSAVSAIDTSGISLFKDLRMVLEKKSLE  383

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNP+GEVLEKLQRA++TKD++  D LFLTVGEAV++LS+TIK+Q+P  HV
Sbjct  384  LVLVNPIGEVLEKLQRADDTKDMMGPDCLFLTVGEAVASLSTTIKYQIPT-HV  435



>ref|XP_009592942.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Nicotiana 
tomentosiformis]
Length=447

 Score =   382 bits (980),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 213/233 (91%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNVILGAIIVTAV+GLIDI AAY IWK+DKFDFIVLLCAFFGV FISVQNGLAI
Sbjct  218  PLFKYTPNVILGAIIVTAVIGLIDISAAYQIWKIDKFDFIVLLCAFFGVIFISVQNGLAI  277

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQITRPKT++LGNIPGT IYR+LDHYKEA++ PGFLILSIEAP+NF NTT
Sbjct  278  AVGISIFKVLLQITRPKTVLLGNIPGTRIYRNLDHYKEALSVPGFLILSIEAPINFANTT  337

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRW+   E E  +TKKQS+LR+VVLD+SA+SAIDTSGIS FKDLRM LEKK +E
Sbjct  338  YLKERISRWM--EEYESGETKKQSELRYVVLDLSAVSAIDTSGISLFKDLRMVLEKKSLE  395

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNP+GEVLEKLQRA++TKD++  D LFLTVGEAV++LS+TIK+Q+P  HV
Sbjct  396  LVLVNPIGEVLEKLQRADDTKDMMGPDCLFLTVGEAVASLSTTIKYQIPT-HV  447



>ref|XP_009604001.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tomentosiformis]
Length=648

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 213/231 (92%), Gaps = 0/231 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLIDIPAAY IWK+DKFDF+VLLCAFFGV FISVQNGLAI
Sbjct  417  PLFQYTPNVVLGAIIVTAVVGLIDIPAAYQIWKIDKFDFLVLLCAFFGVIFISVQNGLAI  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+GISI KVLLQITRPKT+MLGNIPGTGIYR+LDHYKEA++ PGFLILSIEAP+NF N T
Sbjct  477  AIGISILKVLLQITRPKTVMLGNIPGTGIYRNLDHYKEAMSVPGFLILSIEAPINFANAT  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRWIE+Y+AE  + KKQS LRFVVLD+SA++AIDTSG+S FKDL M LEKKG+E
Sbjct  537  YLKERISRWIEDYDAEGGKNKKQSGLRFVVLDLSAVTAIDTSGVSLFKDLSMALEKKGLE  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPAD  242
             VLVNPLGEVLEKLQRA+ETKD+++ D LFLTV EAV++LSSTIK+Q+P +
Sbjct  597  FVLVNPLGEVLEKLQRADETKDMMRPDCLFLTVEEAVASLSSTIKYQIPDN  647



>ref|XP_009802339.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana sylvestris]
Length=648

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 212/231 (92%), Gaps = 0/231 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAAY IWK+DKFDF+VLLCAFFGV FISVQNGLAI
Sbjct  417  PLFQYTPNVVLGAIIVTAVVGLIDVPAAYQIWKIDKFDFLVLLCAFFGVIFISVQNGLAI  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+GISI KVLLQITRPKT+MLGNIPGTGIYR+LDHYKEA++ PGFLILSIEAP+NF N T
Sbjct  477  AIGISILKVLLQITRPKTVMLGNIPGTGIYRNLDHYKEAMSVPGFLILSIEAPINFANAT  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRWIE+Y+AE  + KKQS LRFVVLD+SA++AIDTSG+S FKDL M +EKKG E
Sbjct  537  YLKERISRWIEDYDAEGGKNKKQSGLRFVVLDLSAVTAIDTSGVSLFKDLSMAMEKKGFE  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPAD  242
             VLVNP+GEVLEKLQRA+ETKD+++ D LFLTV EAV++LSSTIK+Q+P +
Sbjct  597  FVLVNPIGEVLEKLQRADETKDMMRPDCLFLTVEEAVASLSSTIKYQIPDN  647



>ref|XP_006355098.1| PREDICTED: probable sulfate transporter 3.3-like [Solanum tuberosum]
Length=645

 Score =   358 bits (920),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 207/233 (89%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA+ IWK+DKFDF+VLLCAFFGV FISVQ+GLAI
Sbjct  416  PLFQYTPNVVLGAIIVTAVIGLIDIPAAFQIWKIDKFDFLVLLCAFFGVIFISVQDGLAI  475

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+GISI KVL+QITRPKT+MLGNIPGTGIYR++DHYKEA++  GFLILSIEAP+NF N T
Sbjct  476  AIGISILKVLMQITRPKTVMLGNIPGTGIYRNVDHYKEAMSVAGFLILSIEAPINFANVT  535

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRWI   + EEE  KKQS LR VVLD+S +SAIDTSGIS FKDL M LEKKG+E
Sbjct  536  YLKERISRWI--QDYEEEGAKKQSGLRVVVLDLSPVSAIDTSGISLFKDLSMALEKKGLE  593

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
             VLVNP+GEV+EKLQRA+ETK++++   LFLTV EAV +LSST+K+Q+P +HV
Sbjct  594  FVLVNPIGEVMEKLQRADETKNLMRPGVLFLTVDEAVGSLSSTVKYQLP-EHV  645



>ref|XP_004238829.1| PREDICTED: probable sulfate transporter 3.3 [Solanum lycopersicum]
Length=645

 Score =   357 bits (917),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 208/233 (89%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA+ IWK+DKFDF+VLLCAFFGV F+SVQ+GLAI
Sbjct  416  PLFQYTPNVVLGAIIVTAVIGLIDIPAAFQIWKIDKFDFLVLLCAFFGVIFVSVQDGLAI  475

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+GIS+ KVL+QITRPKT+MLGNIPGTGIYR++DHY+EA++  GFLILSIEAP+NF N T
Sbjct  476  AIGISMLKVLMQITRPKTVMLGNIPGTGIYRNVDHYEEALSVAGFLILSIEAPINFANVT  535

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERISRWI   + EEE  KKQ  LR VVLD+S +S+IDTSGIS FKDL M LEKKG+E
Sbjct  536  YLKERISRWI--QDYEEEGAKKQPGLRVVVLDLSPVSSIDTSGISLFKDLSMALEKKGLE  593

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
             VLVNP+GEV+EKLQRA+ETKD+++ D LFLTV EAV++LSST+K+Q+P +HV
Sbjct  594  FVLVNPIGEVMEKLQRADETKDLMRPDVLFLTVEEAVASLSSTVKYQIP-EHV  645



>ref|XP_007045150.1| Sulfate transporter 91 [Theobroma cacao]
 gb|EOY00982.1| Sulfate transporter 91 [Theobroma cacao]
Length=652

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 203/233 (87%), Gaps = 2/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAAY IWK+DKFDFIV+LCAFFGV FISVQ+GLAI
Sbjct  421  PLFQYTPNVVLGAIIVSAVVGLIDIPAAYQIWKIDKFDFIVMLCAFFGVIFISVQDGLAI  480

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRPKT+MLGNIPGT IYR+L HYKE++  PGFLILS+EAP+NF N+T
Sbjct  481  AVGISIFKILLQITRPKTVMLGNIPGTDIYRNLHHYKESMKIPGFLILSVEAPINFANST  540

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW+ E    EE  KKQS LRFV+L+MSA+SAIDTSG+S  K+L+  +EKKGVE
Sbjct  541  YLNERILRWV-EDYEAEEDLKKQSSLRFVILEMSAVSAIDTSGVSLIKELKKAMEKKGVE  599

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQ+++E  D +  DSLFLTVGEAV+ LSSTIK Q  ++HV
Sbjct  600  LVLVNPLGEVMEKLQKSDEAGDFMGPDSLFLTVGEAVTTLSSTIKGQ-SSNHV  651



>gb|KDO64646.1| hypothetical protein CISIN_1g006141mg [Citrus sinensis]
Length=659

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAA+ IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  429  PLFQYTPNVVLGAIIVTAVVGLIDVPAAHQIWKIDKFDFLVMLCAFLGVVFISVQEGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRPKT+MLGN+PG+ IYRDL HY EAI  PGFLILSIEAP+NF NTT
Sbjct  489  AVGISIFKILLQITRPKTVMLGNMPGSDIYRDLHHYNEAIRIPGFLILSIEAPINFANTT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI E    EE   KQS LRFV+L+MSA+SAIDTSG SFFKDLR  +EKKGVE
Sbjct  549  YLNERILRWI-EEYEAEENLNKQSSLRFVILEMSAVSAIDTSGTSFFKDLRKAMEKKGVE  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNPL EVLEKLQR++++ D  + DSL+LTVGEAV++LSSTIK
Sbjct  608  LVLVNPLAEVLEKLQRSDDSGDFKRPDSLYLTVGEAVASLSSTIK  652



>ref|XP_006469182.1| PREDICTED: probable sulfate transporter 3.3-like [Citrus sinensis]
Length=659

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAA+ IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  429  PLFQYTPNVVLGAIIVTAVVGLIDVPAAHQIWKIDKFDFLVMLCAFLGVVFISVQEGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRPKT+MLGN+PG+ IYRDL HY EAI  PGFLILSIEAP+NF NTT
Sbjct  489  AVGISIFKILLQITRPKTVMLGNMPGSDIYRDLHHYNEAIRIPGFLILSIEAPINFANTT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI E    EE   KQS LRFV+L+MSA+SAIDTSG SFFKDLR  +EKKGVE
Sbjct  549  YLNERILRWI-EEYEAEENLNKQSSLRFVILEMSAVSAIDTSGTSFFKDLRKAMEKKGVE  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNPL EVLEKLQR++++ D  + DSL+LTVGEAV++LSSTIK
Sbjct  608  LVLVNPLAEVLEKLQRSDDSGDFKRPDSLYLTVGEAVASLSSTIK  652



>ref|XP_006448250.1| hypothetical protein CICLE_v10014538mg [Citrus clementina]
 gb|ESR61490.1| hypothetical protein CICLE_v10014538mg [Citrus clementina]
Length=659

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAA+ IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  429  PLFQYTPNVVLGAIIVTAVVGLIDVPAAHQIWKIDKFDFLVMLCAFLGVVFISVQEGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRPKT+MLGN+PG+ IYRDL HY EAI  PGFLILSIEAP+NF NTT
Sbjct  489  AVGISIFKILLQITRPKTVMLGNMPGSDIYRDLHHYNEAIRIPGFLILSIEAPINFANTT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI E    EE   KQS LRFV+L+MSA+SAIDTSG SFFKDLR  +EKKGVE
Sbjct  549  YLNERILRWI-EEYEAEENLNKQSSLRFVILEMSAVSAIDTSGTSFFKDLRKAMEKKGVE  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNPL EVLEKLQR++++ D  + DSL+LTVGEAV++LSSTIK
Sbjct  608  LVLVNPLAEVLEKLQRSDDSGDFKRPDSLYLTVGEAVASLSSTIK  652



>gb|KHF99906.1| putative sulfate transporter 3.3 -like protein [Gossypium arboreum]
Length=408

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 201/233 (86%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  178  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  237

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+L QITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  238  AVGMSIFKILQQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  297

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI   E E E  KKQS L+FVVL MSA+S IDTSG+S FK+L+ T+EKKG E
Sbjct  298  YLNERILRWI--EEYEAEDHKKQSSLQFVVLVMSAVSTIDTSGVSIFKELKKTVEKKGAE  355

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQ+++E  D ++ D LFLTVGEAV+ L++TIK QV ++HV
Sbjct  356  LVLVNPLGEVMEKLQKSDEAGDFMRPDCLFLTVGEAVATLTATIKSQV-SNHV  407



>ref|XP_010044186.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Eucalyptus 
grandis]
Length=637

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAAYS+WK+DKFDF+V+LCAF GV FISVQ+GLA 
Sbjct  407  PLFQYTPNVVLGAIIVTAVIGLIDIPAAYSVWKIDKFDFVVMLCAFLGVIFISVQDGLAF  466

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQITRPKT++LGNIPGT IYR+L HY+EA+  PGFLILS+EAP+NF N+T
Sbjct  467  AVGISLFKILLQITRPKTVILGNIPGTDIYRNLHHYEEAMRVPGFLILSVEAPINFANST  526

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIE++E EE++ K+QS LRFVVLD+SA+SAIDTSG+S  KDLR  ++KKG E
Sbjct  527  YLNERILRWIEDHETEEDE-KQQSTLRFVVLDLSAVSAIDTSGVSLLKDLRKAMDKKGAE  585

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPLGEV+EKLQRA+E +D+++ D+L+LTVGEAV+ LSS+IK Q
Sbjct  586  LVLVNPLGEVMEKLQRADEGQDLLRPDNLYLTVGEAVAFLSSSIKAQ  632



>gb|KDP38061.1| hypothetical protein JCGZ_04704 [Jatropha curcas]
Length=448

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPN++LGAIIVTAVVGLIDIPAAY IWK+DK+DFIVLLCAFFGV FISVQ GLAI
Sbjct  218  PLFQYTPNLVLGAIIVTAVVGLIDIPAAYLIWKIDKYDFIVLLCAFFGVIFISVQIGLAI  277

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRPKT +LGNI GT IYR++ HYKEAI  PGF+ILSIEAP+NF NTT
Sbjct  278  AVGISVFKILLQVTRPKTAILGNIAGTDIYRNIHHYKEAIMVPGFIILSIEAPINFANTT  337

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI E    +E  KKQ+   FV+LD++A+SAIDT+G+S F DL+ T+E +G+E
Sbjct  338  YLKERILRWI-EEYEAQEDAKKQASSHFVILDLTAVSAIDTTGVSLFMDLKKTMENRGIE  396

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEV+EKLQRA++ ++I+K+++L+L+VGEAV+ALSSTIK Q
Sbjct  397  LVLVNPVGEVIEKLQRADDARNIMKAETLYLSVGEAVAALSSTIKGQ  443



>ref|XP_010044185.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW86221.1| hypothetical protein EUGRSUZ_B02908 [Eucalyptus grandis]
Length=659

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 205/227 (90%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAAYS+WK+DKFDF+V+LCAF GV FISVQ+GLA 
Sbjct  429  PLFQYTPNVVLGAIIVTAVIGLIDIPAAYSVWKIDKFDFVVMLCAFLGVIFISVQDGLAF  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQITRPKT++LGNIPGT IYR+L HY+EA+  PGFLILS+EAP+NF N+T
Sbjct  489  AVGISLFKILLQITRPKTVILGNIPGTDIYRNLHHYEEAMRVPGFLILSVEAPINFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIE++E EE++ K+QS LRFVVLD+SA+SAIDTSG+S  KDLR  ++KKG E
Sbjct  549  YLNERILRWIEDHETEEDE-KQQSTLRFVVLDLSAVSAIDTSGVSLLKDLRKAMDKKGAE  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPLGEV+EKLQRA+E +D+++ D+L+LTVGEAV+ LSS+IK Q
Sbjct  608  LVLVNPLGEVMEKLQRADEGQDLLRPDNLYLTVGEAVAFLSSSIKAQ  654



>gb|KJB15435.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=652

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 203/233 (87%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LLQITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AVGMSIFKILLQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI   E E E  KKQS L+FVVL MSA+SAIDTSG+S FK+L+ T+EKKG E
Sbjct  542  YLNERILRWI--EEYEAEDHKKQSSLQFVVLVMSAVSAIDTSGVSIFKELKKTVEKKGAE  599

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQ+++E  D ++ D LFLTVGEAV+ L++TIK QV ++HV
Sbjct  600  LVLVNPLGEVMEKLQKSDEAGDFMRPDCLFLTVGEAVATLTATIKSQV-SNHV  651



>ref|XP_002526028.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF36368.1| sulfate transporter, putative [Ricinus communis]
Length=652

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/233 (72%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPA+Y IWK+DK+DFIVLLCAFFGV FISVQ GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDIPASYYIWKIDKYDFIVLLCAFFGVIFISVQEGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQ+TRPKT++LGNIP T IYRDL  YKEA+  PGFLILSIEAP+NF NTT
Sbjct  482  AVGISIFKVLLQVTRPKTLILGNIPRTDIYRDLHQYKEALMVPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI E    +E +K+QS + +V++D+SA+SAIDT+G+S FKDL+ T++ +G E
Sbjct  542  YLKERILRWI-EEYEPQEDSKEQSSIHYVIIDLSAVSAIDTTGVSLFKDLKKTMDSRGTE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQRA++ + I+K D+L+LTVGEAV ALSST+K Q  + HV
Sbjct  601  LVLVNPLGEVMEKLQRADDARGIMKPDTLYLTVGEAVVALSSTMKGQT-SSHV  652



>ref|XP_006379763.1| hypothetical protein POPTR_0008s12940g [Populus trichocarpa]
 gb|ERP57560.1| hypothetical protein POPTR_0008s12940g [Populus trichocarpa]
Length=652

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 197/227 (87%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID PAA  IWK+DKFDF+V+LCAFFGV FISVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDFPAACQIWKIDKFDFVVMLCAFFGVIFISVQDGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYK+A   PGFLILSIEAP+NF NTT
Sbjct  482  AVAISIFKILLQVTRPKTLILGNIPGTDIFRNLHHYKDATRIPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI      EE  KKQS +RF++LD+SA+SAIDTSG+S FKDL+  +E KGVE
Sbjct  542  YLKERIVRWI-NEYETEEDIKKQSSIRFLILDLSAVSAIDTSGVSLFKDLKKAVENKGVE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEVLEKL RA++ +DI+  D+L+LTVGEAV+ALSST+K Q
Sbjct  601  LVLVNPVGEVLEKLLRADDARDIMGPDTLYLTVGEAVAALSSTMKGQ  647



>ref|XP_012072227.1| PREDICTED: probable sulfate transporter 3.3 [Jatropha curcas]
Length=654

 Score =   340 bits (873),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPN++LGAIIVTAVVGLIDIPAAY IWK+DK+DFIVLLCAFFGV FISVQ GLAI
Sbjct  424  PLFQYTPNLVLGAIIVTAVVGLIDIPAAYLIWKIDKYDFIVLLCAFFGVIFISVQIGLAI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRPKT +LGNI GT IYR++ HYKEAI  PGF+ILSIEAP+NF NTT
Sbjct  484  AVGISVFKILLQVTRPKTAILGNIAGTDIYRNIHHYKEAIMVPGFIILSIEAPINFANTT  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI E    +E  KKQ+   FV+LD++A+SAIDT+G+S F DL+ T+E +G+E
Sbjct  544  YLKERILRWI-EEYEAQEDAKKQASSHFVILDLTAVSAIDTTGVSLFMDLKKTMENRGIE  602

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEV+EKLQRA++ ++I+K+++L+L+VGEAV+ALSSTIK Q
Sbjct  603  LVLVNPVGEVIEKLQRADDARNIMKAETLYLSVGEAVAALSSTIKGQ  649



>gb|ABK35747.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=587

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID PAA  IWK+DKFDF+V+LCAFFGV FISVQ+GLAI
Sbjct  357  PLFQYTPNVVLGAIIVTAVIGLIDFPAACQIWKIDKFDFVVMLCAFFGVIFISVQDGLAI  416

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYK+A   PGFLILSIEAP+NF NTT
Sbjct  417  AVAISIFKILLQVTRPKTLILGNIPGTDIFRNLHHYKDATRIPGFLILSIEAPINFANTT  476

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI      EE  KKQS + F++LD+SA+SAIDTSG+S F+DL+   E KGVE
Sbjct  477  YLKERILRWI-NEYETEEDIKKQSSIHFLILDLSAVSAIDTSGVSLFEDLKKAAESKGVE  535

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEVLEKL RA++ +DI+  D+L+LTVGEAV+ALSST+K Q
Sbjct  536  LVLVNPVGEVLEKLIRADDARDIMGPDTLYLTVGEAVAALSSTMKGQ  582



>ref|XP_002314803.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
 gb|EEF00974.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
Length=652

 Score =   339 bits (869),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 201/233 (86%), Gaps = 2/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IWK+DKFDF+V+LCAFFGV  +SVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWKIDKFDFVVMLCAFFGVILVSVQDGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYKEA+  PGFLILSIEAP+NF NTT
Sbjct  482  AVGISIFKILLQVTRPKTLVLGNIPGTDIFRNLHHYKEAMRIPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI +    EE TK+QS + F++LD+SA+S+IDTSG+S  KDL+  LE  G E
Sbjct  542  YLKERILRWI-DEYETEEDTKRQSSIHFLILDLSAVSSIDTSGVSLLKDLKKALENTGAE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNP GEVLEKLQRA++ +D++  D+L+LTVGEAV+ALSST+K +  ++HV
Sbjct  601  LVLVNPGGEVLEKLQRADDVRDVMSPDALYLTVGEAVAALSSTMKGR-SSNHV  652



>gb|KJB50368.1| hypothetical protein B456_008G166800 [Gossypium raimondii]
Length=653

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 197/231 (85%), Gaps = 0/231 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLI IPAAY +WK+DKFDF+V+LCAFFGV FISVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIGIPAAYHVWKMDKFDFVVMLCAFFGVIFISVQHGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +SIFK+L+QITRPKT++LG IPGT IYRDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AVAVSIFKILMQITRPKTVLLGKIPGTDIYRDLHHYKESVKIPGFLILSIEAPINFANST  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER+ RWIEEYEAE+ +    S LRFV+L+MS +S IDTSG+SFFK+L+ T+E KGVE
Sbjct  542  YLNERVLRWIEEYEAEDPKMHSNSSLRFVILEMSTVSTIDTSGVSFFKELKQTMENKGVE  601

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPAD  242
            LVLVN +GEV+EKLQR+ E  D +K D LFLTVGEAV+ LS+TIK Q   D
Sbjct  602  LVLVNLVGEVMEKLQRSNEAGDFMKPDCLFLTVGEAVATLSATIKSQSSND  652



>ref|XP_011038634.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
Length=652

 Score =   338 bits (868),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IWK+DKFDFIV+LCAFFGV  +SVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWKIDKFDFIVMLCAFFGVILVSVQDGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYKEA+  PGF ILSIEAPVNF NTT
Sbjct  482  AVGISIFKILLQVTRPKTVVLGNIPGTDIFRNLHHYKEAMRIPGFFILSIEAPVNFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI +    EE TK+QS + F++LD+SA+S+IDTSG+S  KDLR  LE  G E
Sbjct  542  YLKERILRWI-DEYETEEDTKRQSSIHFLILDLSAVSSIDTSGVSLLKDLRKALENTGAE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+GEVLEKLQRA++  D++  D+L+LTVGEAV+ALSST+K
Sbjct  601  LVLVNPVGEVLEKLQRADDVCDVMSPDALYLTVGEAVAALSSTMK  645



>gb|KJB15439.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=649

 Score =   338 bits (866),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 201/233 (86%), Gaps = 6/233 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LLQITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AVGMSIFKILLQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL E   RWI   E E E  KKQS L+FVVL MSA+SAIDTSG+S FK+L+ T+EKKG E
Sbjct  542  YLNE---RWI--EEYEAEDHKKQSSLQFVVLVMSAVSAIDTSGVSIFKELKKTVEKKGAE  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQ+++E  D ++ D LFLTVGEAV+ L++TIK QV ++HV
Sbjct  597  LVLVNPLGEVMEKLQKSDEAGDFMRPDCLFLTVGEAVATLTATIKSQV-SNHV  648



>gb|ABK35748.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=620

 Score =   337 bits (863),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 197/225 (88%), Gaps = 1/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IW++DKFDF+V+LCAFFGVTF+SVQ+GLAI
Sbjct  390  PLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWRIDKFDFVVMLCAFFGVTFVSVQDGLAI  449

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQ+TRPKT++LG+IPGT I+R+  HYKEA+  PGFLILSIEAP+NF NTT
Sbjct  450  AVGISIFKILLQVTRPKTVVLGDIPGTDIFRNFHHYKEAMRIPGFLILSIEAPINFANTT  509

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLK RI RWI +    EE TK+QS + F++LD+SA+S+IDTSG+S  KDL+  LE  G E
Sbjct  510  YLKVRILRWI-DEYETEEDTKRQSSIHFLILDLSAVSSIDTSGVSLLKDLKKALENTGAE  568

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+GEVLEKLQRA++ +D++  D+L+LTVGEAV+ALSST+K
Sbjct  569  LVLVNPVGEVLEKLQRADDVRDVMSPDALYLTVGEAVAALSSTVK  613



>gb|ABK35746.2| sulfate transporter [Populus tremula x Populus alba]
Length=652

 Score =   337 bits (865),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID PAA  IWK+DKFDF+V+LCAFFGV FISVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDFPAACQIWKIDKFDFVVMLCAFFGVVFISVQDGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYK+A   PGFLILSIEAP+NF NTT
Sbjct  482  AVAISIFKILLQVTRPKTLVLGNIPGTDIFRNLHHYKDATRIPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI      EE  KKQS + F++LD+SA+SAIDTSG+S FKDL+  +E KGVE
Sbjct  542  YLKERILRWI-NEYETEEDIKKQSSIHFLILDLSAVSAIDTSGVSLFKDLKKAVENKGVE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEVLEKL RA++ +DI+  D+L+LTVGEAV+ALS T+K Q
Sbjct  601  LVLVNPVGEVLEKLIRADDARDIMGPDTLYLTVGEAVAALSPTMKGQ  647



>ref|XP_011023507.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
 ref|XP_011008182.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
Length=652

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 194/227 (85%), Gaps = 1/227 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID PAA  IWK+DKFDF V+LCAFFGV FISVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDFPAACQIWKIDKFDFAVMLCAFFGVIFISVQHGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYK+A   PGFLILSIEAP+NF NTT
Sbjct  482  AVAISIFKILLQVTRPKTLILGNIPGTDIFRNLHHYKDATRIPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI      EE  KKQS + F++LD+SA+SAIDTSG+S FKDL+  +E KGVE
Sbjct  542  YLKERILRWI-NEYETEEDIKKQSSIHFLILDLSAVSAIDTSGVSLFKDLKKAVENKGVE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEVLEKL RA++  DI+  D+L+LTVGEAV+ALSST+K Q
Sbjct  601  LVLVNPVGEVLEKLLRADDACDIMGPDTLYLTVGEAVAALSSTMKGQ  647



>ref|XP_011075526.1| PREDICTED: probable sulfate transporter 3.3 [Sesamum indicum]
Length=644

 Score =   335 bits (860),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 198/225 (88%), Gaps = 7/225 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVT       +PAA  IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  420  PLFQYTPNVVLGAIIVT-------VPAACQIWKIDKFDFLVMLCAFLGVLFISVQEGLAI  472

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FKVLLQITRPKT++LGNIPGT IYR+L HYKEA++ PGFLILSIEAP+NF NTT
Sbjct  473  AVGISVFKVLLQITRPKTVILGNIPGTDIYRNLHHYKEAVSVPGFLILSIEAPINFANTT  532

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI+RWIEEYE E+   KK+S+++FV+LD+SA+SAIDT+G+SFFKDL+M LEKK +E
Sbjct  533  YLKERITRWIEEYETEDANAKKKSEVKFVILDLSAVSAIDTNGVSFFKDLKMALEKKNLE  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+GEV+EKLQRA++ K++ + D LFLTVGEAV++L ST+K
Sbjct  593  LVLVNPVGEVIEKLQRADDAKELARPDCLFLTVGEAVTSLVSTVK  637



>ref|XP_002280766.1| PREDICTED: probable sulfate transporter 3.3 [Vitis vinifera]
Length=652

 Score =   336 bits (861),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAAY IWK+DKFDFIVLLCAF GV FISVQ GLAI
Sbjct  419  PLFQYTPNVVLGAIIVTAVVGLIDLPAAYQIWKIDKFDFIVLLCAFLGVIFISVQQGLAI  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQ+TRP+T MLGNIPGT IYR++ HYK+ +  PGFLILSI+A +NF NTT
Sbjct  479  AVGISIFKVLLQVTRPRTGMLGNIPGTDIYRNIHHYKDGMKVPGFLILSIDASINFANTT  538

Query  574  YLKERISRWIeeyeaeeEQT--KKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKG  401
            YL ERI RW+EEYEA++ +   KK S L+FV+LD+SA+S IDTSG+S F DL+  LEKKG
Sbjct  539  YLNERILRWVEEYEAQDAEEEGKKHSSLQFVILDLSAVSTIDTSGVSIFSDLKKALEKKG  598

Query  400  VELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            +E+ LVNP+GEV+EKLQR +E +DI++ DS++LTVGEAV++LSS +K Q
Sbjct  599  LEMALVNPVGEVMEKLQRWDEGRDILRPDSVYLTVGEAVASLSSAVKCQ  647



>emb|CBI26897.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   335 bits (859),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAAY IWK+DKFDFIVLLCAF GV FISVQ GLAI
Sbjct  403  PLFQYTPNVVLGAIIVTAVVGLIDLPAAYQIWKIDKFDFIVLLCAFLGVIFISVQQGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQ+TRP+T MLGNIPGT IYR++ HYK+ +  PGFLILSI+A +NF NTT
Sbjct  463  AVGISIFKVLLQVTRPRTGMLGNIPGTDIYRNIHHYKDGMKVPGFLILSIDASINFANTT  522

Query  574  YLKERISRWIeeyeaeeEQT--KKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKG  401
            YL ERI RW+EEYEA++ +   KK S L+FV+LD+SA+S IDTSG+S F DL+  LEKKG
Sbjct  523  YLNERILRWVEEYEAQDAEEEGKKHSSLQFVILDLSAVSTIDTSGVSIFSDLKKALEKKG  582

Query  400  VELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            +E+ LVNP+GEV+EKLQR +E +DI++ DS++LTVGEAV++LSS +K Q
Sbjct  583  LEMALVNPVGEVMEKLQRWDEGRDILRPDSVYLTVGEAVASLSSAVKCQ  631



>ref|XP_010274709.1| PREDICTED: probable sulfate transporter 3.3 [Nelumbo nucifera]
Length=653

 Score =   334 bits (857),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 197/233 (85%), Gaps = 1/233 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAVVGLID+PAAY +WK+D+FDF VL+ AF GV FIS Q GLAI
Sbjct  422  PLFCYTPNVVLGAIIITAVVGLIDVPAAYLVWKIDRFDFFVLVSAFLGVIFISAQGGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRPKT+MLGNIPGT IYR+L HYKEA   PGFLILSIEAPVNF NTT
Sbjct  482  AVGISIFKILLQITRPKTVMLGNIPGTDIYRNLHHYKEARRIPGFLILSIEAPVNFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERISRWI E    EE+  KQS+L +V+LDMSA+SAIDTSG+SF KD++  +EK+G+E
Sbjct  542  YLNERISRWI-EEYEVEEEVAKQSNLHYVILDMSAVSAIDTSGLSFIKDVKKAMEKRGLE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQRA +  + +  DSLFLTVGEAV++LS T+K +  +++V
Sbjct  601  LVLVNPLGEVMEKLQRANKAHEFMAMDSLFLTVGEAVASLSFTVKGRTSSNNV  653



>ref|XP_002312444.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
 gb|EEE89811.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
Length=650

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 195/227 (86%), Gaps = 3/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID PAA  IWK+DKFDF+V+LCAFFGV FISVQ+GLAI
Sbjct  422  PLFQYTPNVVLGAIIVTAVIGLIDFPAACQIWKIDKFDFVVMLCAFFGVIFISVQDGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYK+A   PGFLILSIEAP+NF NTT
Sbjct  482  AVAISIFKILLQVTRPKTLILGNIPGTDIFRNLHHYKDATRIPGFLILSIEAPINFANTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI      EE  KKQS +RF++LD+SA+SAIDTSG+S FKDL+  +E KG  
Sbjct  542  YLKERIVRWI-NEYETEEDIKKQSSIRFLILDLSAVSAIDTSGVSLFKDLKKAVENKG--  598

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+GEVLEKL RA++ +DI+  D+L+LTVGEAV+ALSST+K Q
Sbjct  599  LVLVNPVGEVLEKLLRADDARDIMGPDTLYLTVGEAVAALSSTMKGQ  645



>ref|XP_004140467.1| PREDICTED: probable sulfate transporter 3.3 [Cucumis sativus]
 gb|KGN50848.1| Sulfate transporter [Cucumis sativus]
Length=664

 Score =   332 bits (850),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 203/228 (89%), Gaps = 1/228 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPN++L AIIVTAV+GLID+PAAY+IWKVDKFDF+V+LCAFFGV  ISVQ+GLAI
Sbjct  433  PLFQYTPNLVLAAIIVTAVIGLIDVPAAYAIWKVDKFDFVVMLCAFFGVILISVQHGLAI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK++LQITRPKT MLGNI GT IYR++  YK+A++  GFLILSIEAP+NF NTT
Sbjct  493  AVGISIFKIILQITRPKTAMLGNIGGTDIYRNIHQYKDAMSIQGFLILSIEAPINFANTT  552

Query  574  YLKERISRWIeeyeaeeEQTKKQ-SDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            YL ERI RWIE+YEA ++  KK+ SDL+FVVL++SA+SAIDTSG+  FKDLR  LEKKGV
Sbjct  553  YLNERILRWIEDYEAGQDHLKKEGSDLQFVVLELSAVSAIDTSGVLLFKDLRRALEKKGV  612

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            ELVLVNP+GE+LEKLQ+A+E ++I++ +++FLTVGEAV+ LS+T+K Q
Sbjct  613  ELVLVNPMGELLEKLQKADENQEILRPNNVFLTVGEAVAFLSATMKRQ  660



>ref|XP_006583911.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Glycine 
max]
Length=637

 Score =   330 bits (847),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 195/227 (86%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA +IWK+DKFDF+V+L AF GV FISVQ GLA+
Sbjct  398  PLFQYTPNVVLGAIIVTAVIGLIDLPAACNIWKIDKFDFVVMLTAFLGVLFISVQGGLAL  457

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S FK+LLQITRPKT+MLG IPGT IYR+LD YKEA+  PGFLILSIEAP+NF N T
Sbjct  458  AVGLSTFKILLQITRPKTVMLGKIPGTDIYRNLDQYKEAVRIPGFLILSIEAPINFANIT  517

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF+VL+MSA+SA+DTSGIS FK+L+ TLEKKGVE
Sbjct  518  YLNERTLRWI--EEEEEDNIKEQLSLRFLVLEMSAVSAVDTSGISLFKELKATLEKKGVE  575

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  D +++D+LFLTVGEAV++LSS +K Q
Sbjct  576  LVLVNPLAEVIEKLKKADEANDFIRADNLFLTVGEAVASLSSAMKGQ  622



>ref|XP_008454781.1| PREDICTED: probable sulfate transporter 3.3 [Cucumis melo]
Length=661

 Score =   331 bits (848),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 201/228 (88%), Gaps = 1/228 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPN++L AIIVTAVVGLID+PAAY+IWKVDKFDF+V+LCAFFGV  ISVQ+GLAI
Sbjct  430  PLFQYTPNLVLAAIIVTAVVGLIDVPAAYAIWKVDKFDFVVMLCAFFGVILISVQHGLAI  489

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK++LQITRPKT MLGNI GT IYR++  YK+A++  GFLILSIEAP+NF N T
Sbjct  490  AVGISIFKIILQITRPKTAMLGNIGGTDIYRNIHQYKDAMSVQGFLILSIEAPINFANAT  549

Query  574  YLKERISRWIeeyeaeeEQTKKQ-SDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            YL ERI RWIE+YEA ++  KK+ SDL+FVVL++SA+SAIDTSG+  FKDLR  LEKKGV
Sbjct  550  YLNERILRWIEDYEAGQDHVKKEGSDLQFVVLELSAVSAIDTSGVLLFKDLRRALEKKGV  609

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            EL+LVNP+GEVLEKLQ+A+E ++I++ + +FLTVGEAV+ LS+T+K Q
Sbjct  610  ELLLVNPMGEVLEKLQKADENQEILRPNHVFLTVGEAVALLSTTMKGQ  657



>ref|XP_003529415.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Glycine 
max]
Length=659

 Score =   330 bits (847),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 195/227 (86%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA +IWK+DKFDF+V+L AF GV FISVQ GLA+
Sbjct  420  PLFQYTPNVVLGAIIVTAVIGLIDLPAACNIWKIDKFDFVVMLTAFLGVLFISVQGGLAL  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S FK+LLQITRPKT+MLG IPGT IYR+LD YKEA+  PGFLILSIEAP+NF N T
Sbjct  480  AVGLSTFKILLQITRPKTVMLGKIPGTDIYRNLDQYKEAVRIPGFLILSIEAPINFANIT  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF+VL+MSA+SA+DTSGIS FK+L+ TLEKKGVE
Sbjct  540  YLNERTLRWI--EEEEEDNIKEQLSLRFLVLEMSAVSAVDTSGISLFKELKATLEKKGVE  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  D +++D+LFLTVGEAV++LSS +K Q
Sbjct  598  LVLVNPLAEVIEKLKKADEANDFIRADNLFLTVGEAVASLSSAMKGQ  644



>ref|XP_007157749.1| hypothetical protein PHAVU_002G095300g [Phaseolus vulgaris]
 gb|ESW29743.1| hypothetical protein PHAVU_002G095300g [Phaseolus vulgaris]
Length=647

 Score =   328 bits (840),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 195/232 (84%), Gaps = 3/232 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAAY+IWK+DKFDF+V+L AF GV FISVQ GLA+
Sbjct  418  PLFQYTPNVVLGAIIVTAVIGLIDLPAAYNIWKIDKFDFLVMLSAFMGVLFISVQGGLAL  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S FK+L+QITRPKT+MLG IPGT IYR+L  YKEA+  PGFLILSIEAP+NF N T
Sbjct  478  AVGLSTFKILMQITRPKTVMLGKIPGTEIYRNLHQYKEAVRVPGFLILSIEAPINFANIT  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF++L+MSA+SAIDTSGIS FK+L+ TLEKK VE
Sbjct  538  YLNERTLRWI---EEEEDNIKEQFSLRFLILEMSAVSAIDTSGISLFKELKATLEKKSVE  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADH  239
            LVLVNPL EV+EKL++ +E  D +++DSLFLTVGEA+++LSST+K Q    H
Sbjct  595  LVLVNPLAEVIEKLKKVDEATDFIQADSLFLTVGEAIASLSSTMKAQSSTFH  646



>gb|KJB15438.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=645

 Score =   327 bits (839),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 199/233 (85%), Gaps = 10/233 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+       LLQITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AI-------LLQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  534

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEEYEAE    KKQS L+FVVL MSA+SAIDTSG+S FK+L+ T+EKKG E
Sbjct  535  YLNERILRWIEEYEAE--DHKKQSSLQFVVLVMSAVSAIDTSGVSIFKELKKTVEKKGAE  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVLVNPLGEV+EKLQ+++E  D ++ D LFLTVGEAV+ L++TIK QV ++HV
Sbjct  593  LVLVNPLGEVMEKLQKSDEAGDFMRPDCLFLTVGEAVATLTATIKSQV-SNHV  644



>ref|XP_003556073.1| PREDICTED: probable sulfate transporter 3.3-like [Glycine max]
Length=658

 Score =   327 bits (838),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 194/227 (85%), Gaps = 3/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA +IWK+DKFDF+V++ AF GV FISVQ GLA+
Sbjct  420  PLFQYTPNVVLGAIIVTAVIGLIDLPAACNIWKIDKFDFVVMMTAFLGVLFISVQGGLAL  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S  K+LLQITRPKT+MLG IPGT IYR+LD YKEA+  PGFLILSIEAP+NF N T
Sbjct  480  AVGLSTLKILLQITRPKTVMLGKIPGTDIYRNLDQYKEAVRIPGFLILSIEAPINFANIT  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF+VL+MSA+SA+DTSGIS FK+L+ TLEKKGVE
Sbjct  540  YLNERTLRWI---EEEEDNIKEQLSLRFLVLEMSAVSAVDTSGISLFKELKATLEKKGVE  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  D +++D+LFLTVGEAV++LSS +K Q
Sbjct  597  LVLVNPLAEVIEKLKKADEANDFIRADNLFLTVGEAVASLSSAMKGQ  643



>gb|KEH30847.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 194/227 (85%), Gaps = 3/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IWK+DKFDF+V+L AFFGV FISVQ GLA+
Sbjct  417  PLFQYTPNVVLGAIIVTAVIGLIDIPAACHIWKIDKFDFLVMLTAFFGVVFISVQLGLAV  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S F++LLQITRPKT+M+GNIPGT IYR+L  YKEA   PGFLILSIEAP+NF N T
Sbjct  477  AVGLSTFRILLQITRPKTVMMGNIPGTDIYRNLHQYKEATRIPGFLILSIEAPINFANIT  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL +R  RWI   E EEE   K S LRF+VL+MSA+SAIDTSGIS FK+L+ T+EK+GVE
Sbjct  537  YLNDRTLRWI---EEEEEDNIKDSSLRFLVLEMSAVSAIDTSGISLFKELKATMEKRGVE  593

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E+   +++D+LFLTVGEAV++LSST+K Q
Sbjct  594  LVLVNPLAEVIEKLKKADESNTFIRADNLFLTVGEAVASLSSTMKSQ  640



>ref|XP_010552708.1| PREDICTED: probable sulfate transporter 3.3 [Tarenaya hassleriana]
Length=631

 Score =   324 bits (831),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 187/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV LGAIIVTAVVGLIDIP+A  IWK+DKFDF+V LCAF GV FISVQ+GLAI
Sbjct  403  PLFQYTPNVALGAIIVTAVVGLIDIPSALHIWKIDKFDFLVFLCAFLGVIFISVQHGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+ K+++QITRPKT+ +GNIPGTGIYR+LDHYKEA   PGFLILSIEAPVNF N+T
Sbjct  463  AVGISMLKIMMQITRPKTVRMGNIPGTGIYRNLDHYKEAQKIPGFLILSIEAPVNFANST  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERISRWI E    EE  +K S LRF++++MSA+S +DT+G+SFF+DL+   EKK +E
Sbjct  523  YLTERISRWI-EDCEAEEAAEKHSSLRFLIVEMSAVSGVDTNGVSFFRDLKRATEKKSIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVLVNPL EV+EKLQR +E  D ++ +SLFLTV EAVS+LS
Sbjct  582  LVLVNPLSEVMEKLQRGDEAGDFMRPESLFLTVAEAVSSLS  622



>gb|KHN43014.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=657

 Score =   322 bits (825),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 193/227 (85%), Gaps = 4/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA +IWK+DKFDF+V+L AF GV FISVQ GLA+
Sbjct  420  PLFQYTPNVVLGAIIVTAVIGLIDLPAACNIWKIDKFDFVVMLTAFLGVLFISVQGGLAL  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S FK+LLQITRPKT+MLG IPGT IYR+LD YKEA+  PGFLILSIEAP+NF N T
Sbjct  480  AVGLSTFKILLQITRPKTVMLGKIPGTDIYRNLDQYKEAVRIPGFLILSIEAPINFANIT  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF+VL+MSA+SA+DTSGIS FK+L+ TLEKKG  
Sbjct  540  YLNERTLRWI--EEEEEDNIKEQLSLRFLVLEMSAVSAVDTSGISLFKELKATLEKKG--  595

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  D +++D+LFLTVGEAV++LSS +K Q
Sbjct  596  LVLVNPLAEVIEKLKKADEANDFIRADNLFLTVGEAVASLSSAMKGQ  642



>ref|XP_010088531.1| putative sulfate transporter 3.3 [Morus notabilis]
 gb|EXB36448.1| putative sulfate transporter 3.3 [Morus notabilis]
Length=681

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 197/248 (79%), Gaps = 17/248 (7%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPN++LGAIIVTAVVGLIDIPAA++IWK DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  424  PLFQYTPNLVLGAIIVTAVVGLIDIPAAFNIWKTDKFDFLVMLCAFLGVLFISVQEGLAI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQITRP+T++LG+IPG+ IYR++ HYK+A+  PGFLILSIEAP+NF N+ 
Sbjct  484  AVGISIFKILLQITRPRTVVLGSIPGSDIYRNVHHYKQAVGVPGFLILSIEAPINFANSM  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI E   EE   KK   +++V+LD+SA+S IDT+G+   +DLR  +EKKG+E
Sbjct  544  YLNERILRWI-EEYEEEVDVKKHLSIQYVILDLSAVSTIDTTGVILIRDLRKAVEKKGIE  602

Query  394  ----------------LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTI  263
                            LVLVNPLGEVLEKLQRAEET+D  K ++L+LTVGEAV++LSS++
Sbjct  603  ASKTEKFSLSSQSSSCLVLVNPLGEVLEKLQRAEETRDFAKPENLYLTVGEAVASLSSSM  662

Query  262  KFQVPADH  239
            K Q P  H
Sbjct  663  KSQPPTMH  670



>ref|XP_004505279.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Cicer 
arietinum]
Length=657

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 192/227 (85%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIP+A  IWK+DKFDF+V+L AF GV   SVQ GLA+
Sbjct  419  PLFQYTPNVVLGAIIVTAVIGLIDIPSACHIWKIDKFDFLVMLTAFLGVILFSVQEGLAV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S F++LLQITRPKT+M+GNIPGT IYR+L  YKEA   PGFLILSIEAP+NF N T
Sbjct  479  AVGLSTFRILLQITRPKTVMMGNIPGTDIYRNLHQYKEATRIPGFLILSIEAPINFANIT  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL +R  RWI   E EE+  K+ S LRF++L+MSA+SAIDTSGIS FK+L+ T+EKKG+E
Sbjct  539  YLNDRTLRWI--EEEEEDNIKELSSLRFLILEMSAVSAIDTSGISLFKELKATMEKKGIE  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  + +++D+LFLTVGEAV++LSST+K Q
Sbjct  597  LVLVNPLAEVIEKLKKADEANNFIRADNLFLTVGEAVASLSSTMKSQ  643



>ref|XP_004297375.2| PREDICTED: probable sulfate transporter 3.3 [Fragaria vesca subsp. 
vesca]
Length=681

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 197/228 (86%), Gaps = 5/228 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILGAIIVTAVVGLID+PAAY IWKVDK+DF+VL+CAF GV FISVQ GLAI
Sbjct  431  PLFQYTPNVILGAIIVTAVVGLIDVPAAYHIWKVDKYDFLVLVCAFVGVIFISVQEGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITT-PGFLILSIEAPVNFVNT  578
            AVGIS+FK++LQ+TRP+T++LGNIPGT I+RDL HYK++  T PGFLI+SIEA +NF NT
Sbjct  491  AVGISVFKIMLQVTRPRTVVLGNIPGTDIFRDLQHYKDSTATVPGFLIISIEAAINFANT  550

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERI RWI     EE+  +K+S +R+V++DM+A+S IDT+GI+ F+DLR +L+K+GV
Sbjct  551  TYLNERILRWI----EEEDDGEKRSSIRYVIIDMTAVSTIDTTGITLFRDLRKSLKKRGV  606

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            ELVLVNPL EV+EKL++A E  +I++ ++L+LTVGEAV++LS +IK Q
Sbjct  607  ELVLVNPLSEVMEKLKKAYEGDEIMRPEALYLTVGEAVASLSISIKNQ  654



>gb|EYU43824.1| hypothetical protein MIMGU_mgv1a019207mg [Erythranthe guttata]
Length=385

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 186/226 (82%), Gaps = 18/226 (8%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  170  PLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWKIDKFDFVVMLCAFLGVLFISVQEGLAI  229

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+L+Q+TRPKT+M+GNIPGT IYRDL HYK+A   PGF+IL IEAP+NFVNTT
Sbjct  230  AVGISIFKILMQVTRPKTVMMGNIPGTDIYRDLHHYKDAAAVPGFVILGIEAPINFVNTT  289

Query  574  YLKERISRWIeeyeaeeEQTKKQSD-LRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            YLKERI+RWIE+ E+E +  KK+S  L+FV+LD+SA+SAIDTSG                
Sbjct  290  YLKERITRWIEDSESENDGAKKKSGLLKFVILDLSAVSAIDTSG----------------  333

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
             LVLVNP+GEV+EKLQ+ +E K++ + D++FLTVGEAV+ L STIK
Sbjct  334  -LVLVNPIGEVIEKLQQGDEAKELARPDAMFLTVGEAVTTLLSTIK  378



>ref|XP_003528541.2| PREDICTED: probable sulfate transporter 3.3-like [Glycine max]
Length=656

 Score =   317 bits (811),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 189/229 (83%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILG II+TAV+GLID+P+AY IWK+DKFDF+V+L AFFGV FISVQ GLAI
Sbjct  417  PLFQYTPNVILGTIIITAVIGLIDLPSAYLIWKLDKFDFVVMLTAFFGVIFISVQLGLAI  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+F++LLQ+TRPKT+MLGNIP T IYR++ HY EA   PGFLILSIEAP+NF N T
Sbjct  477  AVGLSVFRILLQVTRPKTVMLGNIPATTIYRNIHHYNEATRVPGFLILSIEAPINFANIT  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW++E EA          L+FV+L+MSA+SAIDTSG+S FKDL+ TL  KGV+
Sbjct  537  YLNERILRWVDEEEATI---NDNLCLQFVILEMSAVSAIDTSGVSLFKDLKTTLTMKGVQ  593

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNPL +V+EKLQ+A+E  D V+ D LF+TVGEAV++LSS +K Q P
Sbjct  594  LVLVNPLADVIEKLQKADEVDDFVREDYLFMTVGEAVTSLSSLMKGQSP  642



>emb|CAG28415.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=326

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+ GAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  97   PLFEYTPNVVPGAIIVTAVIGLIDLPAARHIWRIDKFDFLVMLCAFFGVVFLSVQNGLAI  156

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPKT+++GNIPGT +YR+L HYKEA   PGFL+LSIE+PVNF N+ 
Sbjct  157  AVGLSLFKLLMQVTRPKTVVMGNIPGTDVYRNLHHYKEAQRIPGFLVLSIESPVNFANSN  216

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA++ +DT+G+SFFK+L+ T  KK +E
Sbjct  217  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVNGVDTNGVSFFKELKKTTAKKSIE  275

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++  + + LFLTV +AV++ S
Sbjct  276  LVFVNPLSEVMEKLQRADEEEEFTRPEFLFLTVSQAVASPS  316



>ref|XP_006416126.1| hypothetical protein EUTSA_v10007442mg [Eutrema salsugineum]
 gb|ESQ34479.1| hypothetical protein EUTSA_v10007442mg [Eutrema salsugineum]
Length=499

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA  IWK+DKFDF+V+LCAFFGV F+SVQ+GLAI
Sbjct  271  PLFQYTPNVVLGAIIVTAVIGLIDLPAARYIWKIDKFDFLVMLCAFFGVVFLSVQHGLAI  330

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ KVL+Q+TRPKT+++GNIPGT +YR+L HYK+A   PGFL+LSIE+PVNF N+ 
Sbjct  331  AVGLSLLKVLMQVTRPKTVIMGNIPGTDVYRNLHHYKDAQRIPGFLVLSIESPVNFANSN  390

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA+S +DT+G++FF+DL+ T  KK +E
Sbjct  391  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVSGVDTNGVAFFRDLKKTTAKKNIE  449

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  450  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVAEAVASLS  490



>gb|KHN08075.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=656

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 191/227 (84%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLID+PAA +IWK+DKFDF+V++ AF GV FISVQ GLA+
Sbjct  420  PLFQYTPNVVLGAIIVTAVIGLIDLPAACNIWKIDKFDFVVMMTAFLGVLFISVQGGLAL  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S  K+LLQITRPKT+MLG IPGT IYR+LD YKEA+  PGFLILSIEAP+N  N T
Sbjct  480  AVGLSTLKILLQITRPKTVMLGKIPGTDIYRNLDQYKEAVRIPGFLILSIEAPINSANIT  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E EE+  K+Q  LRF+VL+MSA+SA+DTSGIS FK+L+ TLEKKG  
Sbjct  540  YLNERTLRWI---EEEEDNIKEQLSLRFLVLEMSAVSAVDTSGISLFKELKATLEKKG--  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNPL EV+EKL++A+E  D +++D+LFLTVGEAV++LSS +K Q
Sbjct  595  LVLVNPLAEVIEKLKKADEANDFIRADNLFLTVGEAVASLSSAMKGQ  641



>dbj|BAA75015.1| sulfate transporter [Arabidopsis thaliana]
Length=631

 Score =   313 bits (802),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IWK+DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAACHIWKIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GNIPGT IYRDL HYKEA   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKILMQVTRPKMVIMGNIPGTDIYRDLHHYKEAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S L+F++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLQFLILEMSAVSGVDTNGVSFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E K+ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVVEKLQRADEQKEFMRPEFLFLTVAEAVASLS  622



>emb|CDY04744.1| BnaC05g18450D [Brassica napus]
Length=632

 Score =   313 bits (802),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 190/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARHIWRIDKFDFLVMLCAFFGVVFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPKT+++GNIPGT +YR+L HYKEA   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKTVVMGNIPGTDVYRNLHHYKEAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA+S +DT+G+SFFK+L+ T+ KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVSGVDTNGVSFFKELKKTIAKKRIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVSEAVASLS  622



>gb|KFK44398.1| hypothetical protein AALP_AA1G252200 [Arabis alpina]
Length=631

 Score =   313 bits (802),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IWK+DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARHIWKIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q TRPK +++GNIPGT IYR+LDHYKEA   PGFLILSIE+PVNF N+ 
Sbjct  463  AVGLSLFKILMQATRPKMVIMGNIPGTDIYRNLDHYKEAQRIPGFLILSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA+S +DT+G++FFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVSGVDTNGVAFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVAEAVASLS  622



>ref|NP_173722.1| sulfate transporter 3.3 [Arabidopsis thaliana]
 sp|Q9SXS2.2|SUT33_ARATH RecName: Full=Probable sulfate transporter 3.3; AltName: Full=AST91 
[Arabidopsis thaliana]
 gb|AAC00610.1| Putative sulphate transporter protein#protein [Arabidopsis thaliana]
 gb|AEE30335.1| sulfate transporter 3.3 [Arabidopsis thaliana]
Length=631

 Score =   313 bits (802),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IWK+DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAACHIWKIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GNIPGT IYRDL HYKEA   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKILMQVTRPKMVIMGNIPGTDIYRDLHHYKEAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S L+F++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLQFLILEMSAVSGVDTNGVSFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E K+ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVVEKLQRADEQKEFMRPEFLFLTVAEAVASLS  622



>emb|CAN77009.1| hypothetical protein VITISV_036877 [Vitis vinifera]
Length=653

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 194/239 (81%), Gaps = 18/239 (8%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAVVGLID+PAAY IWK+DKFDFIVLLCAF GV FISVQ GLAI
Sbjct  393  PLFQYTPNVVLGAIIVTAVVGLIDLPAAYQIWKIDKFDFIVLLCAFLGVIFISVQQGLAI  452

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQ+TRP+T MLGNIPGT IYR++ HYK+ +  PGFLILSI+A +NF NTT
Sbjct  453  AVGISIFKVLLQVTRPRTGMLGNIPGTDIYRNIHHYKDGMKVPGFLILSIDASINFANTT  512

Query  574  YLKERISRWIeeyeaeeEQT--KKQSDLRFVVLDM---------SAISAIDTSGISFFKD  428
            YL ERI RW+EEYEA++ +   KK S L+FV+LD+         S++S IDTSG+S F D
Sbjct  513  YLNERILRWVEEYEAQDAEEEGKKHSSLQFVILDLSGELYNSICSSVSTIDTSGVSIFSD  572

Query  427  LRMTLEKKGVE-------LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            L+  LEKKG+E       + LVNP+GEV+EKLQR +E +DI++ DS++LTVGEAV++LS
Sbjct  573  LKKALEKKGLEASTHIYIMALVNPVGEVMEKLQRWDEGRDILRPDSVYLTVGEAVASLS  631



>ref|XP_002893261.1| hypothetical protein ARALYDRAFT_472562 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69520.1| hypothetical protein ARALYDRAFT_472562 [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 187/221 (85%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IWK+DKFDF V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAACQIWKIDKFDFFVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GNIPGT IYRDL HYKEA   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKILMQVTRPKMVIMGNIPGTDIYRDLHHYKEAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S L+F++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSRLQFLILEMSAVSGVDTNGVSFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E K+ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEQKEFMRPEFLFLTVAEAVASLS  622



>gb|KEH30849.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=663

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 190/230 (83%), Gaps = 4/230 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAV+GLIDI AAY IWK+DKFDF+VLL AFFGV F SVQ GLA+
Sbjct  421  PLFHYTPNVVLGAIIITAVIGLIDISAAYLIWKIDKFDFLVLLVAFFGVIFFSVQYGLAL  480

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIF++LLQITRPKT MLGNIP T IYR+L HYKEA   PGFLILSIEAP+NF+N T
Sbjct  481  AVGLSIFRILLQITRPKTAMLGNIPTTNIYRNLHHYKEATRVPGFLILSIEAPINFINIT  540

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE E    +  +   L++V+L+MSA+S+IDTSG+S FK+L +TL+ KG E
Sbjct  541  YLHERILRWIEEEEDTRTENLR---LQYVILEMSAVSSIDTSGVSLFKELEVTLKMKGAE  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPA  245
            LVLVNPL EV+EKL++A+E  D V++D LFLTV EAV+ALSS +K Q P+
Sbjct  598  LVLVNPLAEVIEKLKKADEAND-VRTDYLFLTVEEAVAALSSGLKSQPPS  646



>ref|XP_006306275.1| hypothetical protein CARUB_v10012133mg [Capsella rubella]
 gb|EOA39173.1| hypothetical protein CARUB_v10012133mg [Capsella rubella]
Length=631

 Score =   311 bits (798),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 190/222 (86%), Gaps = 1/222 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  +W++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARQLWRIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GN PGT IYRDL HYKEA   PGFLILSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKMVIMGNFPGTDIYRDLHHYKEAQRIPGFLILSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S+LRF++L+MSA+S +DT+G++FFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKNSNLRFLILEMSAVSGVDTNGVTFFKELKKTTAKKDME  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LV VNPL EV+EKLQRA+E K+ ++++ LFLTV EAV++LS+
Sbjct  582  LVFVNPLSEVMEKLQRADEDKEFMRTEFLFLTVAEAVASLST  623



>emb|CDY21415.1| BnaA09g30120D [Brassica napus]
Length=632

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARHIWRIDKFDFLVMLCAFFGVVFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPKT+++GNIPGT +YR+L HYK+A   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKTVVMGNIPGTDVYRNLHHYKDAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVSGVDTNGVSFFKELKKTTAKKNIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVSEAVASLS  622



>ref|XP_009115564.1| PREDICTED: probable sulfate transporter 3.3 [Brassica rapa]
Length=632

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARHIWRIDKFDFLVMLCAFFGVVFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPKT+++GNIPGT +YR+L HYK+A   PGFL+LSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKTVVMGNIPGTDVYRNLHHYKDAQRIPGFLVLSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S LRF++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSSLRFLILEMSAVSGVDTNGVSFFKELKKTTAKKNIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVSEAVASLS  622



>ref|XP_010460085.1| PREDICTED: probable sulfate transporter 3.3 [Camelina sativa]
Length=631

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 189/222 (85%), Gaps = 1/222 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARQIWRIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GN PGT IYRDL HYK+A   PG LILSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKMVIMGNFPGTDIYRDLHHYKQAQRIPGILILSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S+LRF++L+MSA+S +DT+G++FFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSNLRFLILEMSAVSGVDTTGVTFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LV VNPL EV+EKLQRA+E K+ ++++ LFLTV EAV++LS+
Sbjct  582  LVFVNPLSEVMEKLQRADEEKEFMRTEFLFLTVAEAVASLST  623



>ref|XP_010498811.1| PREDICTED: probable sulfate transporter 3.3 [Camelina sativa]
Length=631

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 189/222 (85%), Gaps = 1/222 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARQIWRIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GN PGT IYRDL HYK+A   PG LILSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKMVIMGNFPGTDIYRDLHHYKQAQRIPGILILSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S+LRF++L+MSA+S +DT+G++FFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSNLRFLILEMSAVSGVDTNGVTFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LV VNPL EV+EKLQRA+E K+ ++++ LFLTV EAV++LS+
Sbjct  582  LVFVNPLSEVMEKLQRADEEKEFMRTEFLFLTVAEAVASLST  623



>ref|XP_010477593.1| PREDICTED: probable sulfate transporter 3.3 [Camelina sativa]
Length=631

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 189/222 (85%), Gaps = 1/222 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQNGLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARQIWRIDKFDFLVMLCAFFGVIFLSVQNGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPK +++GN PGT IYRDL HYK+A   PG LILSIE+PVNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKMVIMGNFPGTDIYRDLHHYKQAQRIPGILILSIESPVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S+LRF++L+MSA+S +DT+G++FFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EECEEEEAQEKHSNLRFLILEMSAVSGVDTNGVTFFKELKKTTAKKDIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LV VNPL EV+EKLQRA+E K+ ++++ LFLTV EAV++LS+
Sbjct  582  LVFVNPLSEVMEKLQRADEEKEFMRTEFLFLTVAEAVASLST  623



>ref|XP_008243372.1| PREDICTED: probable sulfate transporter 3.3 [Prunus mume]
Length=687

 Score =   310 bits (795),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 188/228 (82%), Gaps = 5/228 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAV+GL+D+PAAY IWK+DK+DFIVL+CAF GV FISVQ GLAI
Sbjct  447  PLFHYTPNVILGAIIVTAVIGLVDVPAAYHIWKIDKYDFIVLVCAFLGVIFISVQQGLAI  506

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FK+LLQ+TRP+T++LGNIPGT ++RDL HY E A++ PGFLI+SIEA +NF NT
Sbjct  507  AVGISVFKILLQVTRPRTVVLGNIPGTDVFRDLHHYNESAVSVPGFLIISIEAAINFANT  566

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
             YL ERI RWI     EE+   K  ++RFV++DMSA+S+IDT+GI+ F DLR  + KKGV
Sbjct  567  AYLNERILRWI----EEEDDGNKHPNIRFVIIDMSAVSSIDTTGITLFGDLRKAIRKKGV  622

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            ELVLVNPL EV+EKLQ+ ++  ++++ D L+L+ GEA+++LS  +K Q
Sbjct  623  ELVLVNPLAEVVEKLQKVDKDNELMRPDHLYLSAGEAIASLSMAMKNQ  670



>ref|XP_007157748.1| hypothetical protein PHAVU_002G095200g [Phaseolus vulgaris]
 gb|ESW29742.1| hypothetical protein PHAVU_002G095200g [Phaseolus vulgaris]
Length=628

 Score =   308 bits (789),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 186/229 (81%), Gaps = 4/229 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILGAII+ AV+GLIDIP+AY IWK+DKFDF+V+L AFFGV FISVQ GLA+
Sbjct  390  PLFQYTPNVILGAIIIAAVIGLIDIPSAYLIWKIDKFDFVVMLTAFFGVIFISVQLGLAL  449

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ +VLLQITRPKT+MLGNIP T IYR++ HYKEAI  PGFLILSIEAP+NF N T
Sbjct  450  AVALSVLRVLLQITRPKTVMLGNIPATNIYRNIHHYKEAIRVPGFLILSIEAPINFANIT  509

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW+EE        K+   L+F+VLDMSA+S IDTSG+S FKDL+  L  KGV 
Sbjct  510  YLNERIYRWVEEEATI----KENVCLQFLVLDMSAVSTIDTSGVSLFKDLKNLLTIKGVA  565

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            +VLVNPL EV++KL+++++  D + ++ LFLTVGEAV++LSS +K + P
Sbjct  566  IVLVNPLAEVIDKLKKSDDGHDFIGAEYLFLTVGEAVASLSSAMKTKTP  614



>emb|CAJ86330.1| OSIGBa0113E10.13 [Oryza sativa Indica Group]
Length=603

 Score =   305 bits (780),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 180/229 (79%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  378  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYNIWKMDKMDFLVCLCAFAGVIFISVQQGLAI  437

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VLLQITRPK M+ GNI GT IYR+L  YK+A   PGFLIL++EAP+NF NT 
Sbjct  438  AVGISIFRVLLQITRPKMMIQGNIKGTDIYRNLHQYKDAQRVPGFLILTVEAPINFANTN  497

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE  +      KQS+L FV+LD+SA+ AIDTSGISF  DL+ + EK G+E
Sbjct  498  YLNERIKRWIEEESSA---GTKQSELHFVILDLSAVPAIDTSGISFLIDLKKSTEKHGLE  554

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L+LVNP GEV+EK+QRA +     KSDSL+LT GEAV++LS+  K   P
Sbjct  555  LILVNPTGEVMEKIQRANDAHGHFKSDSLYLTTGEAVASLSTFSKMTAP  603



>emb|CAE03539.2| OSJNBa0060D06.5 [Oryza sativa Japonica Group]
 emb|CAE04513.2| OSJNBb0059K02.23 [Oryza sativa Japonica Group]
 gb|EEC78149.1| hypothetical protein OsI_17708 [Oryza sativa Indica Group]
Length=629

 Score =   305 bits (780),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 180/229 (79%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  404  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYNIWKMDKMDFLVCLCAFAGVIFISVQQGLAI  463

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VLLQITRPK M+ GNI GT IYR+L  YK+A   PGFLIL++EAP+NF NT 
Sbjct  464  AVGISIFRVLLQITRPKMMIQGNIKGTDIYRNLHQYKDAQRVPGFLILTVEAPINFANTN  523

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE  +      KQS+L FV+LD+SA+ AIDTSGISF  DL+ + EK G+E
Sbjct  524  YLNERIKRWIEEESSA---GTKQSELHFVILDLSAVPAIDTSGISFLIDLKKSTEKHGLE  580

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L+LVNP GEV+EK+QRA +     KSDSL+LT GEAV++LS+  K   P
Sbjct  581  LILVNPTGEVMEKIQRANDAHGHFKSDSLYLTTGEAVASLSTFSKMTAP  629



>gb|EAZ37975.1| hypothetical protein OsJ_22321 [Oryza sativa Japonica Group]
Length=655

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 180/229 (79%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  430  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYNIWKMDKMDFLVCLCAFAGVIFISVQQGLAI  489

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VLLQITRPK M+ GNI GT IYR+L  YK+A   PGFLIL++EAP+NF NT 
Sbjct  490  AVGISIFRVLLQITRPKMMIQGNIKGTDIYRNLHQYKDAQRVPGFLILTVEAPINFANTN  549

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE  +      KQS+L FV+LD+SA+ AIDTSGISF  DL+ + EK G+E
Sbjct  550  YLNERIKRWIEEESSAGT---KQSELHFVILDLSAVPAIDTSGISFLIDLKKSTEKHGLE  606

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L+LVNP GEV+EK+QRA +     KSDSL+LT GEAV++LS+  K   P
Sbjct  607  LILVNPTGEVMEKIQRANDAHGHFKSDSLYLTTGEAVASLSTFSKMTAP  655



>ref|NP_001054098.1| Os04g0652400 [Oryza sativa Japonica Group]
 dbj|BAF16012.1| Os04g0652400 [Oryza sativa Japonica Group]
 dbj|BAG96981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=661

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 180/229 (79%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  436  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYNIWKMDKMDFLVCLCAFAGVIFISVQQGLAI  495

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VLLQITRPK M+ GNI GT IYR+L  YK+A   PGFLIL++EAP+NF NT 
Sbjct  496  AVGISIFRVLLQITRPKMMIQGNIKGTDIYRNLHQYKDAQRVPGFLILTVEAPINFANTN  555

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE  +      KQS+L FV+LD+SA+ AIDTSGISF  DL+ + EK G+E
Sbjct  556  YLNERIKRWIEEESSA---GTKQSELHFVILDLSAVPAIDTSGISFLIDLKKSTEKHGLE  612

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L+LVNP GEV+EK+QRA +     KSDSL+LT GEAV++LS+  K   P
Sbjct  613  LILVNPTGEVMEKIQRANDAHGHFKSDSLYLTTGEAVASLSTFSKMTAP  661



>ref|XP_007225166.1| hypothetical protein PRUPE_ppa002313mg [Prunus persica]
 gb|EMJ26365.1| hypothetical protein PRUPE_ppa002313mg [Prunus persica]
Length=689

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 188/228 (82%), Gaps = 6/228 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAV+GLID+PAAY IWK+DK+DFIVL+CAF GV FISVQ GLAI
Sbjct  446  PLFHYTPNVILGAIIVTAVIGLIDVPAAYHIWKIDKYDFIVLVCAFLGVIFISVQQGLAI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FK+LLQ+TRP+T++LGNIPGT ++RDL HY E A++ PGFLI+SIEA +NF NT
Sbjct  506  AVGISVFKILLQVTRPRTVVLGNIPGTDVFRDLHHYNEAAVSVPGFLIISIEAAINFANT  565

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERI RWI   E EE+   K  ++RFV++DMSA+S IDT+GI+ F DLR  + KKG 
Sbjct  566  TYLNERILRWI---EEEEDDGNKHPNIRFVIIDMSAVSTIDTTGITLFGDLRKAIRKKG-  621

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             LVLVNPL EV+EKLQ+ ++  ++++ D L+L+VGEA+++LS  +K Q
Sbjct  622  -LVLVNPLAEVVEKLQKVDKDNELMRPDHLYLSVGEAIASLSMAMKNQ  668



>ref|XP_009103199.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Brassica 
rapa]
 emb|CDY25768.1| BnaA07g10140D [Brassica napus]
Length=631

 Score =   303 bits (776),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAIIVTAV+GLID+PAA  IW++DKFDF+V+LCAFFGV F+SVQ GLAI
Sbjct  403  PLFEYTPNVVLGAIIVTAVIGLIDLPAARHIWRIDKFDFLVMLCAFFGVIFLSVQQGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+Q+TRPKT+++GNIPGT IYR+L HYKEA   PG L+LSIE+ VNF N+ 
Sbjct  463  AVGLSLFKLLMQVTRPKTVIMGNIPGTDIYRNLHHYKEARRIPGVLVLSIESAVNFANSN  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER SRWI E   EEE  +K S L+F++L+MSA+S +DT+G+SFFK+L+ T  KK +E
Sbjct  523  YLTERTSRWI-EDSEEEEAQEKHSSLQFLILEMSAVSGVDTNGVSFFKELKKTTAKKNIE  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LV VNPL EV+EKLQRA+E ++ ++ + LFLTV EAV++LS
Sbjct  582  LVFVNPLSEVMEKLQRADEEEEFMRPEFLFLTVAEAVASLS  622



>gb|EMT11015.1| Putative sulfate transporter 3.3 [Aegilops tauschii]
Length=617

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  392  PLFVYTPNVVLGAIIIAAVIGLIDLPAAYNIWKMDKMDFLVCLCAFAGVIFISVQEGLAI  451

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ M+ GNI GT IYR+L  YKEA   PGFLIL++EAP+NF NT 
Sbjct  452  AVGISIFRVLMQITRPRMMIQGNIKGTDIYRNLHQYKEAQRVPGFLILTVEAPINFANTN  511

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E E     KQ++LR V+LD+SA+ AIDTSGI+F  DL+ + EK G+E
Sbjct  512  YLNERTKRWI---EDESSSGNKQTELRVVILDLSAVPAIDTSGIAFLIDLKKSTEKHGLE  568

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA +  D  + D L+LT GEA+++LS   K   P
Sbjct  569  LVLVNPTGEVMEKIQRANDAHDHFRPDCLYLTTGEAIASLSGFAKMATP  617



>ref|XP_006652928.1| PREDICTED: probable sulfate transporter 3.3-like [Oryza brachyantha]
Length=657

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 179/229 (78%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y IWK+DK DF+V +CAF GV FISVQ GLAI
Sbjct  432  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYHIWKMDKMDFLVCVCAFAGVIFISVQEGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VLLQITRPK M+ GNI GT IYR++  YK+A   PGFLIL++EAP+NF NT 
Sbjct  492  AVGISIFRVLLQITRPKMMIQGNIKGTDIYRNIHQYKDAQRVPGFLILTVEAPINFANTN  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER+ RWIEE  +      KQ+DL FVVLD+SA+ AIDTSGISF  DL+ + EK+G+E
Sbjct  552  YLNERMKRWIEEESSA---GNKQTDLHFVVLDLSAVPAIDTSGISFLIDLKKSTEKRGLE  608

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L+LVNP GEV+EK+QR  +     KSDSL+LT GEAV++LS+  K   P
Sbjct  609  LILVNPTGEVMEKIQRVNDAHGHFKSDSLYLTTGEAVASLSAYSKMTTP  657



>gb|EMS65870.1| putative sulfate transporter 3.3 [Triticum urartu]
Length=583

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  358  PLFVYTPNVVLGAIIIAAVIGLIDLPAAYNIWKMDKMDFLVCLCAFAGVIFISVQEGLAI  417

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ M+ GNI GT IYR+L  YKEA   PGFLIL++EAP+NF NT 
Sbjct  418  AVGISIFRVLMQITRPRMMIQGNIKGTDIYRNLHQYKEAQRVPGFLILTVEAPINFANTN  477

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E E     KQ++LR V+LD+SA+  IDTSGI+F  DL+ + EK G+E
Sbjct  478  YLNERTKRWI---EDESSSGNKQNELRVVILDLSAVPTIDTSGIAFLIDLKKSTEKHGLE  534

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA +  +  + DSL+LT GEA+++LS   K   P
Sbjct  535  LVLVNPTGEVMEKIQRANDAHNHFRPDSLYLTTGEAIASLSGFAKMATP  583



>emb|CDP00782.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   299 bits (766),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILGAIIVTAVVGLIDIPAAY  WKVDKFDFIVLLCAF GV FISVQ GLAI
Sbjct  403  PLFQYTPNVILGAIIVTAVVGLIDIPAAYQTWKVDKFDFIVLLCAFLGVLFISVQGGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFKVLLQITRPKT+MLGNIPGT IYR+L  YK+A+  PGFLILSIEAP+NF NTT
Sbjct  463  AVGISIFKVLLQITRPKTVMLGNIPGTDIYRNLHQYKDAVRIPGFLILSIEAPINFANTT  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI+RW E+YEAE E+TKKQS LRF+V+D+SA+SAIDTSGISFFK+LRM LEKKG+E
Sbjct  523  YLKERITRWTEDYEAEVEKTKKQSGLRFLVIDLSAVSAIDTSGISFFKELRMVLEKKGIE  582



>dbj|BAJ85696.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87528.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88303.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97396.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY+IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  446  PLFVYTPNVVLGAIIIAAVIGLIDLPAAYNIWKMDKMDFLVCLCAFAGVIFISVQEGLAI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ M+ GNI GT IYR+L  YKEA   PGFLIL+IEAP+NF NT 
Sbjct  506  AVGISIFRVLMQITRPRMMIQGNIKGTDIYRNLHQYKEAQRVPGFLILTIEAPINFANTN  565

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E E     KQS+LR V+LD+SA+ AIDTSGI+F  DL+ + EK G+E
Sbjct  566  YLNERTKRWI---EDESFSGNKQSELRVVILDLSAVPAIDTSGIAFLIDLKKSTEKHGLE  622

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA +  +  + D L+LT GEA+++LS   K   P
Sbjct  623  LVLVNPTGEVMEKIQRANDAHNHFRQDCLYLTTGEAIASLSGFAKMATP  671



>ref|NP_001169671.1| uncharacterized protein LOC100383552 [Zea mays]
 gb|ACN34467.1| unknown [Zea mays]
 tpg|DAA35654.1| TPA: hypothetical protein ZEAMMB73_371925 [Zea mays]
Length=660

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 179/229 (78%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID PA Y IWK+DK DF+V +CAF GV FISVQ GLAI
Sbjct  435  PLFVYTPNVVLGAIIIAAVIGLIDFPAVYHIWKMDKMDFLVCVCAFAGVIFISVQEGLAI  494

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRPK M+ GNI GT IYRDL HYKEA    GFLIL+IEAP+NF N+ 
Sbjct  495  AVGISIFRVLMQITRPKMMVQGNIKGTDIYRDLHHYKEAQRVSGFLILAIEAPINFANSN  554

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI   E E  +  K ++L F++LD+SA+ AIDTSGI+F  D++ ++EK+G+E
Sbjct  555  YLNERIKRWI---EEESFEQDKHTELHFIILDLSAVPAIDTSGIAFLIDIKKSIEKRGLE  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA E ++  + D L+LT GEA+++LS+  K   P
Sbjct  612  LVLVNPTGEVMEKIQRANEAENYFRPDCLYLTTGEAIASLSALAKMTKP  660



>ref|XP_002448662.1| hypothetical protein SORBIDRAFT_06g030980 [Sorghum bicolor]
 gb|EES12990.1| hypothetical protein SORBIDRAFT_06g030980 [Sorghum bicolor]
Length=671

 Score =   297 bits (760),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PA Y IWK+DK DF+V +CAF GV FISVQ GLAI
Sbjct  446  PLFVYTPNVVLGAIIIAAVIGLIDLPAVYHIWKMDKMDFLVCVCAFAGVIFISVQEGLAI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRPK M+ GNI GT IYRDL HYKEA    GFLIL+IEAP+NF N  
Sbjct  506  AVGISIFRVLMQITRPKMMVQGNIKGTDIYRDLHHYKEAQRVSGFLILAIEAPINFANCN  565

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI   E E  +  K ++L F++LD+SA+  IDTSGI+F  D++ ++EK+G+E
Sbjct  566  YLNERIKRWI---EEESFEQDKHTELHFIILDLSAVPTIDTSGIAFLIDIKKSIEKRGLE  622

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA E ++  + D L+LT  EAV++LS+  K   P
Sbjct  623  LVLVNPTGEVMEKIQRANEAQNYFRPDCLYLTTAEAVASLSALAKMTKP  671



>ref|XP_009339687.1| PREDICTED: probable sulfate transporter 3.3 [Pyrus x bretschneideri]
Length=668

 Score =   296 bits (759),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAVVGLID+PAAY IWK+DK+DF+VL+CAF GV FISVQ+GLAI
Sbjct  427  PLFHYTPNVILGAIIVTAVVGLIDVPAAYHIWKIDKYDFLVLICAFLGVIFISVQHGLAI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FKVLLQ+TRP+T++LGNIPGT ++RDL  YKE A++ PGFLI+ IEA +NF NT
Sbjct  487  AVGISVFKVLLQVTRPRTVVLGNIPGTDVFRDLHQYKESAVSVPGFLIILIEASINFANT  546

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERISRWI     EE+   K S++RFVV+DMSA+S IDT+GI+ F D+R ++ KKG+
Sbjct  547  TYLNERISRWI----EEEDDGNKVSNIRFVVIDMSAVSTIDTTGITLFADIRKSIRKKGI  602

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            +LVLVNPL EV++KLQ+     +      L+L+VGEAV++LS  +K
Sbjct  603  KLVLVNPLAEVMDKLQKVNNGGE---EFMLYLSVGEAVASLSMGMK  645



>ref|XP_004505276.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Cicer 
arietinum]
Length=656

 Score =   296 bits (757),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 190/229 (83%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAV+GLIDI AAY IWK+DKFDF+VLL AFFGV FISVQ GLA+
Sbjct  418  PLFHYTPNVVLGAIIITAVIGLIDISAAYLIWKLDKFDFLVLLTAFFGVIFISVQYGLAL  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VG+SIF++LLQ+TRPKT+MLGNIP T IYR+L HYKEA   PGFLILSIEAP+NF N T
Sbjct  478  SVGLSIFRILLQVTRPKTVMLGNIPATNIYRNLHHYKEATKVPGFLILSIEAPINFANIT  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW+   E EE  T +   L+ V+L+MSA+S+IDTSG+S FK+L++TL+ K VE
Sbjct  538  YLHERILRWV---EEEEGTTTENLSLQCVILEMSAVSSIDTSGVSLFKELKLTLKLKSVE  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNPL EV+EKL++A+E  D V++D LFLTVGEAV+ L+S +K Q P
Sbjct  595  LVLVNPLAEVIEKLKKADEANDFVRADYLFLTVGEAVATLTSAMKGQSP  643



>gb|EYU31826.1| hypothetical protein MIMGU_mgv1a0030181mg, partial [Erythranthe 
guttata]
Length=367

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIPAA  IWK+DKFDF+V+LCAF GV FISVQ GLAI
Sbjct  177  PLFQYTPNVVLGAIIVTAVIGLIDIPAACQIWKIDKFDFVVMLCAFLGVLFISVQEGLAI  236

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+L+Q+TRPKT+M+GNIPGT IYRDL HYK+A   PGF+IL IEAP+NFVNTT
Sbjct  237  AVGISIFKILMQVTRPKTVMMGNIPGTDIYRDLHHYKDAAAVPGFVILGIEAPINFVNTT  296

Query  574  YLKERISRWIeeyeaeeEQTKKQSD-LRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            YLKERI+RWI++ E+E +  KK+S  L+FV+LD+SA+SAIDTSG+SFFKDLRM LEKK +
Sbjct  297  YLKERITRWIDDSESENDGAKKKSGLLKFVILDLSAVSAIDTSGVSFFKDLRMALEKKNL  356

Query  397  E  395
            E
Sbjct  357  E  357



>ref|XP_010943102.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Elaeis 
guineensis]
Length=648

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 177/225 (79%), Gaps = 3/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AVVGLID+PA Y +WK+DK DFIV LCAF GV FISVQ+GLAI
Sbjct  424  PLFVYTPNVVLGAIIIAAVVGLIDVPAVYHLWKMDKIDFIVCLCAFLGVLFISVQDGLAI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF++LLQITRP  + LGNI GT IYR+L HY +A   PGFLIL++EAP+NF NTT
Sbjct  484  AVGISIFRILLQITRPNIVTLGNITGTDIYRNLHHYIDARRVPGFLILAVEAPINFTNTT  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI+R IEE +A       Q+ LRFV+LD+SA+  IDTSG+SF  DL+ ++EK G E
Sbjct  544  YLNERITRCIEEEKAV---DHHQAVLRFVILDLSAVPTIDTSGVSFLVDLKKSMEKHGFE  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+GEV+EKLQR     +    DSL+LT+GEA+ +LSS +K
Sbjct  601  LVLVNPVGEVMEKLQRTNGVHNFFGVDSLYLTIGEAIISLSSLLK  645



>ref|XP_004977057.1| PREDICTED: probable sulfate transporter 3.3-like [Setaria italica]
Length=670

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID PA Y IWK+DK DF+V +CAF GV FISVQ GLAI
Sbjct  445  PLFVYTPNVVLGAIIIAAVIGLIDAPAVYQIWKMDKMDFLVCVCAFAGVIFISVQEGLAI  504

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+F+VL+QITRPK ++ GNI GT IYRDL  YKEA   PG LIL+IEAP+NF N+ 
Sbjct  505  AVGLSVFRVLMQITRPKMIIQGNIKGTDIYRDLHQYKEAQRVPGMLILAIEAPINFANSN  564

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWIEE  +      KQ++L F++LD+SA+ AIDTSGI+   D++  +EK+G+E
Sbjct  565  YLNERIKRWIEEESSAH---NKQTELHFIILDLSAVPAIDTSGIALLIDIKKAIEKRGLE  621

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA E  +  +S+ L+LT GEAV++LS+  K   P
Sbjct  622  LVLVNPTGEVMEKIQRANEALNQFRSNCLYLTTGEAVASLSALAKMTKP  670



>ref|XP_008775815.1| PREDICTED: probable sulfate transporter 3.3 [Phoenix dactylifera]
Length=642

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY +WK+DK DFIV LCAF GV F+SVQ+GLAI
Sbjct  418  PLFVYTPNVVLGAIIIAAVMGLIDVPAAYYLWKMDKIDFIVCLCAFLGVLFVSVQDGLAI  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF++LLQ TRP  ++LGNI GT IYR+L HY +A   PGFLIL++EAP+NF NTT
Sbjct  478  AVGISIFRILLQTTRPNIVILGNITGTDIYRNLQHYNDARRVPGFLILAVEAPINFTNTT  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI+R I   E EE+    ++ LRFV+LD+SA+S IDTSG+SF  DL+ ++EK G+E
Sbjct  538  YLNERITRCI---EEEEDVEDNEAGLRFVILDLSAVSTIDTSGVSFLVDLKKSMEKHGLE  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL+NP+GEV+EKLQRA    +    DSL+LT+GEA+ +LS+  K
Sbjct  595  LVLINPMGEVMEKLQRANGVHNFYGVDSLYLTIGEAIISLSALQK  639



>ref|XP_008339548.1| PREDICTED: probable sulfate transporter 3.3 [Malus domestica]
Length=679

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 183/226 (81%), Gaps = 8/226 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAVVGLID+PAAY IWK+DK+DF+VL+CAF GV F+SVQ GLAI
Sbjct  446  PLFHYTPNVILGAIIVTAVVGLIDVPAAYHIWKIDKYDFLVLICAFLGVIFLSVQQGLAI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FKVLLQ+TRP+T++LGNIPGT ++RDL  YKE A++ PGFLI+ IEA +NF NT
Sbjct  506  AVGISVFKVLLQVTRPRTVVLGNIPGTEVFRDLHQYKESAVSVPGFLIILIEAAINFANT  565

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERI RWI     EE    K S++RFVV+DMSA+S IDT+GI+ F D+R ++ KKG+
Sbjct  566  TYLNERILRWI----EEEGDGNKVSNIRFVVIDMSAVSTIDTTGITLFTDIRKSIRKKGI  621

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            +LVLVNPL EV++K+Q+  +  +      L+L+VGEAV++LS  +K
Sbjct  622  KLVLVNPLAEVMDKMQKVNDGDE---EFMLYLSVGEAVASLSMGMK  664



>ref|XP_008389211.1| PREDICTED: probable sulfate transporter 3.3 [Malus domestica]
Length=697

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 183/226 (81%), Gaps = 8/226 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAVVGLID+PAA+ IWK+DK+DF+VL+CAF GV FISVQ+GLAI
Sbjct  456  PLFHYTPNVILGAIIITAVVGLIDVPAAFHIWKIDKYDFLVLICAFLGVIFISVQHGLAI  515

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FKVLLQ+TRP+T++LGNIPGT ++RDL  YKE A++ PGFLI+ IEA +NF NT
Sbjct  516  AVGISVFKVLLQVTRPRTVVLGNIPGTDVFRDLHQYKESAVSVPGFLIILIEASINFANT  575

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERI RWIEE         K S++RFVV+DMSA+S IDT+GI+ F D+R ++ KKG+
Sbjct  576  TYLNERILRWIEEESG----EDKVSNIRFVVIDMSAVSTIDTTGITLFVDIRKSIRKKGI  631

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            +LVLVNPL EV++KLQ+     +      L+L+VGEAV++LS  +K
Sbjct  632  KLVLVNPLAEVMDKLQKVNNGGE---EFMLYLSVGEAVASLSMGMK  674



>dbj|BAK05364.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   289 bits (739),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 175/229 (76%), Gaps = 4/229 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII  AVVGLID+PAAY IWK+DK DF+V LCAF GV FISV+ GLAI
Sbjct  441  PLFVYTPNVVLGAIITVAVVGLIDVPAAYHIWKMDKMDFLVCLCAFAGVIFISVEEGLAI  500

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ ++ GNI GT IYR++  Y+EA   PGFLIL++EAP+NF NT 
Sbjct  501  AVGISIFRVLMQITRPRMIIQGNIKGTDIYRNIHQYEEAQRVPGFLILTVEAPINFANTN  560

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWIE+       ++ +S+LRFV+ D+SA+ AIDTSGI+F  DL+   EK G+E
Sbjct  561  YLNERTKRWIEDESF----SRNKSELRFVIFDLSAVPAIDTSGIAFLVDLKKPTEKLGLE  616

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA +  +  + D L+LT+GEA+++LS       P
Sbjct  617  LVLVNPTGEVMEKIQRANDPHNHFRPDCLYLTIGEAIASLSGEANMATP  665



>ref|XP_009351474.1| PREDICTED: probable sulfate transporter 3.3 [Pyrus x bretschneideri]
Length=679

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 182/226 (81%), Gaps = 8/226 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAVVGLID+PAAY +WK+DK+DF+VL+CAF GV F+SVQ GLAI
Sbjct  446  PLFHYTPNVILGAIIVTAVVGLIDVPAAYHVWKIDKYDFLVLICAFLGVIFLSVQQGLAI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKE-AITTPGFLILSIEAPVNFVNT  578
            AVGIS+FKVLLQ+TRP+T++LGNIPGT ++RDL  Y E A++ PGFLI+ IEA +NF NT
Sbjct  506  AVGISVFKVLLQVTRPRTVVLGNIPGTDVFRDLHQYNESAVSVPGFLIILIEAAINFANT  565

Query  577  TYLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGV  398
            TYL ERI RWI     EE    K S++RFVV+DMSA+S IDT+GI+ F+D+R ++ KKG+
Sbjct  566  TYLNERILRWI----EEEGDGNKVSNIRFVVVDMSAVSTIDTTGITLFEDIRKSIRKKGI  621

Query  397  ELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            +LVLVNPL EV++K+Q+     +      L+L+VGEAV++LS  +K
Sbjct  622  KLVLVNPLAEVMDKMQKVNNGDE---EFMLYLSVGEAVASLSMGMK  664



>ref|XP_009403141.1| PREDICTED: probable sulfate transporter 3.3 [Musa acuminata subsp. 
malaccensis]
Length=646

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 175/225 (78%), Gaps = 0/225 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AVVGL+D+PAA +IWK+DK DF+V L +F GV F+SVQ GLA 
Sbjct  419  PLFAYTPNVVLAAIIIAAVVGLVDVPAACNIWKLDKVDFLVCLSSFLGVVFVSVQQGLAT  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+G+S F++LLQITRPK + +GNIPGT IYRD+  YKEA   PGFLIL+IEAP+NF NTT
Sbjct  479  AIGLSTFRILLQITRPKMIAVGNIPGTSIYRDMHQYKEAKGVPGFLILAIEAPINFSNTT  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI+RWIE    E     K++ LRF++LD+SA+  +DTSGI+F  +L+ + EK G+E
Sbjct  539  YLNERITRWIENETNETTMEDKEASLRFLILDLSAVPTVDTSGITFLNELKKSTEKDGLE  598

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            ++ VNP+GEV+EKLQRA +  + +   SL+LT+GEAV +LS  IK
Sbjct  599  VIFVNPMGEVMEKLQRANKIHEFLGVGSLYLTIGEAVISLSPFIK  643



>gb|EMT11939.1| Putative sulfate transporter 3.3 [Aegilops tauschii]
Length=662

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 174/229 (76%), Gaps = 3/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY +WK+DK DF+V LCAF GV F SVQ GLAI
Sbjct  437  PLFVYTPNVVLGAIIIVAVIGLIDLPAAYHLWKMDKMDFLVCLCAFIGVIFFSVQQGLAI  496

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ ++ GNI GT IYR++  Y+EA   PGFLIL++EAP+NF NT 
Sbjct  497  AVGISIFRVLMQITRPRMIIQGNIKGTDIYRNVLQYEEAQRVPGFLILTVEAPINFANTN  556

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RW+   E E     KQ++LRFV+ D+SA+ AIDTSGI+F  DL+   EK G+E
Sbjct  557  YLNERTKRWL---EDESFSGNKQTELRFVIFDLSAVPAIDTSGIAFLIDLKKPTEKLGLE  613

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GEV+EK+QRA +  +  + D L+LT+GEA+++LS       P
Sbjct  614  LVLVNPTGEVMEKIQRANDKHNHFRPDCLYLTIGEAIASLSGEASMATP  662



>gb|ERM94085.1| hypothetical protein AMTR_s00010p00108760 [Amborella trichopoda]
Length=628

 Score =   285 bits (728),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAV+GL+D PAA +IWKVDK DF+V L AF GV FISVQ+GLAI
Sbjct  403  PLFFYTPNVVLGAIIITAVIGLMDFPAAIAIWKVDKVDFLVCLSAFLGVIFISVQDGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A GIS+ KVLLQITRP T +LGN+ GT IY +L HYK+A   PGFLILSI+AP+ F+N+T
Sbjct  463  AAGISLLKVLLQITRPNTALLGNLRGTHIYCNLQHYKDASRVPGFLILSIQAPIYFLNST  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y++ERISRW+EE E E    K  +   +VVLDMSA++AIDTSGIS   +LR +L K+G++
Sbjct  523  YIRERISRWVEEEEEEAHDNKTTTP-HYVVLDMSAVTAIDTSGISVLTELRSSLSKRGLQ  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NPLGEV+ KLQRA++ +    +D L+LTVGEAV++LSS++K Q
Sbjct  582  LVLANPLGEVMGKLQRADQIQSF-GTDGLYLTVGEAVASLSSSLKEQ  627



>ref|XP_006826848.2| PREDICTED: probable sulfate transporter 3.3 [Amborella trichopoda]
Length=646

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAV+GL+D PAA +IWKVDK DF+V L AF GV FISVQ+GLAI
Sbjct  421  PLFFYTPNVVLGAIIITAVIGLMDFPAAIAIWKVDKVDFLVCLSAFLGVIFISVQDGLAI  480

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A GIS+ KVLLQITRP T +LGN+ GT IY +L HYK+A   PGFLILSI+AP+ F+N+T
Sbjct  481  AAGISLLKVLLQITRPNTALLGNLRGTHIYCNLQHYKDASRVPGFLILSIQAPIYFLNST  540

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y++ERISRW+EE E E    K  +   +VVLDMSA++AIDTSGIS   +LR +L K+G++
Sbjct  541  YIRERISRWVEEEEEEAHDNKTTTP-HYVVLDMSAVTAIDTSGISVLTELRSSLSKRGLQ  599

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NPLGEV+ KLQRA++ +    +D L+LTVGEAV++LSS++K Q
Sbjct  600  LVLANPLGEVMGKLQRADQIQSF-GTDGLYLTVGEAVASLSSSLKEQ  645



>gb|KHG23018.1| putative sulfate transporter 3.3 -like protein [Gossypium arboreum]
Length=629

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 173/231 (75%), Gaps = 24/231 (10%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAAY +WK+DKFDFIV                   
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAAYHVWKIDKFDFIV-------------------  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
               +SIFK L+QITRPKT++LG IPGT IYRDL HYKE++  PGFLILSIEAPVNF N+T
Sbjct  463  --AVSIFKNLMQITRPKTVLLGKIPGTDIYRDLHHYKESVKIPGFLILSIEAPVNFANST  520

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER   W EEYEAE+      S LRFV+L+MS +S IDTSG+SFFK+L+ T+EKKGVE
Sbjct  521  YLNER---WFEEYEAEDPMMHSNSSLRFVILEMSTVSTIDTSGVSFFKELKRTMEKKGVE  577

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPAD  242
            LVLVN +GEV+EKLQR+ E  D +K D LFLTVGEAV+ LS+ IK Q   D
Sbjct  578  LVLVNLVGEVMEKLQRSNEADDFMKPDCLFLTVGEAVATLSAKIKGQSSND  628



>ref|XP_004505277.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Cicer 
arietinum]
Length=654

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 181/229 (79%), Gaps = 5/229 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+TAV+GLIDI AAY IWK+DKFDF+VLL AFFGV FISVQ GLA+
Sbjct  418  PLFHYTPNVVLGAIIITAVIGLIDISAAYLIWKLDKFDFLVLLTAFFGVIFISVQYGLAL  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VG+SIF++LLQ+TRPKT+MLGNIP T IYR+L HYKEA   PGFLILSIEAP+NF N T
Sbjct  478  SVGLSIFRILLQVTRPKTVMLGNIPATNIYRNLHHYKEATKVPGFLILSIEAPINFANIT  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW+   E EE  T +   L+ V+L+MSA+S+IDTSG+S      + L  K   
Sbjct  538  YLHERILRWV---EEEEGTTTENLSLQCVILEMSAVSSIDTSGVS--LFKELKLTLKLKS  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNPL EV+EKL++A+E  D V++D LFLTVGEAV+ L+S +K Q P
Sbjct  593  LVLVNPLAEVIEKLKKADEANDFVRADYLFLTVGEAVATLTSAMKGQSP  641



>ref|XP_006844344.2| PREDICTED: probable sulfate transporter 3.4 [Amborella trichopoda]
Length=628

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN ILGAII+TAVVGLID+ AAY IWKVD+ DF   L AFFGV FISVQ GLAI
Sbjct  403  PLFHYTPNAILGAIIITAVVGLIDLRAAYEIWKVDRLDFFACLSAFFGVLFISVQMGLAI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LL +TRP T++LGNIP T ++RD+ HYKEA   P FLIL I++P+ F N T
Sbjct  463  AVGISIFKILLHVTRPNTVILGNIPATNVFRDIGHYKEASRIPSFLILGIQSPIYFANAT  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWIEE E   + ++  + L+ V+LDM+A++AIDTSGI+F  +L+ TL KK ++
Sbjct  523  YLQERINRWIEEEEDRIKNSRDLT-LKCVILDMTAVTAIDTSGINFLAELKKTLHKKSLQ  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G+V+ KLQ      D  +SDSL+LTV EAV A+SS  K
Sbjct  582  LVLANPVGDVMVKLQ-CSPAMDAFQSDSLYLTVAEAVLAISSNFK  625



>ref|XP_009381462.1| PREDICTED: probable sulfate transporter 3.3 [Musa acuminata subsp. 
malaccensis]
Length=655

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 177/227 (78%), Gaps = 3/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID+PAAY+IWK+DK DF+V + +F GV FISVQ GLAI
Sbjct  422  PLFAYTPNVVLAAIIIAAVIGLIDVPAAYNIWKLDKVDFLVCMSSFLGVIFISVQEGLAI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIF++LLQ TRPK + LGNIPGT IYRDL  YK+A   PGFL+L++EAP+NF NTT
Sbjct  482  AVGLSIFRILLQTTRPKMIALGNIPGTNIYRDLHQYKDAKRVPGFLVLAVEAPINFSNTT  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI+RWI   E E    +K+++LRF++LD+SA+  +DTSGISF  DL+ + EK G+E
Sbjct  542  YLNERITRWI---ENENSMEEKETNLRFLILDLSAVPTVDTSGISFLIDLKKSTEKHGLE  598

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            L LVNP GEV+EKLQRA +  D +  + L LT+ EAV +LSS  K Q
Sbjct  599  LTLVNPTGEVMEKLQRANKIHDFLGVNFLHLTIAEAVFSLSSQNKLQ  645



>gb|ERN06019.1| hypothetical protein AMTR_s00142p00027860 [Amborella trichopoda]
Length=656

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN ILGAII+TAVVGLID+ AAY IWKVD+ DF   L AFFGV FISVQ GLAI
Sbjct  431  PLFHYTPNAILGAIIITAVVGLIDLRAAYEIWKVDRLDFFACLSAFFGVLFISVQMGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LL +TRP T++LGNIP T ++RD+ HYKEA   P FLIL I++P+ F N T
Sbjct  491  AVGISIFKILLHVTRPNTVILGNIPATNVFRDIGHYKEASRIPSFLILGIQSPIYFANAT  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWIEE E   + ++  + L+ V+LDM+A++AIDTSGI+F  +L+ TL KK ++
Sbjct  551  YLQERINRWIEEEEDRIKNSRDLT-LKCVILDMTAVTAIDTSGINFLAELKKTLHKKSLQ  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G+V+ KLQ      D  +SDSL+LTV EAV A+SS  K
Sbjct  610  LVLANPVGDVMVKLQ-CSPAMDAFQSDSLYLTVAEAVLAISSNFK  653



>emb|CAA65536.1| sulphate transporter protein [Sporobolus stapfianus]
Length=660

 Score =   270 bits (689),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 171/230 (74%), Gaps = 4/230 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLIDIPA Y IWK+DK DF+V +CAF GV FISVQ GLAI
Sbjct  434  PLFVYTPNVVLGAIIIAAVIGLIDIPAVYHIWKMDKMDFLVCVCAFAGVLFISVQEGLAI  493

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+F+VLLQITRPK  + GNI GT IYR+L  YK+A   PGFLIL+ EAP+NF N+ 
Sbjct  494  AVGISVFRVLLQITRPKITVQGNIMGTDIYRNLHQYKDAQRIPGFLILATEAPINFANSN  553

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI   E    QT KQ++LRFV+LD+SA+ AIDTSG++F  D++ ++EK+G+E
Sbjct  554  YLNERIKRWI--EEESSAQT-KQTELRFVILDLSAVPAIDTSGVAFLIDIKKSIEKRGLE  610

Query  394  LVLVNPLGEVLEKLQRAEE-TKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP GE   K   +E  T+      +  LT GEAV++LS+  K   P
Sbjct  611  LVLVNPTGEGHGKNTASERGTQAFQVGIACILTTGEAVASLSALAKMASP  660



>ref|XP_003580696.2| PREDICTED: LOW QUALITY PROTEIN: probable sulfate transporter 
3.3 [Brachypodium distachyon]
Length=654

 Score =   267 bits (683),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 169/230 (73%), Gaps = 4/230 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AV+GLID+PAAY IWK+DK DF+V LCAF GV FISVQ GLAI
Sbjct  428  PLFVYTPNVVLGAIIIAAVIGLIDLPAAYHIWKMDKMDFLVCLCAFAGVIFISVQEGLAI  487

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF+VL+QITRP+ M+ GNI GT IYR+L  YK+A   PGFLIL++EAP+NF NT 
Sbjct  488  AVGISIFRVLMQITRPRMMIQGNIKGTDIYRNLHQYKDAQRVPGFLILTVEAPINFANTN  547

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E E     KQ++LR ++LD+SA+ AIDTSGI+F  DL+ + EK+G+E
Sbjct  548  YLNERTKRWI---EDESSSGNKQTELRCIILDLSAVPAIDTSGIAFLVDLKKSTEKRGLE  604

Query  394  LVLVNPLGEVLEKLQRAEE-TKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            LVLVNP G    +  +++  T+       L+LT  EA+++LS   K   P
Sbjct  605  LVLVNPTGXGHGENTKSDRCTQSFQAGLXLYLTTEEAIASLSGFAKITTP  654



>ref|XP_010254168.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Nelumbo 
nucifera]
Length=658

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 176/227 (78%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP+++LGAII+TAV+GLID  AAY +WKVD+ DF   +CAFFGV FISVQ GLAI
Sbjct  433  PLFTYTPSLVLGAIIITAVIGLIDYRAAYRLWKVDRLDFFACMCAFFGVLFISVQIGLAI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP T++LGNIPGT IY++L  Y+EA+  P FLIL IE+P+ F N+T
Sbjct  493  AVGVSIFKILLHVTRPNTVVLGNIPGTEIYQNLRCYREALRVPSFLILGIESPIFFANST  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E +  Q  K+S L+ ++LDM+A++AIDTSGI    +LR TL+K+ ++
Sbjct  553  YLQERILRWV-REEEDRIQENKESTLKCIILDMTAVTAIDTSGIEAINELRKTLKKRSLQ  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G+V+EKL R++  +   + + L+L+VGEAV+ +SS  K Q
Sbjct  612  LVLANPVGDVMEKLHRSKTLQSF-ELNGLYLSVGEAVADISSLFKAQ  657



>gb|KDP37199.1| hypothetical protein JCGZ_06255 [Jatropha curcas]
Length=443

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK DF+  LC+F GV FISV  GLAI
Sbjct  218  PLFYYTPNFILAAIIITAVIGLIDYQAAYHLWKVDKLDFLACLCSFVGVLFISVPLGLAI  277

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T  +GNIPGT IY+ L+ Y+EA+  P  LIL+IE+P+ F N+T
Sbjct  278  AVGVSVFKILLHVTRPNTATMGNIPGTHIYQSLNRYREALRVPSILILAIESPIYFANST  337

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E E  +   +S L+ ++LDM+A++AIDT+GI    +LR  LEK+ ++
Sbjct  338  YLQERIARWI-REEEERIKANNESALKCIILDMTAVTAIDTTGIELLSELRKMLEKRSLQ  396

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKLQ++ +  D    + ++LTVGEAV  LS+  K Q
Sbjct  397  LVLANPVGSVIEKLQKSGKL-DSFGLNGVYLTVGEAVDDLSALWKSQ  442



>ref|XP_010249813.1| PREDICTED: probable sulfate transporter 3.4 [Nelumbo nucifera]
Length=655

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 171/227 (75%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAV+GLID  AAY +W VDK DF   + AFFGV F+SVQ GLAI
Sbjct  430  PLFTYTPNVILGAIIITAVIGLIDYRAAYRLWCVDKLDFFACMSAFFGVLFLSVQMGLAI  489

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIPGT I+++L  Y+ A   P FLIL IE+PV F N+ 
Sbjct  490  AVGVSMFKILLHVTRPNTVVLGNIPGTQIFQNLSRYQVASRVPSFLILGIESPVYFANSA  549

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E    ++  +S L+ VVLDMSA++AIDTSGI   ++LR TLEK+ ++
Sbjct  550  YLQERILRWVREEEDRIRES-NESPLKCVVLDMSAVTAIDTSGIEAIRELRKTLEKRLIQ  608

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VLVNP+GEV+EKL R+   +   K + L+LTVGEA+S +SS  K Q
Sbjct  609  FVLVNPVGEVMEKLHRSRILESF-KLNGLYLTVGEAISDISSLFKAQ  654



>gb|KHG20994.1| putative sulfate transporter 3.4 -like protein [Gossypium arboreum]
Length=657

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL I
Sbjct  435  PLFYYTPNVILAAIIITAVIGLIDYKAAYKLWKVDKLDFLACICSFFGVLFISVPLGLGI  494

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+I++P+ F N+T
Sbjct  495  AVGVSVFKILLHVTRPNTLVLGNIPATQIYQSLNRYKEASRVPSFLILAIDSPIYFANST  554

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+   E E  +   +S L+ +++DM++++AIDTSGI    +L+  L+K+ +E
Sbjct  555  YLQERLLRWV-REEEERIKANHESTLKCIIIDMTSVTAIDTSGIDMVCELKKMLDKRSLE  613

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ R+    +I+ ++SLFLTVGEAV+ +S++ K Q
Sbjct  614  LVLVNPVGSVMEKMHRS----NILGTNSLFLTVGEAVADISASWKPQ  656



>ref|XP_009338984.1| PREDICTED: probable sulfate transporter 3.4 [Pyrus x bretschneideri]
Length=656

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID  AAY +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  431  PLFYYTPNVILAAIIITAVSGLIDYQAAYRLWKVDKLDFMACMCSFFGVLFISVPLGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP TM LGNIPGT  Y +L+ Y+EA   P FLIL++EAP+ F N+T
Sbjct  491  AVGVSIFKILLHVTRPNTMALGNIPGTQTYHNLNRYREASRIPSFLILAVEAPIYFANST  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI  W+   E E  +   +S L+ V+LDM+A++AIDTSG     +LR  LEK+ ++
Sbjct  551  YLQERILGWV-CEEEERIKASNESTLKCVILDMTAVTAIDTSGTDMMSELRKMLEKRSLQ  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL+++ ET +    + L+LTVGEAV+ +SS  K Q
Sbjct  610  LVLANPVGSVMEKLKQS-ETLESFGLNGLYLTVGEAVADISSDWKAQ  655



>ref|XP_004505280.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Cicer 
arietinum]
Length=628

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIVTAV+GLIDIP+A  IWK+DKFDF+V+L AF GV   SVQ GLA+
Sbjct  419  PLFQYTPNVVLGAIIVTAVIGLIDIPSACHIWKIDKFDFLVMLTAFLGVILFSVQEGLAV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S F++LLQITRPKT+M+GNIPGT IYR+L  YKEA   PGFLILSIEAP+NF N T
Sbjct  479  AVGLSTFRILLQITRPKTVMMGNIPGTDIYRNLHQYKEATRIPGFLILSIEAPINFANIT  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL +R  RWI   E EE+  K+ S LRF++L+MSA+SAIDTSGIS FK+L+ T+EKKG+E
Sbjct  539  YLNDRTLRWI--EEEEEDNIKELSSLRFLILEMSAVSAIDTSGISLFKELKATMEKKGIE  596

Query  394  LVLVN  380
              + N
Sbjct  597  ARMFN  601



>gb|KJB13141.1| hypothetical protein B456_002G059100 [Gossypium raimondii]
Length=636

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +W VDK DF+  +C+FFGV FISV  GL I
Sbjct  414  PLFYYTPNVILAAIIITAVIGLIDYKAAYKLWNVDKLDFLACICSFFGVLFISVPLGLGI  473

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  474  AVGVSVFKILLHVTRPNTLVLGNIPATQIYQSLNRYKEASRVPSFLILAIESPIYFANST  533

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ + E E  +   +S L+ +++DM++++AIDTSGI    +L+  LEK+ + 
Sbjct  534  YLQERLLRWV-QEEEERIKANHESTLKCIIIDMTSVTAIDTSGIDMVCELKKMLEKRSLV  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ R+    +I+ ++SLFLTVGEAV+ +S++ K Q
Sbjct  593  LVLVNPVGSVMEKMHRS----NILGTNSLFLTVGEAVADISASWKPQ  635



>gb|KJB56717.1| hypothetical protein B456_009G132900 [Gossypium raimondii]
Length=665

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 174/227 (77%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF+  +C+FFGV FISV  GLAI
Sbjct  440  PLFYYTPNVILAAIIITAVIGLIDYRAAYKLWKVDKFDFLACMCSFFGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  500  AVGVSIFKILLHVTRPNTVVLGNIPRTQIYQSLNRYKEASRVPSFLILAIESPIYFANST  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ E E    ++  +S L+ +++DM+A+SAIDTSGI    +LR  LEK+ ++
Sbjct  560  YLQERMLRWVREEEERINES-HESTLKCIIIDMTAVSAIDTSGIDMLCELRKILEKRSLQ  618

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ +++  +    + S++LTVGEAV  ++++ K Q
Sbjct  619  LVLVNPVGSVMEKMHKSKILESFGMT-SMYLTVGEAVGDIAASWKPQ  664



>gb|KJB13144.1| hypothetical protein B456_002G059100 [Gossypium raimondii]
Length=658

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +W VDK DF+  +C+FFGV FISV  GL I
Sbjct  436  PLFYYTPNVILAAIIITAVIGLIDYKAAYKLWNVDKLDFLACICSFFGVLFISVPLGLGI  495

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  496  AVGVSVFKILLHVTRPNTLVLGNIPATQIYQSLNRYKEASRVPSFLILAIESPIYFANST  555

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ + E E  +   +S L+ +++DM++++AIDTSGI    +L+  LEK+ + 
Sbjct  556  YLQERLLRWV-QEEEERIKANHESTLKCIIIDMTSVTAIDTSGIDMVCELKKMLEKRSLV  614

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ R+    +I+ ++SLFLTVGEAV+ +S++ K Q
Sbjct  615  LVLVNPVGSVMEKMHRS----NILGTNSLFLTVGEAVADISASWKPQ  657



>gb|KJB13142.1| hypothetical protein B456_002G059100 [Gossypium raimondii]
Length=667

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +W VDK DF+  +C+FFGV FISV  GL I
Sbjct  445  PLFYYTPNVILAAIIITAVIGLIDYKAAYKLWNVDKLDFLACICSFFGVLFISVPLGLGI  504

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  505  AVGVSVFKILLHVTRPNTLVLGNIPATQIYQSLNRYKEASRVPSFLILAIESPIYFANST  564

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ + E E  +   +S L+ +++DM++++AIDTSGI    +L+  LEK+ + 
Sbjct  565  YLQERLLRWV-QEEEERIKANHESTLKCIIIDMTSVTAIDTSGIDMVCELKKMLEKRSLV  623

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ R+    +I+ ++SLFLTVGEAV+ +S++ K Q
Sbjct  624  LVLVNPVGSVMEKMHRS----NILGTNSLFLTVGEAVADISASWKPQ  666



>ref|XP_010545727.1| PREDICTED: probable sulfate transporter 3.4 [Tarenaya hassleriana]
Length=664

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK DF   LC+FFGV FISV  GLAI
Sbjct  437  PLFYYTPNFILAAIIITAVIGLIDYQAAYKLWKVDKLDFFACLCSFFGVLFISVPLGLAI  496

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T++LGNIPGT IY+ L  Y+EA   PGFLIL+IE+P+ F N T
Sbjct  497  AVGVSVLKILLHVTRPNTVVLGNIPGTEIYQSLGRYREASRIPGFLILAIESPIYFANCT  556

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E    +    + L+ V+L+++A+SAIDTSGI    +LR TLEK+ ++
Sbjct  557  YLQERILRWI-REEEGWIKGNNGNTLKCVILELTAVSAIDTSGIEAVFELRRTLEKQSLQ  615

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EKL +++ T D +    L+L+VGEAV+ +SS  K Q
Sbjct  616  LVLVNPVGSVMEKLHKSKIT-DALGMSGLYLSVGEAVADISSAWKAQ  661



>gb|KHN43015.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=601

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVILG II+TAV+GLID+P+AY IWK+DKFDF+V+L AFFGV FISVQ GLAI
Sbjct  408  PLFQYTPNVILGTIIITAVIGLIDLPSAYLIWKLDKFDFVVMLTAFFGVIFISVQLGLAI  467

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+F++LLQ+TRPKT+MLGNIP T IYR++ HY EA   PGFLILSIEAP+NF N T
Sbjct  468  AVGLSVFRILLQVTRPKTVMLGNIPATTIYRNIHHYNEATRVPGFLILSIEAPINFANIT  527

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RW++E EA          L+FV+L+MSA+SAIDTSG+S FKDL+ TL  KGV+
Sbjct  528  YLNERILRWVDEEEATI---NDNLCLQFVILEMSAVSAIDTSGVSLFKDLKTTLTMKGVQ  584

Query  394  LVLVN  380
              ++N
Sbjct  585  ARILN  589



>ref|XP_007135701.1| hypothetical protein PHAVU_010G151000g [Phaseolus vulgaris]
 gb|ESW07695.1| hypothetical protein PHAVU_010G151000g [Phaseolus vulgaris]
Length=661

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAVVGLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  436  PLFHYTPNVVLAAIIITAVVGLIDYQAAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  495

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL ++RP T++LGNIPGT I+ +L+ Y+EA+  P FLIL++E+P+ F N+T
Sbjct  496  AVGISVFKILLNVSRPNTLVLGNIPGTPIFHNLNQYREALRIPSFLILAVESPIYFANST  555

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  L+K+ ++
Sbjct  556  YLQERILRWV-REEEERVKANDESALKCIILDMTAVTAIDTSGIDTLCELRKVLDKRSLQ  614

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL  +    D      ++LTVGEAV+ +SS+ K Q
Sbjct  615  LVLANPVGNVMEKLHHS-NILDSFGLKGVYLTVGEAVADISSSWKAQ  660



>emb|CDY30127.1| BnaC05g37350D [Brassica napus]
Length=656

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 170/225 (76%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  429  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNIP T IY+ L  Y+EA   PGFLIL++E+P+ F N T
Sbjct  489  AVGVSVIKILLHVTRPNTLEFGNIPETQIYQSLKRYREASRIPGFLILAVESPIYFANCT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW  E E   ++  ++ +L+ ++LDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  549  YLQERISRWTREEENRIKENNER-NLKCIILDMTAVSSIDTSGIESVFELRRRLEKQSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAVS LSST K
Sbjct  608  LVLVNPVGSVMEKLHKSKIIESLGLSG-LYLTVGEAVSDLSSTWK  651



>ref|XP_012073326.1| PREDICTED: probable sulfate transporter 3.4 [Jatropha curcas]
Length=657

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK DF+  LC+F GV FISV  GLAI
Sbjct  432  PLFYYTPNFILAAIIITAVIGLIDYQAAYHLWKVDKLDFLACLCSFVGVLFISVPLGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T  +GNIPGT IY+ L+ Y+EA+  P  LIL+IE+P+ F N+T
Sbjct  492  AVGVSVFKILLHVTRPNTATMGNIPGTHIYQSLNRYREALRVPSILILAIESPIYFANST  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E E  +   +S L+ ++LDM+A++AIDT+GI    +LR  LEK+ ++
Sbjct  552  YLQERIARWI-REEEERIKANNESALKCIILDMTAVTAIDTTGIELLSELRKMLEKRSLQ  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKLQ++ +  D    + ++LTVGEAV  LS+  K Q
Sbjct  611  LVLANPVGSVIEKLQKSGKL-DSFGLNGVYLTVGEAVDDLSALWKSQ  656



>gb|EYU24685.1| hypothetical protein MIMGU_mgv1a002778mg [Erythranthe guttata]
Length=638

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  +AY +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  415  PLFHYTPNLILAAIIITAVIGLIDYQSAYKLWKVDKLDFVACLCSFFGVLFISVPIGLAI  474

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LL +TRP T  LGNI GT IYR+L+ YK+A+  P FLIL++EAP+ F N+T
Sbjct  475  AVGISIFKILLNVTRPNTAALGNIRGTQIYRNLNIYKDAVRVPSFLILAVEAPIYFANST  534

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E      QS+L+ V+LDM+A++AIDTSGI    +LR  LE + ++
Sbjct  535  YLQERIMRWV-REEEEWLALNNQSNLKCVILDMTAVTAIDTSGIDTISELRKVLENRSLK  593

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
             VL NP+G V+EKL +++  +     + L+LTVGEAV+ +SS+ K
Sbjct  594  FVLANPVGNVMEKLHKSKVLEPF-GLEGLYLTVGEAVADISSSWK  637



>ref|XP_008342718.1| PREDICTED: probable sulfate transporter 3.4 [Malus domestica]
Length=656

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 167/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GL+D  AAY +WKVDK DF+  +C+F GV FISV  GLAI
Sbjct  431  PLFYYTPNVILAAIIITAVSGLVDYQAAYRLWKVDKLDFMACMCSFLGVLFISVPLGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP TM LGNIPGT  Y +L+ Y+EA   P FLIL++EAP+ F N+T
Sbjct  491  AVGVSIFKILLHVTRPNTMALGNIPGTQTYHNLNRYREASRIPSFLILAVEAPIYFANST  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI  W+   E E  +   +S L+ V+LDM+A++AIDTSG     +LR  LEK+ ++
Sbjct  551  YLQERILGWV-REEEERIKASNESTLKCVILDMTAVTAIDTSGTDMMSELRKMLEKRSLQ  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL+++ ET +    + L+LTVGEAV+ +SS  K Q
Sbjct  610  LVLANPVGSVMEKLKQS-ETLESFGLNGLYLTVGEAVADISSDWKAQ  655



>gb|AGW45462.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1, 
partial [Reaumuria trigyna]
Length=595

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPNV+LGAII+TAVVGLIDIPAAY IWKVDK+DF+V +CAFFGV FISVQ GLAI
Sbjct  427  PLFRYTPNVVLGAIIITAVVGLIDIPAAYQIWKVDKYDFLVTICAFFGVIFISVQEGLAI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFKVLLQ+TRPKT++LGNIPGT IYR++  YK+A+  PGFLILSIEA +NF NTT
Sbjct  487  AVGLSIFKVLLQMTRPKTVVLGNIPGTDIYRNIHQYKDAVRVPGFLILSIEAAINFTNTT  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLR  422
            YL ERISRWI   + +EE++ K S LRF++L++SA+SAIDTSG+SF  +L+
Sbjct  547  YLNERISRWI--EDYQEEESSKHSCLRFLILELSAVSAIDTSGVSFLIELK  595



>ref|XP_009146179.1| PREDICTED: probable sulfate transporter 3.4 isoform X2 [Brassica 
rapa]
Length=646

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  419  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N T
Sbjct  479  AVGVSVIKILLHVTRPNTLEFGNIPGTQIYQSLKRYREASRVPGFLILAVESPLYFANCT  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++   + +L+ ++LDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  539  YLQERILRWTREEENRIKENNDR-NLKCIILDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAVS LSST K
Sbjct  598  LVLVNPVGSVMEKLHKSKIIESLGLS-GLYLTVGEAVSDLSSTWK  641



>ref|XP_009146178.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Brassica 
rapa]
Length=656

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  429  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N T
Sbjct  489  AVGVSVIKILLHVTRPNTLEFGNIPGTQIYQSLKRYREASRVPGFLILAVESPLYFANCT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++   + +L+ ++LDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  549  YLQERILRWTREEENRIKENNDR-NLKCIILDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAVS LSST K
Sbjct  608  LVLVNPVGSVMEKLHKSKIIESLGLS-GLYLTVGEAVSDLSSTWK  651



>emb|CDO98069.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP+VILGAII+TAV+GLID  AAY +WKVDK DF+  LC+F GV FISV  GLAI
Sbjct  440  PLFYYTPSVILGAIIITAVIGLIDYQAAYKLWKVDKLDFLACLCSFLGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIPGT IY+++  Y EA+  P FL+L++EAP  F N T
Sbjct  500  AVGVSVFKILLHVTRPNTVVLGNIPGTQIYQNISRYTEALRVPSFLVLAVEAPFYFANAT  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  Q   +S L+ ++LDM+A++AIDTSGI    ++R  LE + ++
Sbjct  560  YLQERILRWV-REEEERIQANNESKLKCIILDMTAVTAIDTSGIDTICEVRKALENRSLK  618

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL ++    D    D L+LTVGEAV+ +SS+ K
Sbjct  619  LVLANPVGSVMEKLHQS-NILDSFGLDGLYLTVGEAVADISSSWK  662



>gb|ABB59575.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=639

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV +GL I
Sbjct  414  PLFYYTPNVILGAIIVTAVIGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPSGLGI  473

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNI GT +Y+ L  YKEA   P FL+L+IE+P+ F N+T
Sbjct  474  AVGVSVFKILLHVTRPNTLIMGNIRGTNVYQCLGRYKEASRIPSFLVLAIESPIYFANST  533

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +  L+ V+LDM+A++AIDTSGI    +LR  LEK+  +
Sbjct  534  YLQERILRWI-REEEDWIKANNEDTLKCVILDMTAVTAIDTSGIDLVCELRKMLEKRSFQ  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++ +T D    + ++LTVGEAV+ +S+  K Q
Sbjct  593  LVLANPVGSVMEKLHQS-KTLDSFGLNGIYLTVGEAVADISALWKSQ  638



>ref|XP_007217635.1| hypothetical protein PRUPE_ppa002586mg [Prunus persica]
 gb|EMJ18834.1| hypothetical protein PRUPE_ppa002586mg [Prunus persica]
Length=655

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID  AAY +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  430  PLFYYTPNVILAAIIITAVSGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPLGLAI  489

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP TM+LGNIP T  +  L+ Y+EA+  P FLIL+IEAP+ F NTT
Sbjct  490  AVGVSIFKILLHVTRPNTMVLGNIPRTQTFHSLNRYREALRIPSFLILAIEAPIYFANTT  549

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSG     +LR  L+K+ ++
Sbjct  550  YLQERILRWV-REEEERIKASNESTLKCIILDMTAVTAIDTSGTDMMFELRKMLDKRSLQ  608

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKLQ++ +T +    + ++LTVGEAV+ +SS  K Q
Sbjct  609  LVLANPVGTVMEKLQQS-KTLESFGLNGVYLTVGEAVADISSAWKAQ  654



>ref|XP_006297165.1| hypothetical protein CARUB_v10013170mg [Capsella rubella]
 gb|EOA30063.1| hypothetical protein CARUB_v10013170mg [Capsella rubella]
Length=654

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  427  PLFYYTPNVILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L+ Y+EA   PGFLIL++E+P+ F N+T
Sbjct  487  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLERYREASRIPGFLILAVESPIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++T   + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  547  YLQERILRWTREEETRIKETNG-TTLKCIILDMTAVSAIDTSGLDAVFELRRRLEKQSLQ  605

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV  LSST K
Sbjct  606  LVLVNPVGTVMEKLHKSKIIESLGLS-GLYLTVGEAVDDLSSTWK  649



>ref|XP_002303279.2| sulfate transporter 3.4 family protein [Populus trichocarpa]
 gb|EEE78258.2| sulfate transporter 3.4 family protein [Populus trichocarpa]
Length=628

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV +GL I
Sbjct  403  PLFYYTPNVILGAIIVTAVIGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPSGLGI  462

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNI GT +Y+ L  YKE    P FLIL+IE+P+ F N+T
Sbjct  463  AVGVSVFKILLHVTRPNTLIMGNIRGTNVYQCLGRYKETSRVPSFLILAIESPIYFANST  522

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +  L+ V+LDM+A++AIDTSGI    +LR  LEK+  +
Sbjct  523  YLQERILRWI-REEEDWIKANNEGTLKCVILDMTAVTAIDTSGIDLVCELRKMLEKRSFQ  581

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++ +T D    + ++LTVGEAV+ +S+  K Q
Sbjct  582  LVLANPVGSVMEKLHQS-KTLDSFGLNGIYLTVGEAVADISALWKSQ  627



>emb|CDX97715.1| BnaA05g23640D [Brassica napus]
Length=656

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  429  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N T
Sbjct  489  AVGVSVIKILLHVTRPNTVEFGNIPGTQIYQSLKRYREASRVPGFLILAVESPLYFANCT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++   + +L+ ++LDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  549  YLQERILRWTREEENRIKENNDR-NLKCIILDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAVS LSST K
Sbjct  608  LVLVNPVGSVMEKLHKSKIIESLGLS-GLYLTVGEAVSDLSSTWK  651



>ref|XP_002528191.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF34198.1| sulfate transporter, putative [Ricinus communis]
Length=662

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 170/227 (75%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID   AY +WKVDK DF   LC+F GV FISV  GLAI
Sbjct  437  PLFYYTPNVILAAIIITAVIGLIDYRGAYELWKVDKLDFFACLCSFLGVLFISVPLGLAI  496

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNIPGT IY+ L+ Y+EA+  P  LIL+IE+P+ F N+T
Sbjct  497  AVGVSVFKILLHVTRPNTVIMGNIPGTQIYQSLNRYREALRVPSILILAIESPIYFANST  556

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI F  +LR  L+K+ ++
Sbjct  557  YLQERILRWV-REEEERIKANNESPLKCIILDMTAVTAIDTSGIDFVCELRKMLDKRTLQ  615

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EKLQ + +  D    + L+L+VGEAV+ +S+  K Q
Sbjct  616  LVLVNPVGSVMEKLQES-KILDSFGLNGLYLSVGEAVTDISALWKSQ  661



>ref|XP_010098035.1| putative sulfate transporter 3.4 [Morus notabilis]
 gb|EXB74472.1| putative sulfate transporter 3.4 [Morus notabilis]
Length=723

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 168/228 (74%), Gaps = 2/228 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  +AY +WKVDK DF+  L +FFGV FISV  GLAI
Sbjct  429  PLFYYTPNVILAAIIITAVIGLIDYQSAYRLWKVDKLDFLACLASFFGVLFISVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP TM LGNIPGT IY++L  Y+EA   P FLIL++E+P+ F N+T
Sbjct  489  AVGVSVFKILLHVTRPNTMALGNIPGTQIYQNLTRYREAFRVPSFLILAVESPIYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E     T   S L+ ++LDM+A++AIDTSGI   ++L+  L+K+ ++
Sbjct  549  YLQERILRWVREEEERILAT-NDSTLKCIILDMTAVTAIDTSGIDMIRELKKMLDKRSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQV  251
            LVL NP G V+EKLQ++    +    + ++LTVGEA+  +SS  K QV
Sbjct  608  LVLANPGGTVMEKLQQSNAL-EAFGCNGVYLTVGEAIGDISSLCKAQV  654



>ref|XP_007024090.1| Sulfate transporter 3,4 [Theobroma cacao]
 gb|EOY26712.1| Sulfate transporter 3,4 [Theobroma cacao]
Length=665

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 172/227 (76%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  440  PLFYYTPNVILGAIIITAVIGLIDYQAAYKLWKVDKLDFLACVCSFFGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIP T IY+ L+ Y+EA   P FLIL+IE+P+ F N+T
Sbjct  500  AVGVSVFKILLHVTRPNTLVLGNIPRTEIYQSLNRYREASRVPSFLILAIESPIYFANST  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +  ++S L+ +++DM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  560  YLQERILRWV-REEEEWIKANRESTLKCIIIDMTAVTAIDTSGIDMVCELRKMLEKRSLQ  618

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V EKL  ++  +     ++ +LTVG+AV+ +S++ K Q
Sbjct  619  LVLVNPVGSVTEKLHHSKILESF-GMNAFYLTVGKAVADVSASWKPQ  664



>ref|XP_008228574.1| PREDICTED: probable sulfate transporter 3.4 [Prunus mume]
Length=655

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 170/227 (75%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID  AAY +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  430  PLFYYTPNVILAAIIITAVSGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPLGLAI  489

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A G+SIFK+LL +TRP TM+LGNIP T  +++L+ Y+EA+  P FLIL++EAP+ F NTT
Sbjct  490  AAGVSIFKILLHVTRPNTMVLGNIPRTQTFQNLNRYREALRIPSFLILAVEAPIYFANTT  549

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSG     +LR  L+K+ ++
Sbjct  550  YLQERILRWV-REEEERIKASNESTLKCIILDMTAVTAIDTSGTDMMFELRKMLDKRSLQ  608

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKLQ++ +T +    + ++LTVGEAV+ +SS  K Q
Sbjct  609  LVLANPVGTVMEKLQQS-KTLESFGLNGVYLTVGEAVADISSAWKAQ  654



>gb|ABB59576.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=639

 Score =   253 bits (646),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAIIVTAV+GLID  AAY +WKVDK DF+  LC+FF V FISV +GL I
Sbjct  414  PLFYYTPNVILGAIIVTAVIGLIDYQAAYRLWKVDKLDFLACLCSFFSVLFISVPSGLGI  473

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNI GT +Y+ L  YKEA   P FL+L+IE+P+ F N+T
Sbjct  474  AVGVSVFKILLHVTRPNTLIMGNIRGTNVYQCLGRYKEASRIPSFLVLAIESPIYFANST  533

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +  L+ V+LDM+A++AIDTSGI    +LR  LEK+  +
Sbjct  534  YLQERILRWI-REEEDWIKANNEGALKCVILDMTAVTAIDTSGIDLVCELRKMLEKRSFQ  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++ +T D    + ++LTVGEAV+ +S+  K Q
Sbjct  593  LVLANPVGSVMEKLHQS-KTLDSFGLNGIYLTVGEAVADISTLWKSQ  638



>gb|KHG08777.1| putative sulfate transporter 3.4 -like protein [Gossypium arboreum]
Length=665

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 171/227 (75%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  440  PLFYYTPNVILAAIIITAVIGLIDYRAAYKLWKVDKLDFLACICSFFGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  500  AVGVSIFKILLHVTRPNTVVLGNIPRTQIYQSLNRYKEASRVPSFLILAIESPIYFANST  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER+ RW+ E E    ++  +S L+ +++DM+A+SAIDTSGI    +LR  LEK+ ++
Sbjct  560  YLHERMLRWVREEEERINES-HESTLKCIIIDMTAVSAIDTSGIDMLCELRKILEKRSLQ  618

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EK+ +++  +    S S++LTV EAV  ++++ K Q
Sbjct  619  LVLVNPVGSVMEKMHKSKILESFGMS-SMYLTVAEAVGDIAASWKPQ  664



>gb|KFK38950.1| hypothetical protein AALP_AA3G181100 [Arabis alpina]
Length=656

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF   LC+FFGV F+SV  GLAI
Sbjct  429  PLFYYTPNVILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCLCSFFGVLFVSVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNI GT IY+ L  YKEA   PGFLIL+IE+P+ F N+T
Sbjct  489  AVGVSVMKILLNVTRPNTTEFGNIAGTDIYQSLGRYKEASRIPGFLILAIESPIYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    S L+ ++LDM+A+S+IDTSG+    +LR  LEK+ ++
Sbjct  549  YLQERILRWTREEETRVKE-NNCSTLKCIILDMTAVSSIDTSGLEAVFELRRRLEKQSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  608  LVLVNPVGSVMEKLHKSKIVESLGMSG-LYLTVGEAVADLSSTWK  651



>ref|XP_006451104.1| hypothetical protein CICLE_v10010204mg [Citrus clementina]
 gb|ESR64344.1| hypothetical protein CICLE_v10010204mg [Citrus clementina]
Length=631

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP+ +L AII+TAVVGL+D  AA  +WK+DK DF+   C+FFGV FISVQ GLAI
Sbjct  406  PLFHYTPDFVLAAIIITAVVGLVDYKAALRLWKLDKLDFVACCCSFFGVLFISVQIGLAI  465

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK++L +TRP T++LGNIPGT I+R L+HY+ A   P FLILSIE+P+ F N+ 
Sbjct  466  AVGVSVFKIILHVTRPNTVVLGNIPGTQIFRSLNHYENATRVPSFLILSIESPIFFANSL  525

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW+   E    +  +++ L+ V+LDM+A++AIDTSGI    +L+  ++K+ ++
Sbjct  526  YLQERISRWVRGEENRIRENNERA-LKCVILDMTAVTAIDTSGIDAISELKKNMDKRSLQ  584

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            L LVN +G V+EKL ++ +T D  +S  L+LTVGEAV  LSS+ K
Sbjct  585  LALVNLVGTVMEKLHQS-KTLDSFRSKGLYLTVGEAVDDLSSSWK  628



>gb|KDO54167.1| hypothetical protein CISIN_1g005883mg [Citrus sinensis]
Length=672

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP+ +L AII+TAVVGL+D  AA  +WK+DK DF+   C+FFGV FISVQ GLAI
Sbjct  447  PLFHYTPDFVLAAIIITAVVGLVDYKAALRLWKLDKLDFVACCCSFFGVLFISVQIGLAI  506

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK++L +TRP T++LGNIPGT I+R L+HY+ A   P FLILSIE+P+ F N+ 
Sbjct  507  AVGVSVFKIILHVTRPNTVVLGNIPGTQIFRSLNHYENATRVPSFLILSIESPIFFANSL  566

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW+   E    +   +S L+ V+LDM+A++AIDTSGI    +L+  ++K+ ++
Sbjct  567  YLQERISRWVRGEENRIRE-NNESALKCVILDMTAVTAIDTSGIDAISELKKNMDKRSLQ  625

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            L LVN +G V+EKL ++ +T D  +S  L+LTVGEAV  LSS+ K
Sbjct  626  LALVNLVGTVMEKLHQS-KTLDSFRSKGLYLTVGEAVDDLSSSWK  669



>gb|EYU21552.1| hypothetical protein MIMGU_mgv1a002572mg [Erythranthe guttata]
Length=657

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 175/228 (77%), Gaps = 8/228 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY++WKVDK DF+  LC+F GV FISV  GLAI
Sbjct  432  PLFHYTPNLILAAIIITAVIGLIDYEAAYNLWKVDKLDFLACLCSFLGVLFISVPLGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNIPGT IY+++  Y+EA+  P FL++++EAP+ F N+T
Sbjct  492  AVGVSVFKILLHVTRPNTAVLGNIPGTQIYQNVGRYREAVRVPFFLVIAVEAPMYFANST  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI E E     +  +S+++ V+LDM+A++AIDTSGI    +LR  L+K+ ++
Sbjct  552  YLQERIIRWIREEEEWLA-SNNRSNIKCVILDMTAVTAIDTSGIDTISELRKILDKRSLK  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKS---DSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL ++    ++++S   + L+LTVGEA++ +SS+ K
Sbjct  611  LVLANPVGSVMEKLHQS----NVLESFGLEGLYLTVGEAITDISSSWK  654



>ref|XP_010691282.1| PREDICTED: probable sulfate transporter 3.4 [Beta vulgaris subsp. 
vulgaris]
Length=680

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAV+GLID  AA+ +WKVDK DF+  +C+FFGV F+SV  GLAI
Sbjct  455  PLFYYTPTVILAAIIITAVIGLIDYQAAFRLWKVDKLDFLACVCSFFGVLFVSVPLGLAI  514

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VGIS+FK+LL +TRP T  LGNIPGT IY+ L  Y+EA+  P FLILS+E+P+ F N+T
Sbjct  515  SVGISVFKILLHVTRPNTTALGNIPGTQIYQSLGRYREAMRIPSFLILSVESPIYFANST  574

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ + E E  +   +S ++ V+LDMSA++AIDTSGI    +LR  LE++ ++
Sbjct  575  YLQERVLRWV-QEEEERVKANSESMMKCVILDMSAVTAIDTSGIELLSELRKILERRSLQ  633

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP G V+EKL  ++  +    S  L+LTVGEA++ +S++ K Q
Sbjct  634  LVLANPAGNVMEKLHFSKALESF-GSQGLYLTVGEAITDISASWKAQ  679



>ref|XP_002882970.1| SULTR3_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59229.1| SULTR3_4 [Arabidopsis lyrata subsp. lyrata]
Length=655

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF   LC+FFGV F+SV  GLAI
Sbjct  428  PLFYYTPNVILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCLCSFFGVLFVSVPLGLAI  487

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFLIL+IE+P+ F N+T
Sbjct  488  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLILAIESPIYFANST  547

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL++RI RW  E E   ++    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  548  YLQDRILRWTREEETRIKEING-TTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  606

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  607  LVLVNPVGTVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  650



>ref|XP_006476102.1| PREDICTED: probable sulfate transporter 3.4-like [Citrus sinensis]
Length=672

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP+ +L AII+TAVVGL+D  AA  +WK+DK DF+   C+FFGV FISVQ GLAI
Sbjct  447  PLFHYTPDFVLAAIIITAVVGLVDYKAALRLWKLDKLDFVACCCSFFGVLFISVQIGLAI  506

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK++L +TRP T++LGNIPGT I+R L+HY+ A   P FLILSIE+P+ F N+ 
Sbjct  507  AVGVSVFKIILHVTRPNTVVLGNIPGTQIFRSLNHYENATRVPSFLILSIESPIFFANSL  566

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW+   E    +  +++ L+ V+LDM+A++AIDTSGI    +L+  ++K+ ++
Sbjct  567  YLQERISRWVRGEENRIRENNERA-LKCVILDMTAVTAIDTSGIDAISELKKNMDKRSLQ  625

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            L LVN +G V+EKL ++ +T D  +S  L+LTVGEAV  LSS+ K
Sbjct  626  LALVNLVGTVMEKLHQS-KTLDSFRSKGLYLTVGEAVDDLSSSWK  669



>emb|CAN70927.1| hypothetical protein VITISV_043810 [Vitis vinifera]
Length=664

 Score =   252 bits (644),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK D    LC+FFGV FISV  GLAI
Sbjct  439  PLFHYTPNFILAAIIITAVIGLIDYEAAYKLWKVDKLDCFACLCSFFGVLFISVPLGLAI  498

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FKVLL +TRP TM+LGNIPGT IY++   Y+EA+  P FLIL++E+P+ F N+T
Sbjct  499  AVGVSVFKVLLHVTRPNTMVLGNIPGTQIYQNPSRYREAMKVPSFLILAVESPIYFANST  558

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y++ERI RW+   E E+ Q    + L+ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  559  YIQERILRWV-REEEEQIQANNGNALKCVILDMTAVTAIDTSGIDXICELRKMLEKRSLQ  617

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VL NP G V+EKL ++ +  D    + L+L VGEAV+ +SS  K Q
Sbjct  618  FVLANPAGNVMEKLHQS-KILDSFGLNGLYLAVGEAVADISSLWKAQ  663



>emb|CBI36164.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK D    LC+FFGV FISV  GLAI
Sbjct  406  PLFHYTPNFILAAIIITAVIGLIDYEAAYKLWKVDKLDCFACLCSFFGVLFISVPLGLAI  465

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FKVLL +TRP TM+LGNIPGT IY++   Y+EA+  P FLIL++E+P+ F N+T
Sbjct  466  AVGVSVFKVLLHVTRPNTMVLGNIPGTQIYQNPSRYREAMKVPSFLILAVESPIYFANST  525

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y++ERI RW+   E E+ Q    + L+ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  526  YIQERILRWV-REEEEQIQANNGNALKCVILDMTAVTAIDTSGIDVICELRKMLEKRSLQ  584

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VL NP G V+EKL ++ +  D    + L+L VGEAV+ +SS  K Q
Sbjct  585  FVLANPAGNVMEKLHQS-KILDSFGLNGLYLAVGEAVADISSLWKAQ  630



>ref|XP_010487443.1| PREDICTED: probable sulfate transporter 3.4 [Camelina sativa]
Length=659

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL  II+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  432  PLFYYTPNVILAVIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N+T
Sbjct  492  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLILAVESPIYFANST  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  552  YLQERILRWTREEETRIKENNG-TTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL ++ +  D +    L+LTVGEAV+ LSST K
Sbjct  611  LVLVNPVGTVMEKLHKS-KIIDALGLSGLYLTVGEAVADLSSTWK  654



>ref|XP_003632863.1| PREDICTED: probable sulfate transporter 3.4 [Vitis vinifera]
Length=664

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AAY +WKVDK D    LC+FFGV FISV  GLAI
Sbjct  439  PLFHYTPNFILAAIIITAVIGLIDYEAAYKLWKVDKLDCFACLCSFFGVLFISVPLGLAI  498

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FKVLL +TRP TM+LGNIPGT IY++   Y+EA+  P FLIL++E+P+ F N+T
Sbjct  499  AVGVSVFKVLLHVTRPNTMVLGNIPGTQIYQNPSRYREAMKVPSFLILAVESPIYFANST  558

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y++ERI RW+   E E+ Q    + L+ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  559  YIQERILRWV-REEEEQIQANNGNALKCVILDMTAVTAIDTSGIDVICELRKMLEKRSLQ  617

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VL NP G V+EKL ++ +  D    + L+L VGEAV+ +SS  K Q
Sbjct  618  FVLANPAGNVMEKLHQS-KILDSFGLNGLYLAVGEAVADISSLWKAQ  663



>emb|CAG28416.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=656

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID   AY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  429  PLFYYTPNLILAAIILTAVIGLIDYQPAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNIP T IY+ L  Y+EA   PGFLIL++E+P+ F N T
Sbjct  489  AVGVSVIKILLHVTRPNTLEFGNIPETQIYQSLKRYREASRIPGFLILAVESPIYFANCT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW  E E   ++  ++ +L+ ++LDM+A+S+IDTSGI    +LR  LE + ++
Sbjct  549  YLQERISRWTREEENRIKENNER-NLKCIILDMTAVSSIDTSGIESVFELRRRLENQSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAVS LSST K
Sbjct  608  LVLVNPVGSVMEKLHKSKIIESLGLS-GLYLTVGEAVSDLSSTWK  651



>ref|XP_011000828.1| PREDICTED: probable sulfate transporter 3.4 [Populus euphratica]
Length=656

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV +GL I
Sbjct  431  PLFYYTPNVILGAIIITAVIGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPSGLGI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNI GT +Y+ L  YKE    P FLIL+IE+P+ F N+T
Sbjct  491  AVGVSVFKILLHVTRPNTLIMGNIRGTNVYQCLGRYKETSRVPSFLILAIESPIYFANST  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +  L+ V+LDM+A++AIDTSGI    +LR  LEK+  +
Sbjct  551  YLQERILRWI-REEEDWIKANNEGTLKCVILDMTAVTAIDTSGIDLVCELRKMLEKRSFQ  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL +++   D    + ++LTVGEAV+ +S   K Q
Sbjct  610  LVLANPVGSVMEKLHQSKAL-DSFGLNGIYLTVGEAVADISVLWKSQ  655



>ref|XP_011000827.1| PREDICTED: probable sulfate transporter 3.4 [Populus euphratica]
Length=656

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV +GL I
Sbjct  431  PLFYYTPNVILGAIIITAVIGLIDYQAAYRLWKVDKLDFLACMCSFFGVLFISVPSGLGI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+++GNI GT +Y+ L  YKE    P FLIL+IE+P+ F N+T
Sbjct  491  AVGVSVFKILLHVTRPNTLIMGNIRGTNVYQCLGRYKETSRVPSFLILAIESPIYFANST  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +  L+ V+LDM+A++AIDTSGI    +LR  LEK+  +
Sbjct  551  YLQERILRWI-REEEDWIKANNEGTLKCVILDMTAVTAIDTSGIDLVCELRKMLEKRSFQ  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL +++   D    + ++LTVGEAV+ +S   K Q
Sbjct  610  LVLANPVGSVMEKLHQSKAL-DSFGLNGIYLTVGEAVADISVLWKSQ  655



>gb|ABK24712.1| unknown [Picea sitchensis]
Length=491

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 169/228 (74%), Gaps = 2/228 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ AV+GLID PAAY IWKVDK DF+  + AF GV FIS+Q GL I
Sbjct  266  PLFYYTPGVVLASIIIAAVLGLIDFPAAYFIWKVDKVDFLACVGAFLGVIFISLQMGLLI  325

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL +TRP T + G IPGT  YR+++ Y EA   P FLIL I+AP+ F N+T
Sbjct  326  AVGISVFKILLHVTRPHTSLQGKIPGTNYYRNIEQYSEATRIPAFLILRIDAPIYFANST  385

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RW+   E +  +++    L++V+LD++A++ IDT+G++   +++ TLEK+G++
Sbjct  386  YLKERIMRWV-SEEEDRIESENDDTLQYVILDLTAVTTIDTTGVNIVVEVKKTLEKRGLQ  444

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQV  251
            + +VNP   V+EKL+RA+  +++ + D L+LTVGEAVS+ SS  K QV
Sbjct  445  VAMVNPGAGVMEKLRRADLIQNLGQ-DCLYLTVGEAVSSRSSAFKEQV  491



>ref|XP_003529722.1| PREDICTED: probable sulfate transporter 3.4-like [Glycine max]
Length=648

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  423  PLFYYTPNVVLAAIIITAVSGLIDYQAAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  482

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +L+ Y+EA+  P F+IL++E+P+ F N+T
Sbjct  483  AVAISVFKILLHVSRPNTLVLGNIPGTPIFHNLNQYREALRIPSFIILAVESPIYFANST  542

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  543  YLQERILRWV-REEEERVKANNESTLKCIILDMTAVTAIDTSGIDTLCELRKVLEKRSLQ  601

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    D      ++L+VGEAV+ +SS+ K Q
Sbjct  602  LVLTNPVGNVMEKLHQS-NILDSFGLKGVYLSVGEAVADISSSWKAQ  647



>gb|KHN39335.1| Putative sulfate transporter 3.4 [Glycine soja]
Length=649

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 171/230 (74%), Gaps = 8/230 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  424  PLFYYTPNVVLAAIIITAVSGLIDYQAAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +L+ Y+EA+  P F+IL++E+P+ F N+T
Sbjct  484  AVAISVFKILLHVSRPTTLVLGNIPGTPIFHNLNQYREALRIPSFIILAVESPIYFANST  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  544  YLQERILRWV-REEEERVKANNESTLKCIILDMTAVTAIDTSGIDTLCELRKVLEKRSLQ  602

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSL---FLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    +I+ S  L   +L+VGEAV+ +SS+ K Q
Sbjct  603  LVLTNPVGNVMEKLHQS----NILNSFGLKGVYLSVGEAVADISSSWKAQ  648



>ref|XP_010503650.1| PREDICTED: probable sulfate transporter 3.4 [Camelina sativa]
Length=659

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL  II+TAV+GLID  AAY +WKVDKFDF   +C+FFGV F+SV  GLAI
Sbjct  432  PLFYYTPNVILAVIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLFVSVPLGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFL+L++E+P+ F N+T
Sbjct  492  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLVLAVESPIYFANST  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI +W  E E   ++    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  552  YLQERILKWTREEETRIKENNG-TTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL ++ +  D +    L+LTVGEAV+ LSST K
Sbjct  611  LVLVNPVGTVMEKLHKS-KIIDALGLSGLYLTVGEAVADLSSTWK  654



>ref|NP_188220.1| putative sulfate transporter 3;4 [Arabidopsis thaliana]
 sp|Q9LW86.1|SUT34_ARATH RecName: Full=Probable sulfate transporter 3.4 [Arabidopsis thaliana]
 dbj|BAB02665.1| sulfate transporter [Arabidopsis thaliana]
 dbj|BAB21264.1| sulfate transporter Sultr3;4 [Arabidopsis thaliana]
 gb|AEE75760.1| putative sulfate transporter 3;4 [Arabidopsis thaliana]
Length=653

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF   LC+FFGV F+SV  GLAI
Sbjct  426  PLFYYTPNVILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCLCSFFGVLFVSVPLGLAI  485

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFLIL+IE+P+ F N+T
Sbjct  486  AVAVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLILAIESPIYFANST  545

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL++RI RW    E    +    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  546  YLQDRILRW-AREEENRIKENNGTTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  604

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  605  LVLVNPVGTVMEKLHKSKIIEALGLSG-LYLTVGEAVADLSSTWK  648



>ref|XP_011002696.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Populus 
euphratica]
Length=669

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII++AV+GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  427  PLFYYTPNVILGAIIISAVIGLIDYQAAYCLWKVDKLDFLACLCSFFGVLFISVPLGLGI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP ++++GNI GT IY  L  YKEA   P FLIL+IE+P+ F N+T
Sbjct  487  AVGVSVFKILLHVTRPNSLIMGNIKGTQIYHSLSRYKEASRVPSFLILAIESPIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E E  +    S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  547  YLQERILRWI-REEDEWIKANDGSPLKCIILDMTAVTAIDTSGIDLLCELRKMLEKRSLK  605

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL +++   D    + ++L VGEAV+ +S+  K Q
Sbjct  606  LVLANPVGSVMEKLHQSKML-DSFGLNGIYLAVGEAVADISALWKSQ  651



>emb|CDY21893.1| BnaC01g35550D [Brassica napus]
Length=641

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 169/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV  +SV  GLAI
Sbjct  414  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLLVSVPLGLAI  473

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNI GT IY+ +  Y+EA   PGFLIL++E+P+ F N+T
Sbjct  474  AVGVSVLKILLHVTRPNTLEFGNIQGTQIYQSVKRYREASRIPGFLILAVESPIYFANST  533

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI E EA  ++    S L+ ++LDM+A+S+IDT+GI    +LR  LEK+ ++
Sbjct  534  YLQERILRWIREEEARIKENNG-STLKCIILDMTAVSSIDTNGIEALFELRRRLEKQSLQ  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  593  LVLVNPVGSVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  636



>gb|ABB59574.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=622

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII++AV+GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  380  PLFYYTPNVILGAIIISAVIGLIDYQAAYCLWKVDKLDFLACLCSFFGVIFISVPLGLGI  439

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP + ++GNI GT IY  L  YKEA   P FLIL+IE+P+ F N+T
Sbjct  440  AVGVSVFKILLHVTRPNSSIMGNIKGTQIYHSLSRYKEASRVPSFLILAIESPIYFANST  499

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RWI   E E  +    S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  500  YLQERVLRWI-REEDEWIKANNGSPLKCIILDMTAVTAIDTSGIDLLCELRKMLEKRSLK  558

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL +++   D    + ++L VGEAV+ +S+  K Q
Sbjct  559  LVLTNPVGSVMEKLHQSKML-DSFGLNGIYLAVGEAVADISALWKSQ  604



>gb|KEH39568.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=647

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 168/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L  II+ AV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL+I
Sbjct  422  PLFYYTPNVVLATIIIAAVIGLIDYQAAYKLWKVDKLDFLACMCSFFGVLFISVPLGLSI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +++ YKEA+  P FLIL++E+P+ F N+T
Sbjct  482  AVAISVFKILLHVSRPNTLVLGNIPGTQIFHNINQYKEALRVPSFLILAVESPIYFANST  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E   ++    S L+ ++LDM+A++AIDTSG+    +LR  LEK+ ++
Sbjct  542  YLRERILRWVREEEERIKEYNGTS-LQCIILDMTAVTAIDTSGLETLGELRKMLEKRSLQ  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EKL  + +  D      L+LTVGEAV+ +S + K Q
Sbjct  601  LVLVNPVGNVMEKLHMS-KILDTFGFKGLYLTVGEAVADISKSEKAQ  646



>ref|XP_004486722.1| PREDICTED: probable sulfate transporter 3.4-like [Cicer arietinum]
Length=649

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN++L AII+ AVVGLID  AAY +WKVDK DF+  +C+FFGV FISV  GL+I
Sbjct  424  PLFYYTPNLVLAAIIIAAVVGLIDFQAAYKLWKVDKLDFLACMCSFFGVLFISVPLGLSI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP TM+LGNIPGT I+ +++ YKEA+  P FL+L++E+P+ F N+T
Sbjct  484  AVAISVFKILLHVSRPNTMVLGNIPGTQIFHNINQYKEALRIPSFLVLAVESPIYFANST  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E + +    +S L  ++LDM+A++AIDTSG+    +LR  LE++ ++
Sbjct  544  YLRERILRWVREEEEQIKAHNGKS-LECIILDMTAVTAIDTSGLETLGELRKMLEQRSLK  602

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVLVNP+G V+EKL  + +  D      ++LTVGEAV+ +SS  K Q
Sbjct  603  LVLVNPVGNVMEKLHTS-KILDTFGFKGVYLTVGEAVAGISSLEKAQ  648



>ref|XP_004302921.1| PREDICTED: probable sulfate transporter 3.4 [Fragaria vesca subsp. 
vesca]
Length=664

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL  II+TAV GLID  AAY +WKVDK D +  LC+FFGV FISV  GLAI
Sbjct  439  PLFYYTPNVILATIILTAVSGLIDYQAAYDLWKVDKLDCMACLCSFFGVLFISVPIGLAI  498

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP TM LGNIPGT IY++L+ Y EA   P FLIL+IEAP  F N+T
Sbjct  499  AVGVSVFKILLHVTRPNTMALGNIPGTQIYQNLNRYGEASRIPSFLILAIEAPFYFANST  558

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  ++  +  L+ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  559  YLQERILRWV-REEEERIKSNNEGILKCVILDMTAVTAIDTSGIDTLSELRKMLEKRLLQ  617

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKLQ++ +T      + ++LTVGEAV+  SS  K
Sbjct  618  LVLANPVGSVMEKLQQS-KTLGSFGLNGVYLTVGEAVADTSSLWK  661



>ref|XP_011072325.1| PREDICTED: probable sulfate transporter 3.4 [Sesamum indicum]
Length=672

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 173/230 (75%), Gaps = 8/230 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AA  +WKVDK DF+  LC+F GV FISV  GLAI
Sbjct  447  PLFYYTPNLILAAIIITAVIGLIDYQAAIKLWKVDKLDFLACLCSFLGVLFISVPLGLAI  506

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T++LGNIPGT IY++L  Y++A+  P FLI+++EAP+ F N+T
Sbjct  507  AVGVSVFKILLHVTRPNTVILGNIPGTQIYQNLSRYRDAVRVPSFLIIAVEAPMYFANST  566

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI RWI E E     +  +S+++ V+LDM+A++AIDTSGI    +LR  L+K+ ++
Sbjct  567  YLHERILRWIREEEEWLA-SNNRSNMKCVILDMTAVTAIDTSGIDTINELRKMLDKRSLK  625

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKS---DSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    ++++S   + +++TVGEAV+ +SS  K Q
Sbjct  626  LVLANPVGSVMEKLHQS----NVLESFGLEGVYVTVGEAVADISSAWKAQ  671



>ref|XP_003531685.1| PREDICTED: probable sulfate transporter 3.4-like [Glycine max]
Length=663

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 167/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAVVGLID   AY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  438  PLFYYTPNVVLAAIIITAVVGLIDYQGAYKLWKVDKLDFLACLCSFFGVWFISVPLGLGI  497

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+  L+ Y+EA+  P F+IL++E+P+ F N+T
Sbjct  498  AVAISVFKILLHVSRPNTLVLGNIPGTPIFHSLNQYREALRIPSFVILAVESPIYFANST  557

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  L+K+ ++
Sbjct  558  YLQERILRWV-REEEERVKANNESTLKCIILDMTAVTAIDTSGIDTLYELRKVLDKRSLQ  616

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    D      ++L+VGEAV+ +SS+ K Q
Sbjct  617  LVLANPVGNVMEKLHQS-NILDSFGLKGVYLSVGEAVADISSSWKAQ  662



>ref|XP_010465599.1| PREDICTED: probable sulfate transporter 3.4 isoform X2 [Camelina 
sativa]
Length=661

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL  II+TAV+GLID  AAY +WKVDKFDF   +C+FFGV  +SV  GLAI
Sbjct  434  PLFYYTPNVILAVIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLLVSVPLGLAI  493

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N+T
Sbjct  494  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLILAVESPIYFANST  553

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  554  YLQERILRWTREEETRIKEFNA-TTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  612

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  613  LVLVNPVGTVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  656



>gb|ABR16213.1| unknown [Picea sitchensis]
Length=680

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 170/225 (76%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +IIV AV+GLID+PAAY IWKVDK DF   + AF GV FISVQ GL I
Sbjct  454  PLFYYTPVVVLSSIIVAAVLGLIDVPAAYFIWKVDKVDFFACMGAFVGVIFISVQIGLLI  513

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL +TRP+T++LGNIPGT +YR+++ YKEA   PGFLIL I +P+ F N+T
Sbjct  514  AVGISVFKILLDVTRPQTLLLGNIPGTALYRNVEQYKEASRVPGFLILGIASPIYFANST  573

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ + E +  + +K + L++V+LD++A++ IDT+GI+   +L+ TL K+G++
Sbjct  574  YLRERILRWV-QDEEDRIENEKANTLQYVILDITAVTTIDTTGINSLLELKKTLTKQGLQ  632

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            + LVNP   V+EKL+RA+  +     D LF++VGEA+ + SS  K
Sbjct  633  VALVNPGAAVMEKLERAKVIESF-GGDCLFMSVGEAIYSFSSMFK  676



>ref|XP_010465597.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Camelina 
sativa]
Length=690

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 166/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL  II+TAV+GLID  AAY +WKVDKFDF   +C+FFGV  +SV  GLAI
Sbjct  463  PLFYYTPNVILAVIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLLVSVPLGLAI  522

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T   GNIPGT IY+ L  Y+EA   PGFLIL++E+P+ F N+T
Sbjct  523  AVGVSVIKILLHVTRPNTSEFGNIPGTQIYQSLGRYREASRIPGFLILAVESPIYFANST  582

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    + L+ ++LDM+A+SAIDTSG+    +LR  LEK+ ++
Sbjct  583  YLQERILRWTREEETRIKEFNA-TTLKCIILDMTAVSAIDTSGLEAVFELRRRLEKQSLQ  641

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  642  LVLVNPVGTVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  685



>ref|XP_008793448.1| PREDICTED: probable sulfate transporter 3.4 [Phoenix dactylifera]
Length=665

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 169/233 (73%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF +TPNVILGAII+TAVVGLID+     +WKVDK DF+  +CAFFGV FISVQ GLAI
Sbjct  431  PLFYHTPNVILGAIIITAVVGLIDLHGMIRLWKVDKLDFLACVCAFFGVLFISVQIGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI K+L+ +TRP T+++GN+PGT  YR+L HYKEA   P FLIL +E+P+ F N  
Sbjct  491  AVAISILKILIHVTRPNTVIMGNVPGTRSYRNLAHYKEAARVPAFLILGVESPIYFANCM  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E    +   +S ++ +VLDM+A++ IDTSG+    +L+ TL+K+ +E
Sbjct  551  YLQERILRWVREEEERVIKM-NESSIKCLVLDMAAVTTIDTSGMDALSELKKTLDKRSLE  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVL NP+G+V E++ R+    ++  S+ +++TV EAV+A+S   K Q P  +V
Sbjct  610  LVLANPVGDVTERMNRS-GMWELFGSEGIYMTVAEAVAAVSCKYKDQ-PRSYV  660



>ref|XP_009115084.1| PREDICTED: probable sulfate transporter 3.4 [Brassica rapa]
 emb|CDY20171.1| BnaA01g28310D [Brassica napus]
Length=660

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY +WKVDKFDF   +C+FFGV  +SV  GLAI
Sbjct  433  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLWKVDKFDFFTCMCSFFGVLLVSVPLGLAI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+ K+LL +TRP T+  GNI GT IY+ +  Y+EA   PGFLIL++E+P+ F N+T
Sbjct  493  AVGVSVLKILLHVTRPNTLEFGNIQGTQIYQSVKRYREASRIPGFLILAVESPIYFANST  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E EA  ++    S L+ ++LDM+A+S+IDT+GI    +LR  LEK+ ++
Sbjct  553  YLQERILRWTREEEARIKENNG-STLKCIILDMTAVSSIDTNGIEALFELRRRLEKQSLQ  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  612  LVLVNPVGSVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  655



>ref|XP_009773435.1| PREDICTED: probable sulfate transporter 3.4 [Nicotiana sylvestris]
Length=671

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAV+GLID  AA+ +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  442  PLFYYTPIVILAAIIITAVIGLIDYQAAFRLWKVDKLDFLACLCSFFGVLFISVPLGLAI  501

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNIPGT +Y++L  Y+ A+  P FLIL++EAP+ F N+T
Sbjct  502  AVGVSVFKILLHVTRPNTSVLGNIPGTQVYQNLSRYRTAVRIPSFLILAVEAPIYFANST  561

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI E E     + K++ ++ V++DM+A+S+ID+SGI    +LR TL K+ ++
Sbjct  562  YLKERILRWIREEEEWIV-SNKETAIKCVIIDMTAVSSIDSSGIDTICELRKTLNKRSLK  620

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL ++  T +    + ++LTV EAV+ +SS  K
Sbjct  621  LVLANPVGNVMEKLHQS-STLEAFGLNGIYLTVSEAVADISSLWK  664



>ref|XP_003546346.1| PREDICTED: probable sulfate transporter 3.4-like isoform 1 [Glycine 
max]
Length=652

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  +AY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  427  PLFYYTPNVVLAAIIITAVIGLIDYQSAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL +TRP T++LGNIPGT I+ +++ Y EA+  P FLIL++E+P+ F N+T
Sbjct  487  AVIISVFKILLHVTRPNTLVLGNIPGTQIFHNINQYIEALRVPSFLILAVESPIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    + L+ ++LDM+A++AIDTSG+    +LR  LEK+ +E
Sbjct  547  YLQERILRWV-REEEEHIKANNGAPLKCIILDMTAVTAIDTSGLDTLCELRKMLEKRSLE  605

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    D      ++LTVGEAV+ +SS  K Q
Sbjct  606  LVLANPVGNVMEKLHKS-NILDSFGLKGVYLTVGEAVADISSIWKAQ  651



>ref|XP_009598569.1| PREDICTED: probable sulfate transporter 3.4 [Nicotiana tomentosiformis]
Length=669

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAV+GLID  AA+ +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  440  PLFYYTPIVILAAIIITAVIGLIDYQAAFRLWKVDKLDFLACLCSFFGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNIPGT +Y++L  Y+ A+  P FLIL++EAP+ F N+T
Sbjct  500  AVGVSVFKILLHVTRPNTSVLGNIPGTQVYQNLSRYRTAVRIPSFLILAVEAPIYFANST  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RWI E E       K++ ++ V++DM+A+S+ID+SGI    +LR TL+K+ ++
Sbjct  560  YLKERILRWIREEEEWIV-ANKETAIKCVIIDMTAVSSIDSSGIDTICELRKTLDKRSLK  618

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LV+ NP G V+EKL ++  T D    + ++LTV EAV+ +SS  K
Sbjct  619  LVMANPGGNVMEKLHQS-NTLDAFGLNGIYLTVSEAVADISSLWK  662



>ref|XP_010033888.1| PREDICTED: probable sulfate transporter 3.4 [Eucalyptus grandis]
 gb|KCW53743.1| hypothetical protein EUGRSUZ_J02996 [Eucalyptus grandis]
Length=661

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 169/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII+TAV+GLID  AA  +WKVDK DF+  +C+F GV FISV  GLAI
Sbjct  436  PLFHYTPNVILGAIIITAVIGLIDYQAALRLWKVDKLDFLACICSFVGVLFISVPLGLAI  495

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNI GT  Y+ L  Y+ A   P FLIL++E+P+ F N+T
Sbjct  496  AVGVSVFKILLHVTRPNTTVLGNIQGTHTYQSLSRYRVASKVPSFLILAVESPIYFANST  555

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E   ++   QS L+ ++LDM+A+++IDTSGI    ++R  +EK+ ++
Sbjct  556  YLQERILRWVREEEEWIKE-NNQSALKCLILDMTAVTSIDTSGIDALVEIRKMVEKRSLK  614

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL +P+G V+EKL ++ +T D  +S+ L++TVGEAV+ +SS  K Q
Sbjct  615  LVLASPVGNVMEKLDKS-QTLDSFRSNGLYMTVGEAVADISSLWKCQ  660



>ref|XP_009358236.1| PREDICTED: LOW QUALITY PROTEIN: probable sulfate transporter 
3.4 [Pyrus x bretschneideri]
Length=453

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 160/227 (70%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID  AAY +WK DK DF+  +C+FFGV FISV  GLAI
Sbjct  228  PLFYYTPNVILAAIIITAVSGLIDYQAAYRLWKXDKLDFMACMCSFFGVLFISVPFGLAI  287

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP TM  GNIP T    +L+ Y+E      FLIL++EAP+ F N+T
Sbjct  288  AVGVSIFKILLHVTRPNTMAPGNIPVTQTNHNLNRYREDSRISSFLILAVEAPIYFANST  347

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  348  YLQERILRWV-REEEESIKASNESALKCIILDMTAVTAIDTSGIDMMSELRKMLEKRSLQ  406

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EK Q+  +T +    + L LTVGEAV+ +SS    Q
Sbjct  407  LVLANPVGSVMEK-QQQSKTLEAFGLNGLCLTVGEAVADISSDWNAQ  452



>gb|KHM98769.1| Putative sulfate transporter 3.4 [Glycine soja]
Length=652

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  +AY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  427  PLFYYTPNVVLAAIIITAVIGLIDYQSAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL +TRP T++LGNIPGT ++ +++ Y EA+  P FLIL++E P+ F N+T
Sbjct  487  AVIISVFKILLHVTRPNTLVLGNIPGTQMFHNINQYIEALRVPSFLILAVEPPIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    + L+ ++LDM+A++AIDTSG+    +LR  LEK+ +E
Sbjct  547  YLQERILRWV-REEEEHIKANNGAPLKCIILDMTAVTAIDTSGLDTLCELRKMLEKRSLE  605

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    D      ++LTVGEAV+ +SS  K Q
Sbjct  606  LVLANPIGNVMEKLHKS-NILDSFGLKGVYLTVGEAVADISSIWKAQ  651



>ref|XP_009381146.1| PREDICTED: probable sulfate transporter 3.4 [Musa acuminata subsp. 
malaccensis]
Length=656

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 167/221 (76%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID+  A+ +WKVDKFDF+  + AFFGV  +SVQ GLAI
Sbjct  433  PLFYYTPNVMLSAIIIAAVIGLIDVRGAFLLWKVDKFDFLACMSAFFGVLLVSVQMGLAI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+L+  TRP T++LGN+PGT  YR+L  Y+EA+  P FLIL IE+P+ F N+ 
Sbjct  493  AVGISLFKILIHATRPNTVILGNVPGTNSYRNLAQYREAVRVPSFLILGIESPIYFTNSM  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E    ++  +S L+ +VLDM+A++A+DT+G+    +L+ T +K+ ++
Sbjct  553  YLQERILRWVREEEERIVKS-NESSLKCIVLDMAAVTAMDTNGMEALSELKKTFDKRSLD  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP+GEV +KL R+  T ++  S+ +++TVGEA++A S
Sbjct  612  LVLANPVGEVAQKLSRS-GTWELFGSEHIYMTVGEAIAAAS  651



>ref|XP_004506859.1| PREDICTED: probable sulfate transporter 3.4-like [Cicer arietinum]
Length=654

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 167/230 (73%), Gaps = 8/230 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  429  PLFYYTPNVVLAAIIITAVIGLIDYQAAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +L+ YKEA+  P F+IL++E+P+ F N T
Sbjct  489  AVAISVFKILLHVSRPNTVVLGNIPGTPIFHNLNQYKEALRIPSFIILAVESPIYFANAT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E         S L+ ++LDM+A++ IDTSGI    +LR  LE++ ++
Sbjct  549  YLQERILRWVREEEERIIAING-STLKCIILDMTAVTGIDTSGIDTLCELRRRLEQRSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKS---DSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL  +    +I+ S     ++L+VGEAV+ +SS+ K Q
Sbjct  608  LVLANPIGNVMEKLHES----NILNSFGMKGVYLSVGEAVADISSSWKPQ  653



>ref|XP_007150669.1| hypothetical protein PHAVU_005G171800g [Phaseolus vulgaris]
 gb|ESW22663.1| hypothetical protein PHAVU_005G171800g [Phaseolus vulgaris]
Length=654

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 165/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  +AY +WKVDK DF+  LC+F GV FISV  GL I
Sbjct  429  PLFYYTPNVVLAAIIITAVIGLIDYQSAYKLWKVDKLDFLACLCSFLGVLFISVPLGLGI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ K+LL +TRP T++LGNIPGT I+ +++ YKEA   P FLIL++E+P+ F N+T
Sbjct  489  AVIISVIKILLHVTRPNTLVLGNIPGTQIFHNINQYKEASRLPSFLILAVESPIYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    + L+ ++LDM+A++AIDTSG+   ++LR  LEK+ ++
Sbjct  549  YLQERILRWV-REEEEHIKANHGAPLKCMILDMTAVTAIDTSGLETLRELRKMLEKRSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+  V EKL R+ +  D   S  ++LTVGEAV+ +SS  K Q
Sbjct  608  LVLANPVANVAEKLHRS-KILDSFGSKGVYLTVGEAVADISSIWKTQ  653



>emb|CDY10952.1| BnaA03g46110D [Brassica napus]
Length=590

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY ++KVDKFDF   +CAFFGV  +SV  GLAI
Sbjct  363  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLYKVDKFDFFTCMCAFFGVLLVSVPLGLAI  422

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T+  GNI GT IY+ L  Y+EA    GFLIL++E+P+ FVN+T
Sbjct  423  AVVVSVIKILLHVTRPNTLEFGNIQGTQIYQSLKRYREASRIHGFLILAVESPIYFVNST  482

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E+  ++    S L+ +VLDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  483  YLQERILRWTREEESRIKENNG-STLKCIVLDMTAVSSIDTSGIEALFELRRRLEKQSLQ  541

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTVGEAV+ LSST K
Sbjct  542  LVLVNPVGSVMEKLHKSKIIESLGLSG-LYLTVGEAVADLSSTWK  585



>gb|KEH28773.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 162/227 (71%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL +
Sbjct  429  PLFYYTPNVVLAAIIITAVIGLIDYRAAYKLWKVDKLDFLACVCSFFGVLFISVPLGLGV  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T +LGNIPGT I+ +L  YKEAI  P F+IL++E+P+ F N T
Sbjct  489  AVAISVFKILLHVSRPNTSVLGNIPGTPIFHNLIQYKEAIRIPAFIILAVESPIYFANAT  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E         S L+ ++LDM+A++ IDTSGI    +LR  LE+K ++
Sbjct  549  YLQERILRWVREEEERVVALNG-SALKCIILDMTAVTGIDTSGIDTLCELRRRLEQKSLQ  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL  +    D      L+L+VGEAV+ +SS+ K Q
Sbjct  608  LVLANPVGNVMEKLHES-NILDSFGMKGLYLSVGEAVADISSSWKAQ  653



>gb|KJB15440.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=590

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LLQITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AVGMSIFKILLQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSA  470
            YL ERI RWI   E E E  KKQS L+FVVL MS 
Sbjct  542  YLNERILRWI--EEYEAEDHKKQSSLQFVVLVMSG  574



>ref|XP_002281235.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Vitis 
vinifera]
Length=660

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 172/225 (76%), Gaps = 3/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF +TPN++L AII+TAV+GLID  AA+ +WK+DK +F+  LC+FFGV FISV  GLAI
Sbjct  438  PLFYHTPNLVLAAIIITAVIGLIDYNAAFLLWKLDKLEFLACLCSFFGVLFISVPMGLAI  497

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VG+S+FK+LL +TRP T+ LGNIPGT IY+++  Y+ A   P FLIL IE+P+ F N+T
Sbjct  498  SVGVSVFKILLHVTRPNTVALGNIPGTQIYQNVSRYENASRVPCFLILGIESPIYFANST  557

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+  +E EE   +K+ +L+ VVLDM+A++AID+SGI    +LR TL  + V+
Sbjct  558  YLQERILRWV--WEEEERLKEKEENLKCVVLDMTAVTAIDSSGIDAIYELRKTLLNRSVQ  615

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL  + +  D+  ++ L+LTVGEAV+ +SS+ K
Sbjct  616  LVLVNPVGSVMEKLHHS-KILDLFGTNQLYLTVGEAVTDISSSWK  659



>emb|CBI28093.3| unnamed protein product [Vitis vinifera]
Length=665

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 172/225 (76%), Gaps = 3/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF +TPN++L AII+TAV+GLID  AA+ +WK+DK +F+  LC+FFGV FISV  GLAI
Sbjct  443  PLFYHTPNLVLAAIIITAVIGLIDYNAAFLLWKLDKLEFLACLCSFFGVLFISVPMGLAI  502

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VG+S+FK+LL +TRP T+ LGNIPGT IY+++  Y+ A   P FLIL IE+P+ F N+T
Sbjct  503  SVGVSVFKILLHVTRPNTVALGNIPGTQIYQNVSRYENASRVPCFLILGIESPIYFANST  562

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+  +E EE   +K+ +L+ VVLDM+A++AID+SGI    +LR TL  + V+
Sbjct  563  YLQERILRWV--WEEEERLKEKEENLKCVVLDMTAVTAIDSSGIDAIYELRKTLLNRSVQ  620

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL  + +  D+  ++ L+LTVGEAV+ +SS+ K
Sbjct  621  LVLVNPVGSVMEKLHHS-KILDLFGTNQLYLTVGEAVTDISSSWK  664



>ref|XP_009135468.1| PREDICTED: probable sulfate transporter 3.4 [Brassica rapa]
Length=653

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY ++KVDKFDF   +CAFFGV  +SV  GLAI
Sbjct  426  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLYKVDKFDFFTCMCAFFGVLLVSVPLGLAI  485

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T+  GNI GT IY+ L  Y+EA    GFLIL++E+P+ FVN+T
Sbjct  486  AVVVSVIKILLHVTRPNTLEFGNIQGTQIYQSLKRYREASRIHGFLILAVESPIYFVNST  545

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E+  ++    S L+ +VLDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  546  YLQERILRWTREEESRIKENNG-STLKCIVLDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  604

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKLQ+++  + +  S  L+LTVGEAV+ LSST K
Sbjct  605  LVLVNPVGSVMEKLQKSKIIESLGLSG-LYLTVGEAVADLSSTWK  648



>ref|XP_003543650.1| PREDICTED: probable sulfate transporter 3.4-like [Glycine max]
Length=649

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 164/227 (72%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  +AY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  424  PLFYYTPNVVLAAIIITAVIGLIDYQSAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ K+LL +TRP T++LGNIPGT I+ +++ YK+A+  P FLIL++E+P+ F N+T
Sbjct  484  AVIISVLKILLHVTRPNTLVLGNIPGTQIFHNINQYKKALRVPSFLILAVESPIYFANST  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    + L+ ++LDM+A++A DTSG+    +LR  LEK+ +E
Sbjct  544  YLQERILRWV-REEEEHIKANNGAPLKCIILDMTAVTATDTSGLDTLCELRKMLEKRSLE  602

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VL NP+G V+EKL ++    D      ++LTVGEAV+ +SS  K Q
Sbjct  603  FVLANPVGNVMEKLHKS-NILDSFGLKGVYLTVGEAVTDISSIWKAQ  648



>gb|KHN32600.1| Putative sulfate transporter 3.4 [Glycine soja]
Length=646

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 164/227 (72%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID  +AY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  421  PLFYYTPNVVLAAIIITAVIGLIDYQSAYKLWKVDKLDFLACLCSFFGVLFISVPLGLGI  480

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ K+LL +TRP T++LGNIPGT I+ +++ YK+A+  P FLIL++E+P+ F N+T
Sbjct  481  AVIISVLKILLHVTRPNTLVLGNIPGTQIFHNINQYKKALRVPSFLILAVESPIYFANST  540

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    + L+ ++LDM+A++A DTSG+    +LR  LEK+ +E
Sbjct  541  YLQERILRWV-REEEEHIKANNGAPLKCIILDMTAVTATDTSGLDTLCELRKMLEKRSLE  599

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
             VL NP+G V+EKL ++    D      ++LTVGEAV+ +SS  K Q
Sbjct  600  FVLANPVGNVMEKLHKS-NILDSFGLKGVYLTVGEAVTDISSIWKAQ  645



>ref|XP_008462141.1| PREDICTED: probable sulfate transporter 3.4 [Cucumis melo]
Length=661

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 169/229 (74%), Gaps = 2/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AA  +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  435  PLFHYTPNFILAAIIITAVIGLIDYQAACKLWKVDKLDFLACVCSFFGVLFISVPLGLAI  494

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP TM+LGNI GT I+++LD Y++A   P FLIL+I++P+ F N+T
Sbjct  495  AVGVSVFKILLHVTRPNTMVLGNISGTHIFQNLDRYRDASRVPSFLILAIDSPIYFANST  554

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E   + T + S L+ V+LDM+A+++IDTSGI    +LR TL +K ++
Sbjct  555  YLQERILRWVREEEERIKST-EDSPLKCVILDMTAVTSIDTSGIETVCELRKTLIQKSLQ  613

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
             VL NP G V+EKL +++  +   + + L+L+VGEA+  +SS  K  +P
Sbjct  614  FVLANPGGNVMEKLYKSKALEQF-EFNGLYLSVGEAIKDISSLWKRVLP  661



>emb|CDX82421.1| BnaA03g34000D [Brassica napus]
Length=653

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY ++KVDKFDF   +CAFFGV  +SV  GLAI
Sbjct  426  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLYKVDKFDFFTCMCAFFGVLLVSVPLGLAI  485

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T+  GNI GT IY+ L  Y+EA    GFLIL++E+P+ FVN+T
Sbjct  486  AVVVSVIKILLHVTRPNTLEFGNIQGTQIYQSLKRYREASRIHGFLILAVESPIYFVNST  545

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    + L+ +VLDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  546  YLQERILRWTREEETRIKE-NNGTTLKCIVLDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  604

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKLQ+++  + +  S  L+LTVGEAV+ LSST K
Sbjct  605  LVLVNPVGSVMEKLQKSKIIESLGLSG-LYLTVGEAVADLSSTWK  648



>ref|XP_002298140.1| sulfate transporter 3.4 family protein [Populus trichocarpa]
 gb|EEE82945.1| sulfate transporter 3.4 family protein [Populus trichocarpa]
Length=699

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 167/238 (70%), Gaps = 13/238 (5%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII++AV+GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  446  PLFYYTPNVILGAIIISAVIGLIDYQAAYCLWKVDKLDFLACLCSFFGVLFISVPLGLGI  505

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP ++++GNI GT IY  L  YKEA   P FLIL+IE+P+ F N+T
Sbjct  506  AVGVSVFKILLHVTRPNSLIMGNIKGTQIYHSLSRYKEASRVPSFLILAIESPIYFANST  565

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  +EK+ ++
Sbjct  566  YLQERILRWI-REEDEWIKANDRSPLKCIILDMTAVTAIDTSGIDLLCELRKMMEKRSLK  624

Query  394  -----------LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
                       LVL NP+G V+EKL +++   D    + ++L VGEAV+ +S+  K Q
Sbjct  625  ARLSPNQSHLALVLANPVGSVMEKLHQSKML-DSFGLNGIYLAVGEAVADISALWKSQ  681



>ref|XP_009137368.1| PREDICTED: probable sulfate transporter 3.4 [Brassica rapa]
Length=655

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 168/228 (74%), Gaps = 8/228 (4%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY ++KVDKFDF   +CAFFGV  +SV  GLAI
Sbjct  426  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLYKVDKFDFFTCMCAFFGVLLVSVPLGLAI  485

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T+  GNI GT IY+ L  Y+EA    GFLIL++E+P+ FVN+T
Sbjct  486  AVVVSVIKILLHVTRPNTLEFGNIQGTQIYQSLKRYREASRIHGFLILAVESPIYFVNST  545

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E+  ++    S L+ +VLDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  546  YLQERILRWTREEESRIKENNG-STLKCIVLDMTAVSSIDTSGIEALFELRRRLEKQSLQ  604

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKS---DSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++    I++S     L+LTVGEAV+ LSST K
Sbjct  605  LVLVNPVGSVMEKLHKSK----IIESLGLRGLYLTVGEAVADLSSTWK  648



>ref|XP_010943103.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+LGAII+ AVVGLID+PA Y +WK+DK DFIV LCAF GV FISVQ+GLAI
Sbjct  424  PLFVYTPNVVLGAIIIAAVVGLIDVPAVYHLWKMDKIDFIVCLCAFLGVLFISVQDGLAI  483

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIF++LLQITRP  + LGNI GT IYR+L HY +A   PGFLIL++EAP+NF NTT
Sbjct  484  AVGISIFRILLQITRPNIVTLGNITGTDIYRNLHHYIDARRVPGFLILAVEAPINFTNTT  543

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI+R IEE +A       Q+ LRFV+LD+SA+  IDTSG+SF  DL+ ++EK G E
Sbjct  544  YLNERITRCIEEEKAV---DHHQAVLRFVILDLSAVPTIDTSGVSFLVDLKKSMEKHGFE  600



>ref|XP_011081670.1| PREDICTED: probable sulfate transporter 3.4 [Sesamum indicum]
Length=697

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 167/227 (74%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPN+IL AII+TA VGLID  AAY +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  472  PLFRYTPNLILAAIIITAAVGLIDYGAAYKLWKVDKLDFVACLCSFFGVLFISVALGLAI  531

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL +TRP T+ LGNIPGT IY++   Y +A+  P FLIL IEAP+ F N+T
Sbjct  532  AVGISVFKILLNVTRPNTVSLGNIPGTQIYQNRSRYTQAVRVPSFLILGIEAPIYFANST  591

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI E E     +    DLR V+LDM+A++AIDTSG+    +LR  L+ + ++
Sbjct  592  YLQERILRWIREEEQWLA-SNDICDLRCVILDMTAVTAIDTSGLDMISELRKMLDNRSLK  650

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V+EKL ++    ++   + L+LTVGEAVS +SS+ K Q
Sbjct  651  LVLANPVGSVMEKLHKS-NVLELFHFEGLYLTVGEAVSDISSSWKDQ  696



>ref|XP_006465559.1| PREDICTED: probable sulfate transporter 3.4-like [Citrus sinensis]
 gb|KDO51182.1| hypothetical protein CISIN_1g006183mg [Citrus sinensis]
Length=657

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 166/227 (73%), Gaps = 2/227 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AA+ +WKVDK DF+   C+FFGV FISV  GLAI
Sbjct  432  PLFYYTPNVILAAIIITAVIGLIDYQAAFRLWKVDKLDFLACSCSFFGVLFISVPLGLAI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T+ +GNIPGT IY+ L+ Y+EA+    FLIL++E+P+ F N+T
Sbjct  492  AVGVSVFKILLHVTRPNTVAMGNIPGTHIYQSLNRYREALRVSSFLILAVESPIYFANST  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI R     E E  +   +S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  552  YLQERILR-WIREEEEWIEANNESTLKCIILDMTAVTAIDTSGIDMVCELRKILEKQSLQ  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQ  254
            LVL NP+G V EKL +++  +     + L+LTVGEAV+ +S+  K Q
Sbjct  611  LVLANPVGSVTEKLHQSKVLESF-GLNGLYLTVGEAVADISALWKAQ  656



>ref|XP_004252331.1| PREDICTED: probable sulfate transporter 3.4 [Solanum lycopersicum]
Length=665

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 167/225 (74%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAV+GLID  AA  +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  436  PLFYYTPIVILAAIIITAVIGLIDYQAALRLWKVDKLDFLACLCSFFGVLFISVPLGLAI  495

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNIPGT +Y++++ Y+ A+  P FLIL++EAP+ F N+T
Sbjct  496  AVGVSVFKILLHVTRPNTGVLGNIPGTQVYQNMNRYRTAVRIPSFLILAVEAPIYFANST  555

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E E  +T +++ ++ V++DM+A+S+ID+SGI    +LR TL+K+ ++
Sbjct  556  YLQERILRWI-REEEERIETNQETAIKCVIIDMTAVSSIDSSGIDTICELRKTLDKRSLK  614

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP G V+EKL  +   +     + ++LTV EAV+ +SS  K
Sbjct  615  LVLANPGGNVMEKLHESNALEGF-GLNGIYLTVSEAVADISSLWK  658



>ref|XP_004141780.1| PREDICTED: probable sulfate transporter 3.4 [Cucumis sativus]
 gb|KGN45350.1| hypothetical protein Csa_7G446670 [Cucumis sativus]
Length=661

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 165/225 (73%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN IL AII+TAV+GLID  AA  +WKVDK DF+  +C+FFGV FISV  GLAI
Sbjct  435  PLFHYTPNFILAAIIITAVIGLIDYQAACKLWKVDKLDFLACVCSFFGVLFISVPLGLAI  494

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP TM+LGNI GT I+++LD Y++A   P FLIL+I++P+ F N+T
Sbjct  495  AVGVSVFKILLHVTRPNTMVLGNISGTHIFQNLDRYRDASRVPSFLILAIDSPIYFANST  554

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E   + T + S L+ V+LDM+A+++IDTSGI    +L+  L KK ++
Sbjct  555  YLQERILRWVREEEERIKST-EDSPLKCVILDMTAVTSIDTSGIETVCELKKILMKKSLQ  613

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
             VL NP G V+EKL  ++  +   + + L+L+VGEAV  +SS  K
Sbjct  614  FVLANPGGNVMEKLYNSKALEQF-EFNGLYLSVGEAVKDISSLWK  657



>ref|XP_009408945.1| PREDICTED: probable sulfate transporter 3.4 [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   239 bits (609),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 171/230 (74%), Gaps = 4/230 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID+  A+ +WKVDKFDF+  + AFFGV  ISVQ GLAI
Sbjct  433  PLFYYTPNVMLSAIIIVAVIGLIDVRGAFLLWKVDKFDFLACMSAFFGVLLISVQTGLAI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+L+ +TRP T+++GN+PGT  YR+L  Y+EA+  P FLIL IE+P+ F N+ 
Sbjct  493  AVGVSLFKILVHVTRPNTVIMGNVPGTNSYRNLAQYREAVQLPSFLILGIESPIYFTNSI  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E + ++   +S L+ ++LDM+A++AID SG+    +L+ TL+K+ ++
Sbjct  553  YLQERILRWVREEEEKIKKL-NESSLKCIILDMAAVTAIDISGLETLAELKKTLDKRFID  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPA  245
            LVL NP+ EV +KL +   T D+  S+ +++TVGEA++A  S+ K Q  A
Sbjct  612  LVLANPVLEVAQKLSQL-GTWDLFGSERIYMTVGEAIAA--SSYKAQTSA  658



>emb|CDX75862.1| BnaC03g39450D [Brassica napus]
Length=653

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AAY ++KVDKFDF   +CAFFGV  +SV  GLAI
Sbjct  426  PLFYYTPNLILAAIILTAVIGLIDYQAAYKLYKVDKFDFFTCMCAFFGVLLVSVPLGLAI  485

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ K+LL +TRP T+  GNI GT IY+ L  Y+EA    GFLIL++E+P+ F N+T
Sbjct  486  AVVVSVIKILLHVTRPNTLEFGNIQGTQIYQSLKRYREASRIHGFLILAVESPIYFANST  545

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW  E E   ++    S L+ +VLDM+A+S+IDTSGI    +LR  LEK+ ++
Sbjct  546  YLQERILRWTREEETRIKE-NNGSTLKCIVLDMTAVSSIDTSGIEAVFELRRRLEKQSLQ  604

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVLVNP+G V+EKL +++  + +  S  L+LTV EAV+ LSST K
Sbjct  605  LVLVNPVGSVMEKLHKSKIIESLGLSG-LYLTVAEAVADLSSTWK  648



>ref|XP_009768935.1| PREDICTED: probable sulfate transporter 3.4 [Nicotiana sylvestris]
Length=654

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 162/225 (72%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AA+ +WKVDK DF+  L +FFGV FISV  GLAI
Sbjct  429  PLFHYTPNLILAAIIITAVIGLIDYQAAFRLWKVDKLDFVACLSSFFGVLFISVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LG IPGT  ++ L  Y  A+  P FLI+++EAP  F N+T
Sbjct  489  AVGVSVFKILLHVTRPNTNVLGYIPGTQSFQSLSRYSTAVRIPSFLIIAVEAPFYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER  RWI   E E  + K+++ ++ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  549  YLQERTLRWI-REEEERIEVKRETAIKCVILDMTAVTAIDTSGIDTICELRRILEKRSLK  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL  +    +    D L+LTV EAV+ +SS+ K
Sbjct  608  LVLANPVGNVMEKLHNSHAL-EAFGLDGLYLTVSEAVADISSSWK  651



>ref|XP_010915047.1| PREDICTED: probable sulfate transporter 3.4 isoform X1 [Elaeis 
guineensis]
Length=665

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 164/233 (70%), Gaps = 3/233 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAVVGLID+     +WKVDK DF+  + AF GV FISVQ GLAI
Sbjct  431  PLFYYTPKVILAAIIITAVVGLIDLHGMIRLWKVDKLDFLACISAFLGVLFISVQIGLAI  490

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIFK+L+ +TRP T ++GN+PGT  YR+L HYKEA   P FLIL IE+P+ F N  
Sbjct  491  AVVISIFKILVHVTRPNTAIMGNVPGTQSYRNLAHYKEATRVPAFLILGIESPIYFANCM  550

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+ E E    +   +S ++ +VLDM+A++ IDTSG+    +L+ T +K+ +E
Sbjct  551  YLQERILRWVREEEERAIKM-NESSIKCIVLDMAAVTTIDTSGMDTLSELKKTFDKRSIE  609

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPADHV  236
            LVL NP+G+V E++ ++   +    S+ +++TV EAV+A+SS  K Q+   HV
Sbjct  610  LVLANPVGDVTERMNQSGIWEQF-GSEGIYMTVAEAVAAVSSMYKDQL-RSHV  660



>ref|XP_006346582.1| PREDICTED: probable sulfate transporter 3.4-like [Solanum tuberosum]
Length=664

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP VIL AII+TAV+GLID  AA  +WKVDK DF+  LC+FFGV FISV  GLAI
Sbjct  435  PLFYYTPIVILAAIIITAVIGLIDYQAALRLWKVDKLDFLACLCSFFGVLFISVPLGLAI  494

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LGNIPGT +Y++++ Y+ A+  P FLIL++EAP  F N+T
Sbjct  495  AVGVSVFKILLHVTRPNTGVLGNIPGTQVYQNMNRYRTAVRIPSFLILAVEAPFYFANST  554

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E E  +  +++ ++ V++DM+A+S+ID+SGI    +LR TL+K+ ++
Sbjct  555  YLQERILRWI-REEEERIEANQETAIKCVIIDMTAVSSIDSSGIDTICELRKTLDKRSLK  613

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP G V EKL  +   +     + ++LTV EAV+ +SS  K
Sbjct  614  LVLANPGGNVTEKLHESNALEGF-GLNGIYLTVSEAVADISSLWK  657



>ref|XP_010688173.1| PREDICTED: probable sulfate transporter 3.4 [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 165/227 (73%), Gaps = 5/227 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+TAV+GLID   A  +WKVDK DF+  LC+F GV FISV +GLA+
Sbjct  428  PLFYYTPNVVLAAIIITAVIGLIDHEGALRLWKVDKLDFVACLCSFLGVLFISVPSGLAL  487

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FKVLL ITRP  + LGNIPGT ++  ++ YK A   P FLI+ +EAP+ F+N+T
Sbjct  488  AVGISVFKVLLHITRPNIVNLGNIPGTQMFNSIERYKNASRIPSFLIIGLEAPIYFLNST  547

Query  574  YLKERISRWIeeyeaeeEQTKKQSD--LRFVVLDMSAISAIDTSGISFFKDLRMTLEKKG  401
            YL+ERI R I     EE+  K  SD  L++V+LDM+A++AIDTSGI    +L  +++K+ 
Sbjct  548  YLQERILRSI---REEEDMIKSNSDPMLKYVILDMTAVTAIDTSGIDTINELGKSIQKRS  604

Query  400  VELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            +EL LVNP+G V+EKL +++       S+ ++++VGEA+  ++++ K
Sbjct  605  LELALVNPVGSVMEKLHKSKVLDLFGSSNGVYMSVGEAILDMTTSKK  651



>ref|XP_009615183.1| PREDICTED: probable sulfate transporter 3.4 [Nicotiana tomentosiformis]
Length=654

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 162/225 (72%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPN+IL AII+TAV+GLID  AA+ +WKVDK DF+  L +FFGV FISV  GLAI
Sbjct  429  PLFHYTPNLILAAIIITAVIGLIDYQAAFRLWKVDKLDFVACLSSFFGVLFISVPLGLAI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP T +LG IPGT  ++ L  Y  A+  P FLI+++EAP  F N+T
Sbjct  489  AVGVSVFKILLHVTRPNTNVLGYIPGTQSFQSLSRYSAAVRIPSFLIIAVEAPFYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER  RWI   E E  + KK++ ++ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  549  YLQERTLRWI-REEEERIEVKKETAIKCVILDMTAVTAIDTSGIDTICELRRILEKRSLK  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL  +    +    D L+LTV EAV+ +SS+ K
Sbjct  608  LVLANPVGNVMEKLHNSHAL-EAFGLDGLYLTVSEAVADISSSWK  651



>gb|ACF85430.1| unknown [Zea mays]
 tpg|DAA43467.1| TPA: hypothetical protein ZEAMMB73_358631 [Zea mays]
Length=308

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 160/232 (69%), Gaps = 6/232 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AIIV+A++GL+D  AA  +W+VDK DF V   A+ GV F SV+ GL +
Sbjct  68   PLFHYTPLVVLSAIIVSAMLGLVDFGAALHLWRVDKVDFCVCAGAYLGVVFGSVEVGLVV  127

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV +S+ +VLL + RP+T +LGNIPGT +YR +D Y  A T PG L+L ++APV F N +
Sbjct  128  AVAVSLLRVLLFVARPRTTVLGNIPGTMVYRRMDQYAAAQTVPGVLVLRVDAPVYFANAS  187

Query  574  YLKERISRWIeeyeaeeEQTKKQSDL--RFVVLDMSAISAIDTSGISFFKDLRMTLEKKG  401
            YL+ERISRWI   + EEE+TK Q ++  R+VVLDM AI +IDTSG S   +L  +L+++G
Sbjct  188  YLRERISRWI---DDEEERTKSQGEMGVRYVVLDMGAIGSIDTSGTSMLDELNKSLDRRG  244

Query  400  VELVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPA  245
            +++VL NP  E+++KL  ++  + I   + +F TVGEAV++    +    P 
Sbjct  245  MQIVLANPGSEIMKKLDSSKVLEQI-GHEWVFPTVGEAVASCDYVLHSHKPG  295



>emb|CBK55662.1| sulphate transporter [Astragalus drummondii]
Length=658

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 164/222 (74%), Gaps = 2/222 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL+I
Sbjct  434  PLFYYTPNVVLAAIIIAAVIGLIDYQAAYKLWKVDKLDFLACICSFFGVLFISVPLGLSI  493

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +++ YKEA+  P  LIL+IE+P+ F N+T
Sbjct  494  AVAISVFKILLHVSRPNTLVLGNIPGTQIFHNINQYKEALRVPSILILAIESPIYFANST  553

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    S L+ VVLDM+A++AIDTSG+    +LR  LE + ++
Sbjct  554  YLQERILRWV-REEEECIKANNGSSLKCVVLDMTAVTAIDTSGLETLNELRKMLESRSLQ  612

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LVLVNP+G V+EKL  + +  D      ++LTVGEAV+ ++S
Sbjct  613  LVLVNPVGNVMEKLHMS-KVLDTFGLRGVYLTVGEAVADITS  653



>ref|XP_011042845.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
Length=172

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTP V+L AIIVTAV GL+DIPAA  IWK+DKFDF+V+LCAFFGV F+S+++GLAI
Sbjct  14   PLFQYTPTVVLRAIIVTAVNGLVDIPAACQIWKIDKFDFVVMLCAFFGVIFVSIRDGLAI  73

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISIFK+LLQ+TRPKT++LGNIPGT I+R+L HYKEA+  PG  ILSIEAP+NF NTT
Sbjct  74   AVGISIFKILLQVTRPKTLVLGNIPGTDIFRNLHHYKEAMRIPGVFILSIEAPINFANTT  133

Query  574  YLKERISRWI  545
            YL ERI RW+
Sbjct  134  YLNERILRWV  143



>emb|CBK55659.1| sulphate transporter [Astragalus bisulcatus]
Length=658

 Score =   226 bits (577),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 164/222 (74%), Gaps = 2/222 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL+I
Sbjct  434  PLFYYTPNVVLAAIIIAAVIGLIDYQAAYKLWKVDKLDFLACICSFFGVLFISVPLGLSI  493

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +++ YKEA+  P  LIL+IE+P+ F N+T
Sbjct  494  AVAISVFKILLHVSRPNTLVLGNIPGTQIFHNINQYKEALRVPSILILAIESPIYFANST  553

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    S L+ V+LDM+A++AIDTSG+    +LR  LE + ++
Sbjct  554  YLQERILRWV-REEEECIKANNGSSLKCVILDMTAVTAIDTSGLETLYELRKMLESRSLQ  612

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LVLVNP+G V+EKL  + +  D      ++LTVGEAV+ ++S
Sbjct  613  LVLVNPVGNVMEKLHMS-KVLDTFGLRGVYLTVGEAVADITS  653



>emb|CBK55654.1| sulphate transporter [Astragalus racemosus]
Length=658

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 164/222 (74%), Gaps = 2/222 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNV+L AII+ AV+GLID  AAY +WKVDK DF+  +C+FFGV FISV  GL+I
Sbjct  434  PLFYYTPNVVLAAIIIAAVIGLIDYQAAYKLWKVDKLDFLACICSFFGVLFISVPLGLSI  493

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+FK+LL ++RP T++LGNIPGT I+ +++ YKEA+  P  LIL+IE+P+ F N+T
Sbjct  494  AVAISVFKILLHVSRPNTLVLGNIPGTQIFHNINQYKEALRVPSILILAIESPIYFANST  553

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RW+   E E  +    S L+ V+LDM+A++AIDTSG+    +LR  LE + ++
Sbjct  554  YLQERILRWV-REEEECIKANNGSSLKCVILDMTAVTAIDTSGLETLYELRKMLESRSLQ  612

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LVLVNP+G V+EKL  + +  D      ++LTVGEAV+ ++S
Sbjct  613  LVLVNPVGNVMEKLHMS-KVLDTFGLRGVYLTVGEAVADITS  653



>ref|XP_008366542.1| PREDICTED: sulfate transporter 3.1-like [Malus domestica]
Length=657

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+ A++GLID  AA  +WKVDKFDF+V + A+ GV F SVQNGL +
Sbjct  417  PLFHYTPLVVLSAIIIAAMLGLIDYEAAIHLWKVDKFDFVVCMSAYIGVVFSSVQNGLVL  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T +LGN+P +  YR++D Y+ A   PG LIL I+AP+ F NT 
Sbjct  477  AVAISVMRVLLFVARPRTFILGNLPNSMDYRNVDQYQSASNIPGILILEIDAPIYFANTN  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E +  ++  +S L++V+LDMSA++ IDTSGIS   +++  ++++G++
Sbjct  537  YLRERITRWI-NDEEDRIKSAGESSLQYVILDMSAVANIDTSGISMLDEVKKLVDRRGLQ  595

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP GEV++K+ ++E  + I     ++LTV EAV+A
Sbjct  596  LVLANPGGEVMKKMNKSELIEKI-GQQWIYLTVAEAVAA  633



>ref|XP_009393046.1| PREDICTED: sulfate transporter 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=662

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 162/222 (73%), Gaps = 2/222 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AIIV A++GLI+  AA  +W+VDK DF V +CA+ GV F SV+ GL I
Sbjct  422  PLFHYTPLVVLSAIIVAAMLGLINYEAAMHLWQVDKIDFCVCMCAYLGVVFGSVEIGLVI  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI +VLL + RP+T +LGNIP + IYR +D Y EA + PG LIL ++AP+ F N +
Sbjct  482  AVAISILRVLLFVARPRTTVLGNIPNSSIYRRMDQYSEAQSVPGVLILRVDAPIYFANAS  541

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRW+ + E E+ Q+K +  +++V+LD+ A+ +ID+SGI   K++  ++++KGV+
Sbjct  542  YLRERISRWM-DEEEEKLQSKGEIGIQYVILDLGAVGSIDSSGIDMLKEINKSMDRKGVQ  600

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSS  269
            LVL NP  EV++KL +++  + I +   +FLTV EAV+A +S
Sbjct  601  LVLANPGSEVMKKLDKSKALETI-RQQWIFLTVAEAVAACNS  641



>ref|XP_008359389.1| PREDICTED: sulfate transporter 3.1-like [Malus domestica]
Length=452

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 158/221 (71%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+ A++GLID  AA  +WKVDKFDF++ + A+ GV F SV+ GL +
Sbjct  212  PLFHYTPLVVLSAIIIXAMLGLIDYEAAIHLWKVDKFDFVICMSAYIGVVFXSVEIGLVV  271

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T +LGN+P +  YR++D Y+ A   PG LIL I+AP+ F NT 
Sbjct  272  AVXISVIRVLLFVARPRTFILGNLPNSMDYRNVDQYQSASNIPGILILEIDAPIYFANTN  331

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  +   +S L +V+LDMSA++ IDTSGIS F++++  ++++G +
Sbjct  332  YLRERIXRWI-NDEEDRIKXAGESSLXYVILDMSAVANIDTSGISMFEEVKKLIDRRGXQ  390

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ ++E  + I     ++LTV EAV+A +
Sbjct  391  LVLANPGGEVMKKMNKSELIEKI-GQQWIYLTVAEAVAACN  430



>gb|ABL85048.1| sulfate transporter [Brachypodium sylvaticum]
Length=652

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 154/219 (70%), Gaps = 7/219 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAVVGLID+  A  +WKVDK DF+  L AF GV  +SVQ GLA+
Sbjct  433  PLFHYTPNVILSAIIITAVVGLIDVRGAARLWKVDKLDFLACLAAFLGVLLVSVQVGLAL  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FKVLLQ+TRP T+++G IPGT  +R++  YK+A+  P FL++ +E+ + F N+T
Sbjct  493  AVGISLFKVLLQVTRPNTVVMGRIPGTQSFRNMAQYKDAVKVPSFLVVGVESAIYFANST  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++       E+ +    ++ VVLDM A++AIDTSG+    +L+  L+K+GVE
Sbjct  553  YLVERIMRYL------REEEEGGQGVKCVVLDMGAVAAIDTSGLDALAELKRVLDKRGVE  606

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+  V E++  +    D   SD +F +V EAV+A
Sbjct  607  LVLANPVASVTERMY-SSVVGDAFGSDRIFFSVAEAVAA  644



>ref|XP_009367588.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=657

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 159/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+ A++GLID  AA  +WKVDKFDF+V + A+ GV F SVQNGL +
Sbjct  417  PLFHYTPLVVLSAIIIAAMLGLIDYEAAIHLWKVDKFDFVVCMSAYIGVVFSSVQNGLVL  476

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T +LGN+P +  YR++D Y+ A   PG LIL I+AP+ F NT 
Sbjct  477  AVAISVMRVLLFVARPRTFILGNLPNSMDYRNVDQYQSASNIPGILILEIDAPIYFANTN  536

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E +  ++  +S L++V+LDMSA++ IDTSGIS   +++  ++++G++
Sbjct  537  YLRERITRWI-NDEEDRIKSAGESSLQYVILDMSAVANIDTSGISMLDEVKKLVDRRGLQ  595

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            L L NP GEV++K+ ++E  + I     ++LTV EAV+A
Sbjct  596  LALANPGGEVMKKMNKSELIEKI-GQQWIYLTVAEAVAA  633



>gb|EAZ35804.1| hypothetical protein OsJ_20097 [Oryza sativa Japonica Group]
Length=611

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 152/219 (69%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID+  A  +WKVDK DF+  + AF GV  +SVQ GLAI
Sbjct  388  PLFHYTPNVILSAIIITAVIGLIDVRGAARLWKVDKLDFLACMAAFLGVLLVSVQMGLAI  447

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP  ++ G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+ 
Sbjct  448  AVGISLFKILLQVTRPNMVVKGVVPGTASYRSMAQYREAMRVPSFLVVGVESAIYFANSM  507

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E +    +   Q  +R ++LDMSA++AIDTSG+    +L+  LEK+ +E
Sbjct  508  YLGERIMRFLREEDERAAKC-NQCPVRCIILDMSAVAAIDTSGLDALAELKKVLEKRNIE  566

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E+L  +   K    SD +F +V EAV+A
Sbjct  567  LVLANPVGSVTERLYNSVVGKTF-GSDRVFFSVAEAVAA  604



>gb|KJB15437.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=554

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNV+LGAIIV+AVVGLIDIPAA  IWK+DKFDFIV+LCAFFGV FISVQ+GLA+
Sbjct  422  PLFQYTPNVVLGAIIVSAVVGLIDIPAACQIWKIDKFDFIVMLCAFFGVIFISVQDGLAM  481

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LLQITRPKT+MLGNIPGT I+RDL HYKE++  PGFLILSIEAP+NF N+T
Sbjct  482  AVGMSIFKILLQITRPKTVMLGNIPGTDIFRDLHHYKESMKIPGFLILSIEAPINFANST  541

Query  574  YLKERI  557
            YL ER+
Sbjct  542  YLNERL  547



>gb|ABK35756.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=465

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 160/221 (72%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II++A++GLID  AA S+WKVDK DFIV + A+ GV F SV+ GL I
Sbjct  209  PLFHYTPLVVLSSIIISAMLGLIDYEAAVSLWKVDKCDFIVCMSAYIGVVFCSVEIGLVI  268

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ ++L+ + RP+T +LGNIP + IYR +D Y  A T PG LIL I+APV F N  
Sbjct  269  AVAISLLRMLMSVARPRTFLLGNIPNSMIYRSIDQYPIANTVPGVLILQIDAPVYFANAN  328

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI E E + + T   S L++V+LD+SA+ ++DTSGIS  ++++  ++++  +
Sbjct  329  YLRERISRWIYEEEEKVKSTGG-SSLQYVILDLSAVGSLDTSGISMLEEVKKNIDRRDFK  387

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP  EV++KL++ +  + I   + ++LTVGEAV+A +
Sbjct  388  LVLANPRSEVIKKLEKTKFMESI-GQEWIYLTVGEAVAACN  427



>ref|XP_008780888.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
 ref|XP_008780889.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
Length=658

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 161/217 (74%), Gaps = 2/217 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPN IL +II++AV+GLID  AAY IWKVDK DF+  + AFFGV F+SV+ GL +
Sbjct  433  PLFKYTPNAILASIIISAVIGLIDYEAAYLIWKVDKLDFVACMGAFFGVVFVSVEIGLLV  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ K+LLQ+TRP+T +LGN+P T IYR+++ Y EA   PG LI+ +++ + F N+ 
Sbjct  493  AVSISLAKILLQVTRPRTALLGNLPSTMIYRNIEQYPEATKVPGVLIVRVDSAIYFTNSN  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y+KERI RW+   E E+ + K+   + F++++MS ++ IDTSGI  F++L  +L+K+ ++
Sbjct  553  YVKERILRWL-RDEEEQLKAKQLPKIEFLIVEMSPVTDIDTSGIHAFEELHKSLQKRSIQ  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAV  284
            LVL NP   V++KL+ AE T +++  D +FLTVGEAV
Sbjct  612  LVLANPGPVVIDKLRLAEFT-ELIGHDKIFLTVGEAV  647



>ref|XP_004964529.1| PREDICTED: probable sulfate transporter 3.4-like isoform X2 [Setaria 
italica]
Length=679

 Score =   224 bits (572),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 154/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAVVGLID+  A  +WKVDK DF+  + AF GV  +SVQ GLAI
Sbjct  456  PLFHYTPNVILSAIIITAVVGLIDVRGAAKLWKVDKLDFLACMAAFLGVLLVSVQMGLAI  515

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP  ++ G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+ 
Sbjct  516  AVGISLFKILLQVTRPNMVVKGLVPGTQTYRSVVQYREAVRVPAFLVVGVESAIYFTNSM  575

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER+ R++ + E    ++  QS +R VVLDMSA++AIDTSG+    +L+  L+K+ +E
Sbjct  576  YLVERVMRYLRDEEEMALKS-NQSSIRCVVLDMSAVAAIDTSGLDALSELKKILDKRNIE  634

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E++  +    +   SD LF +V EAV+A
Sbjct  635  LVLANPVGSVAERMFNS-AVGETFGSDRLFFSVAEAVAA  672



>gb|EPS70563.1| hypothetical protein M569_04193, partial [Genlisea aurea]
Length=403

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 164/224 (73%), Gaps = 2/224 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II++A++GLID  AA  +WKVDKFDF+V + A+ GV F S++ GL +
Sbjct  178  PLFHYTPLVVLASIIISAMLGLIDYEAAVHLWKVDKFDFLVCISAYVGVVFASIEIGLIL  237

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SI +V+L + RPKT++LGNIP + +YR +D Y+ A+T PG LIL I+ P+ F N+ 
Sbjct  238  AVGLSILRVVLFVARPKTLVLGNIPESKVYRSVDQYRTAVTVPGILILGIDGPIYFANSN  297

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            +L+ERISR + + E E  ++  ++DL  V+LDM+ I  IDTSGI+  ++++  +E++G++
Sbjct  298  FLRERISRCV-DDEEERLKSDGETDLHHVILDMTTIGNIDTSGITMLEEIKKIIERRGLK  356

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTI  263
            L LVNP  EV++KL +AE  + + +S  +FLTVG+AV A +  +
Sbjct  357  LSLVNPGAEVIKKLNKAEFLETVGES-WIFLTVGDAVGACNCVL  399



>ref|XP_009398827.1| PREDICTED: probable sulfate transporter 3.4 [Musa acuminata subsp. 
malaccensis]
Length=653

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 155/224 (69%), Gaps = 2/224 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII++AV+GLID+  A  +WKVDKFDF+  + AF GV  +SV  GL+I
Sbjct  432  PLFHYTPNVILSAIIISAVIGLIDVRGAILLWKVDKFDFLACMSAFLGVLLLSVPIGLSI  491

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            +VGIS+ K+L   TRP   ++GNIPGT  YRDL  YKEA   P FLIL IE+PV F N+ 
Sbjct  492  SVGISVLKILFHATRPNIAVMGNIPGTNSYRDLAQYKEAKRMPSFLILGIESPVYFTNSV  551

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI E E     + ++  L+ ++LDM+A++ ID SGI   K+L+ TL+++ +E
Sbjct  552  YLQERILRWIREEEERITNSNER-PLKCIILDMAAVTNIDISGIESLKELKRTLDRRSLE  610

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTI  263
            LVL NP+GEV +KL  +    ++   +  ++TV EA+++ S  I
Sbjct  611  LVLANPVGEVSQKLSHS-GAWELFGPECFYMTVEEAIASTSYKI  653



>ref|XP_008368821.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 3.1-like 
[Malus domestica]
Length=652

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+TA++GLID  AA  +WKVDKFDF++ + A+ GV F SV+ GL +
Sbjct  416  PLFHYTPLVVLSAIIITAMLGLIDYEAAIHLWKVDKFDFVICMSAYIGVVFASVEIGLVV  475

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T +LG +P +  YR++D Y+ A   PG LIL I+AP+ F NT 
Sbjct  476  AVAISVIRVLLFVARPRTFILGTLPNSMDYRNVDQYQSASNIPGILILEIDAPIYFANTN  535

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E +  ++  +S L++V+LDMSA++ IDTSGIS F++++  ++++G++
Sbjct  536  YLRERIARWI-NDEEDRIKSAGESSLQYVILDMSAVANIDTSGISMFEEVKKLIDRRGLQ  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ ++E  + I     ++LTV EAV+A +
Sbjct  595  LVLANPGGEVMKKMNKSELIEKI-GQQWIYLTVAEAVAACN  634



>ref|XP_010515628.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Camelina 
sativa]
 ref|XP_010515629.1| PREDICTED: sulfate transporter 3.1-like isoform X2 [Camelina 
sativa]
Length=659

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 166/234 (71%), Gaps = 4/234 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  419  PLFYYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  479  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERIIRWIDEEEDRVKQS-GESSLQYIILDMSAVGNIDTSGISMMEEIKKVIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS---STIKFQVPAD  242
            LVL NP GEV++KL R+    D +  + +FLTVGEAV A S    T + + PA 
Sbjct  598  LVLANPKGEVVKKLTRSNFIGDHLGKEWMFLTVGEAVEACSFMLHTFRNEQPAS  651



>gb|EEC79974.1| hypothetical protein OsI_21599 [Oryza sativa Indica Group]
Length=671

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 152/219 (69%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID+  A  +WKVDK DF+  + AF GV  +SVQ GLAI
Sbjct  448  PLFHYTPNVILSAIIITAVIGLIDVRGAARLWKVDKLDFLACMAAFLGVLLVSVQMGLAI  507

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP  ++ G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+ 
Sbjct  508  AVGISLFKILLQVTRPNMVVKGVVPGTASYRSMAQYREAMRVPSFLVVGVESAIYFANSM  567

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E +    +   Q  +R ++LDMSA++AIDTSG+    +L+  LEK+ +E
Sbjct  568  YLGERIMRFLREEDERAAKC-NQCPVRCIILDMSAVAAIDTSGLDALAELKKVLEKRNIE  626

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E+L  +   K    SD +F +V EAV+A
Sbjct  627  LVLANPVGSVTERLYNSVVGKTF-GSDRVFFSVAEAVAA  664



>dbj|BAJ34524.1| unnamed protein product [Thellungiella halophila]
Length=658

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA+ +WKVDKFDF+V + A+FGV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSSIIIAAMLGLIDYQAAFHLWKVDKFDFLVCMSAYFGVVFGSVEIGLVL  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RP+T + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N  
Sbjct  479  AVAISIARLLLFMSRPRTAVKGNIPNSMIYRNTEQYPYSRTVPGLLILEIDAPIYFANAG  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI + E E  +T  +S L++V+LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERITRWI-DEEEERAKTSGESSLQYVILDMSAVGNIDTSGISMMEEIKKIIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++     +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSKFIDGNLGKEWMFLTVGEAVEACS  638



>gb|KJB56718.1| hypothetical protein B456_009G132900 [Gossypium raimondii]
Length=634

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID  AAY +WKVDKFDF+  +C+FFGV FISV  GLAI
Sbjct  440  PLFYYTPNVILAAIIITAVIGLIDYRAAYKLWKVDKFDFLACMCSFFGVLFISVPLGLAI  499

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP T++LGNIP T IY+ L+ YKEA   P FLIL+IE+P+ F N+T
Sbjct  500  AVGVSIFKILLHVTRPNTVVLGNIPRTQIYQSLNRYKEASRVPSFLILAIESPIYFANST  559

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ER+ RW+ E E    ++  +S L+ +++DM+A+SAIDTSGI    +LR  LEK+ ++
Sbjct  560  YLQERMLRWVREEEERINES-HESTLKCIIIDMTAVSAIDTSGIDMLCELRKILEKRSLQ  618

Query  394  L  392
            +
Sbjct  619  V  619



>ref|XP_006403870.1| hypothetical protein EUTSA_v10010178mg [Eutrema salsugineum]
 gb|ESQ45323.1| hypothetical protein EUTSA_v10010178mg [Eutrema salsugineum]
Length=658

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA+ +WKVDKFDF+V + A+FGV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSSIIIAAMLGLIDYQAAFHLWKVDKFDFLVCMSAYFGVVFGSVEIGLVL  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RP+T + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N  
Sbjct  479  AVAISIARLLLFMSRPRTAVKGNIPNSMIYRNTEQYPYSRTVPGLLILEIDAPIYFANAG  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI + E E  +T  +S L++V+LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERITRWI-DEEEERVKTSGESSLQYVILDMSAVGNIDTSGISMMEEIKKIIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++     +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSKFIDGNLGKEWMFLTVGEAVEACS  638



>ref|NP_001056778.1| Os06g0143700 [Oryza sativa Japonica Group]
 dbj|BAD68396.1| putative sulfate transporter Sultr3;4 [Oryza sativa Japonica 
Group]
 dbj|BAF18692.1| Os06g0143700 [Oryza sativa Japonica Group]
Length=670

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 152/219 (69%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID+  A  +WKVDK DF+  + AF GV  +SVQ GLAI
Sbjct  447  PLFHYTPNVILSAIIITAVIGLIDVRGAARLWKVDKLDFLACMAAFLGVLLVSVQMGLAI  506

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP  ++ G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+ 
Sbjct  507  AVGISLFKILLQVTRPNMVVKGVVPGTASYRSMAQYREAMRVPSFLVVGVESAIYFANSM  566

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E +    +   Q  +R ++LDMSA++AIDTSG+    +L+  LEK+ +E
Sbjct  567  YLGERIMRFLREEDERAAKC-NQCPVRCIILDMSAVAAIDTSGLDALAELKKVLEKRNIE  625

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E+L  +   K    SD +F +V EAV+A
Sbjct  626  LVLANPVGSVTERLYNSVVGKTF-GSDRVFFSVAEAVAA  663



>ref|XP_010426769.1| PREDICTED: sulfate transporter 3.1 isoform X1 [Camelina sativa]
 ref|XP_010426770.1| PREDICTED: sulfate transporter 3.1 isoform X2 [Camelina sativa]
Length=658

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  419  PLFYYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  479  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGLLILEIDAPIYFANAS  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERIIRWIDEEEDRVKQS-GESSLQYIILDMSAVGNIDTSGISMMEEIKKVIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R+    D +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSNFIGDHLGKEWMFLTVGEAVEACS  638



>ref|XP_003557209.1| PREDICTED: probable sulfate transporter 3.4 [Brachypodium distachyon]
Length=647

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 154/219 (70%), Gaps = 6/219 (3%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAVVGLID+  A  +WKVDK DF+  L AF GV  +SVQ GLA+
Sbjct  427  PLFHYTPNVILSAIIITAVVGLIDVRGAARLWKVDKLDFMACLAAFLGVLLVSVQVGLAV  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FKVLLQ+TRP T+++G IPGT  +R++  YK+A+  P FL++ +E+ + F N+T
Sbjct  487  AVGISLFKVLLQVTRPNTVIMGRIPGTQSFRNMAQYKDAVKVPSFLVVGVESAIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E E E  Q      ++ VVLDM A++AIDTSG+    +L+  L+K+ VE
Sbjct  547  YLVERIMRYLREEEEEGGQ-----GVKCVVLDMGAVAAIDTSGLDALAELKRVLDKRAVE  601

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+  V E++  +    +   SD +F +V EAV+A
Sbjct  602  LVLANPVASVTERMY-SSVVGETFGSDRIFFSVAEAVAA  639



>ref|XP_002877831.1| sulfate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54090.1| sulfate transporter [Arabidopsis lyrata subsp. lyrata]
Length=659

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  420  PLFHYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLIV  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RP+T + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  480  AVAISIARLLLFVSRPRTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  540  YLRERIIRWIDEEEERVKQS-GESSLQYIILDMSAVGNIDTSGISMMEEIKKVIDRRALK  598

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  599  LVLANPKGEVVKKLTRSKFIGDHLGKEWMFLTVGEAVEACS  639



>emb|CDX90628.1| BnaA03g41530D [Brassica napus]
Length=658

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II++A++GLID  AA  +W VDKFDF+V + A+FGV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSSIIISAMLGLIDYQAAIHLWNVDKFDFLVCMSAYFGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RP+T + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N  
Sbjct  479  AVAISIARLLLFMSRPRTAIKGNIPNSMIYRNTEQYPYSRTVPGLLILEIDAPIYFANAG  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E E  +T  ++ L++V+LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERITRWI-NEEEERVKTSGENSLQYVILDMSAVGNIDTSGISMMEEIKKIIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSKFIDDKLGKEWMFLTVGEAVEACS  638



>ref|XP_008356897.1| PREDICTED: probable sulfate transporter 3.4 [Malus domestica]
Length=298

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+  ID  A Y +WKVDK DF+  +CAF GV FISV  GLAI
Sbjct  88   PLFYYTPNVILAAIIITAVI--IDYQAQYRLWKVDKLDFMACMCAFLGVLFISVPLGLAI  145

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+SIFK+LL +TRP TM LGNIPGT  Y +L+ Y+E      FLIL++EAP+ F N+T
Sbjct  146  AVGVSIFKILLHVTRPNTMALGNIPGTQTYHNLNRYREVSRISSFLILAVEAPIYFANST  205

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YLKERI RW+ E E   + + +++ L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  206  YLKERIIRWVREEEERIKASNEKA-LKCIILDMTAVTAIDTSGIDMMSELRKMLEKRSLQ  264

Query  394  LVLVNPLGEVLEKLQRAE  341
            LVL NP+G V+EKLQ+++
Sbjct  265  LVLANPVGSVMEKLQQSK  282



>dbj|BAA25175.1| sulfate transporter [Arabidopsis thaliana]
Length=646

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  407  PLFHYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  466

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  467  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  526

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS   +++  ++++ ++
Sbjct  527  YLRERIIRWIDEEEERVKQS-GESSLQYIILDMSAVGNIDTSGISMMVEIKKVIDRRALK  585

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  586  LVLSNPKGEVVKKLTRSKFIGDHLGKEWMFLTVGEAVEACS  626



>ref|NP_190758.2| sulfate transporter 3;1 [Arabidopsis thaliana]
 sp|Q9SV13.1|SUT31_ARATH RecName: Full=Sulfate transporter 3.1; AltName: Full=AST12; AltName: 
Full=AtST1 [Arabidopsis thaliana]
 emb|CAB41310.1| sulfate transporter (ATST1) [Arabidopsis thaliana]
 gb|AAM20724.1| sulfate transporter ATST1 [Arabidopsis thaliana]
 gb|AEE78860.1| sulfate transporter 3.1 [Arabidopsis thaliana]
Length=658

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  479  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS   +++  ++++ ++
Sbjct  539  YLRERIIRWIDEEEERVKQS-GESSLQYIILDMSAVGNIDTSGISMMVEIKKVIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  598  LVLSNPKGEVVKKLTRSKFIGDHLGKEWMFLTVGEAVEACS  638



>gb|EMS52732.1| putative sulfate transporter 3.4 [Triticum urartu]
Length=624

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 153/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID+  A  +WKVDK DF   + AF GV  +SVQ GL+I
Sbjct  401  PLFHYTPNVILSAIIITAVAGLIDVRGAAKLWKVDKLDFCACVSAFLGVLLVSVQVGLSI  460

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP T+++G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+T
Sbjct  461  AVGISLFKILLQVTRPNTVVMGLVPGTQSYRSMAQYREAVRVPPFLVVGVESAIYFANST  520

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E E    +      +R +VLDMSA++AIDTSG+    +++  L+K+G++
Sbjct  521  YLVERIMRYLREEEERAAKA-NLCGVRCIVLDMSAVTAIDTSGLDALAEMKRVLDKRGID  579

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E++  +    D   SD +F +V EAV+A
Sbjct  580  LVLANPVGSVTERMYNS-VVGDTFGSDRIFFSVAEAVAA  617



>dbj|BAA21657.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  479  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS   +++  ++++ ++
Sbjct  539  YLRERIIRWIDEEEERVKQS-GESSLQYIILDMSAVGNIDTSGISMMVEIKKVIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  598  LVLSNPKGEVVKKLTRSKFIGDHLGKEWMFLTVGEAVEACS  638



>ref|XP_010503899.1| PREDICTED: sulfate transporter 3.1-like [Camelina sativa]
Length=658

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  419  PLFYYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLIV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  479  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERIIRWIDEEEDRVKQS-GESSLQYIILDMSAVGNIDTSGISMMEEIKKVIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R+    D +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSNFIGDHLGKEWMFLTVGEAVEACS  638



>emb|CAN70402.1| hypothetical protein VITISV_039695 [Vitis vinifera]
Length=533

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 160/221 (72%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA  +WKVDKFDFIV + A+ GV F SV+ GL +
Sbjct  297  PLFHYTPLVVLSSIIIAAMLGLIDYDAAIHLWKVDKFDFIVCIAAYIGVVFGSVEIGLVL  356

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +++L + RP+T +LGNIP + IYR +D Y  A T PG LIL I+AP+ F N  
Sbjct  357  AVAISLLRMVLFVARPRTTVLGNIPNSKIYRSVDQYPAASTVPGVLILEIDAPIYFANAG  416

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI + E ++ +   +S L++V+LDM A+  IDTSGIS  ++++  +E+ G++
Sbjct  417  YLRERISRWI-DEEEDKLKAAGESSLQYVILDMGAVGNIDTSGISMLEEVKKNMERSGLK  475

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ +++   +++  + ++LTVGEAV A +
Sbjct  476  LVLANPGGEVMKKMNKSKFI-EVLGQEWIYLTVGEAVGACN  515



>ref|XP_004235704.1| PREDICTED: probable sulfate transporter 3.4 [Solanum lycopersicum]
Length=666

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 154/225 (68%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLFQYTPNVIL AII+TAV+GLID   A+ +WKVDK D I  L +FFGV FISV  GL I
Sbjct  433  PLFQYTPNVILAAIIITAVIGLIDYQGAFRLWKVDKLDCIACLSSFFGVLFISVPVGLLI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL +TRP T  LG I  T  ++ L  Y  A+  P FLI+++EAP  F N+T
Sbjct  493  AVGISVFKILLHVTRPNTNALGYISSTRSFQSLSRYTTAVRIPSFLIIAVEAPFYFANST  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E +  +T ++  ++ +++DM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  553  YLHERTLRWI-REEEDRIKTNQEPPIKCIIIDMTAVTAIDTSGIDTICELRRILEKRSLK  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL  +    +    D L+LTV EAV  +SS+ K
Sbjct  612  LVLANPVGNVMEKLFNSNAL-EAFGLDGLYLTVSEAVDDISSSWK  655



>ref|XP_006655780.1| PREDICTED: probable sulfate transporter 3.4-like [Oryza brachyantha]
Length=686

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 152/219 (69%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID   A  +WKVDK DF+  + AFFGV  +SVQ GLAI
Sbjct  463  PLFHYTPNVILSAIIITAVIGLIDFQGAAKLWKVDKLDFLACMAAFFGVLLVSVQMGLAI  522

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP  ++ G IPGT  YR +  Y+EA+  P FL++ +E+ + F N+ 
Sbjct  523  AVGISLFKILLQVTRPNMVIKGVIPGTQSYRSMVQYREAMRVPSFLVVGVESAIYFANSM  582

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E E    ++  Q  +R ++LDMSA++AIDTSG+    +L   L+K+ VE
Sbjct  583  YLVERIVRFLREEEERALKS-NQCPVRCIILDMSAVAAIDTSGLDALAELNRVLDKRNVE  641

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E+L  +   K    SD +F +V EAV+A
Sbjct  642  LVLANPVGSVTERLYNSVVGKTF-GSDRVFFSVAEAVAA  679



>gb|EYU46548.1| hypothetical protein MIMGU_mgv1a002543mg [Erythranthe guttata]
Length=660

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 166/229 (72%), Gaps = 2/229 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +IIV A++GLID  AA  +W VDKFDF+V + A+ GV F +++ GL +
Sbjct  418  PLFHYTPLVVLSSIIVAAMLGLIDYEAAIHLWHVDKFDFVVCMSAYIGVVFANIEIGLVM  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+G+S+ +VLL + RPKT++LGNIP + +YR++D Y+ A   PG LIL I+AP+ F N+ 
Sbjct  478  AIGLSVVRVLLFVARPKTLVLGNIPDSKVYRNVDQYQNAQCVPGILILEIDAPIYFANSN  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI++ E   + T  +++L+ ++LDMSA+  IDTSGIS  ++++ T++++G++
Sbjct  538  YLRERISRWIDDEEDRIKST-GETELQCIILDMSAVGNIDTSGISMLEEVKKTVDRRGLK  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVP  248
            L L NP GEV++KL +++   + +  + +FLTVGEAV A +  +    P
Sbjct  597  LGLANPGGEVMKKLNKSKFL-ETMGEEWIFLTVGEAVGACNYMLHTTNP  644



>gb|AAC14417.1| unknown [Arabidopsis thaliana]
Length=703

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID  AA  +WKVDKFDF+V + A+ GV F SV+ GL +
Sbjct  464  PLFHYTPLVVLSAIIISAMLGLIDYQAAIHLWKVDKFDFLVCMSAYVGVVFGSVEIGLVV  523

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RPKT + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N +
Sbjct  524  AVAISIARLLLFVSRPKTAVKGNIPNSMIYRNTEQYPSSRTVPGILILEIDAPIYFANAS  583

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI+E E   +Q+  +S L++++LDMSA+  IDTSGIS   +++  ++++ ++
Sbjct  584  YLRERIIRWIDEEEERVKQS-GESSLQYIILDMSAVGNIDTSGISMMVEIKKVIDRRALK  642

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  643  LVLSNPKGEVVKKLTRSKFIGDHLGKEWMFLTVGEAVEACS  683



>gb|KHG13885.1| Sulfate transporter 3 [Gossypium arboreum]
Length=458

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 158/221 (71%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GL+D  AA  +WK+DKFDF + L A+ GV   SV+ GL I
Sbjct  218  PLFHYTPLVVLSSIIIAAMLGLLDYEAAIHLWKIDKFDFFICLGAYLGVVLGSVEIGLII  277

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            A+ +S+ +++L + RP+TM+LGNIP +GIYR +D Y+ A + PG LIL I+APV F N +
Sbjct  278  AITVSLLRIILFVARPRTMVLGNIPNSGIYRSMDQYQIANSVPGILILQIDAPVFFANAS  337

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI   E +  ++  ++ L +V+LD+SA+ +IDTSGIS  ++L   + +KG++
Sbjct  338  YLRERISRWI-YEEEDRLKSAGEASLHYVILDLSAVGSIDTSGISMLEELMKNVHRKGLQ  396

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            L+L NP  E+++KL +++   D +    +FLTV EAVSA +
Sbjct  397  LLLANPQSEMMKKLDKSKLI-DKIGQGWIFLTVEEAVSACN  436



>ref|XP_011026981.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
Length=649

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA  +WKVDK DFIV + A+ GV F SV++GL I
Sbjct  409  PLFHYTPIVVLSSIIIAAMLGLIDYEAAIGLWKVDKCDFIVCMSAYIGVVFGSVESGLVI  468

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ ++LL + RP+T +LGNIP + I+R +D Y  A   PG LIL I+APV F N  
Sbjct  469  AVTISLLRMLLSVARPRTFLLGNIPNSMIFRSIDQYPVANNIPGVLILQIDAPVYFANAN  528

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI E E + + T  +S L++V+LD+SA+ + DTSGIS FK+++ +++++G++
Sbjct  529  YLRERISRWIYEEEEKLKST-GESSLQYVILDLSAVGSTDTSGISMFKEVKKSIDRRGLK  587

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP  EV++KL +++  + I   + ++LTVGEAV+A +
Sbjct  588  LVLANPRSEVIKKLVKSKFIESI-GQEWIYLTVGEAVAACN  627



>ref|XP_010102377.1| Sulfate transporter 3.1 [Morus notabilis]
 gb|EXB93349.1| Sulfate transporter 3.1 [Morus notabilis]
Length=660

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 163/231 (71%), Gaps = 2/231 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+ A++GLID  AA  +WKVDKFD IV + A+ GV F SV+ GL I
Sbjct  418  PLFHYTPLVVLSAIIIAAMLGLIDYEAAIHLWKVDKFDLIVCISAYVGVVFGSVEVGLVI  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T +LGNIP + IYR+ + Y  A   PG LIL I+AP+ F N+ 
Sbjct  478  AVAISLLRVLLFVARPRTFVLGNIPDSMIYRNAEQYTNASNVPGILILEIDAPIYFANSN  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI + E +  ++  ++ L++V+LD++A+  IDTSG+S   +++ T+E++G++
Sbjct  538  YLRERISRWI-DDEEDRIKSAGETSLQYVILDLTAVGNIDTSGLSMVDEVKKTIERRGLK  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPAD  242
            LVL NP  EV++KL ++E   D +  + ++LTVGEAV A +  +    P+D
Sbjct  597  LVLANPGSEVMKKLNKSELI-DKIGQEWIYLTVGEAVEACNFMLHTCKPSD  646



>ref|XP_009136641.1| PREDICTED: sulfate transporter 3.1-like [Brassica rapa]
Length=658

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II++A++GLID  AA  +W VDKFDF+V + A+FGV F SV+ GL +
Sbjct  419  PLFHYTPLVVLSSIIISAMLGLIDYQAAIHLWNVDKFDFLVCMSAYFGVVFGSVEIGLVV  478

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISI ++LL ++RP+T + GNIP + IYR+ + Y  + T PG LIL I+AP+ F N  
Sbjct  479  AVAISIARLLLFMSRPRTAIKGNIPNSMIYRNTEQYPYSRTVPGLLILEIDAPIYFTNAG  538

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI   E E  +T  ++ L++V+LD+SA+  IDTSGIS  ++++  ++++ ++
Sbjct  539  YLRERITRWI-NEEEERVKTSGENSLQYVILDLSAVGNIDTSGISMMEEIKKIIDRRALK  597

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++KL R++   D +  + +FLTVGEAV A S
Sbjct  598  LVLANPKGEVVKKLTRSKFIDDKLGKEWMFLTVGEAVEACS  638



>gb|EMT18395.1| Putative sulfate transporter 3.4 [Aegilops tauschii]
Length=641

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 153/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV GLID+  A  +WKVDK DF   + AF GV  +SVQ GL+I
Sbjct  418  PLFHYTPNVILSAIIITAVAGLIDVRGAAKLWKVDKLDFCACVAAFLGVLLVSVQVGLSI  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LLQ+TRP T+++G +PGT  YR +  Y+EA+  P FL++ +E+ + F N+T
Sbjct  478  AVGISLFKILLQVTRPNTVVMGLVPGTQSYRSMAQYREAVRVPPFLVVGVESAIYFANST  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ERI R++ E E    +      +R +VLDMSA++AIDTSG+    +++  L+K+G++
Sbjct  538  YLVERIMRYLREEEERAAKA-NLCGVRCIVLDMSAVTAIDTSGLDALAEMKRVLDKRGID  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSA  278
            LVL NP+G V E++  +    +   SD +F +V EAV+A
Sbjct  597  LVLANPVGSVTERMYNS-VVGETFGSDRIFFSVAEAVAA  634



>ref|XP_008798427.1| PREDICTED: sulfate transporter 1.3-like [Phoenix dactylifera]
Length=658

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 159/217 (73%), Gaps = 2/217 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPN IL +II++AVVGLID  AA+ IWKVD+ DF+  + AF GV F+SV+ GL I
Sbjct  433  PLFKYTPNAILASIIISAVVGLIDYEAAFLIWKVDRLDFVACMGAFLGVIFVSVEIGLLI  492

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ K+LLQ+TRP+T +LGN+PGT IYR+++ Y EA   PG LI+ +++ + F N+ 
Sbjct  493  AVSISLAKILLQVTRPRTALLGNLPGTSIYRNIEQYPEATKVPGVLIVRVDSAIYFTNSN  552

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y+KERI RW+   E E+ + K+   + F+++DMS ++ IDTSG+  F+DL  +L+K+ V+
Sbjct  553  YVKERILRWL-RDEEEQLEAKQLPRIDFLIVDMSPVTDIDTSGVHAFEDLHKSLQKRSVQ  611

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAV  284
            LVL NP   V++KL  A+ T +++  D +FLTVG AV
Sbjct  612  LVLANPGPIVIDKLHLAKFT-ELIGHDMIFLTVGAAV  647



>ref|XP_008807263.1| PREDICTED: sulfate transporter 3.1-like [Phoenix dactylifera]
Length=660

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 168/230 (73%), Gaps = 2/230 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA  +W+VDK DF V L A+ GV F SV+ GL I
Sbjct  420  PLFHYTPLVVLSSIIIAAMLGLIDYEAAIHLWQVDKIDFCVCLGAYLGVVFGSVEIGLVI  479

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV ISIF+VLL + RP+T +LGNIP + IY+ +D Y  A + PG +IL ++AP+ F + +
Sbjct  480  AVAISIFRVLLFVARPRTTVLGNIPNSMIYQRMDQYPVAQSVPGVIILRVDAPIYFASAS  539

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI + E ++ ++K ++ L++V+LD+ A+S+IDTSGIS   +++ +++++G++
Sbjct  540  YLRERISRWI-DEEEDKLKSKTKTSLQYVILDLGAVSSIDTSGISMLVEVKKSMDRRGLQ  598

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPA  245
            LVL NP GEV++KL ++ E  + +  + +FLTVG+AV+A + T+    P 
Sbjct  599  LVLANPGGEVMKKLDKS-EVLETIGHEWIFLTVGDAVAACNFTLHTCKPG  647



>ref|XP_009409847.1| PREDICTED: sulfate transporter 1.2-like, partial [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 157/221 (71%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF+YTPN +L AII++AV+GLID   AY IWKVDK DF+  + AFFGV FISV+ GL I
Sbjct  408  PLFKYTPNAVLAAIIISAVIGLIDYQTAYLIWKVDKLDFLACMGAFFGVVFISVEIGLLI  467

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS  K+LLQ+TRP+T +LGN+PGT IYR+++ Y E I  PG LI+ +++ + F N+ 
Sbjct  468  AVMISFAKILLQVTRPRTALLGNLPGTEIYRNVEQYPETIKVPGVLIVRVDSAIYFTNSN  527

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            Y +ERI RW+ + E E+ + K    + F+++++S +  IDTSGI  F+DL   L+K GV+
Sbjct  528  YARERILRWL-KDEVEQIKAKNLPMIEFLIVELSPVIDIDTSGIHAFEDLHTALQKHGVQ  586

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            L+L NP   V++KL R+    +I+  D +FLTVG+AV A +
Sbjct  587  LLLANPGAAVIQKL-RSSGFIEIIGRDKIFLTVGDAVKACA  626



>ref|XP_009370789.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=654

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 160/221 (72%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII+ A++GLID  AA  +WKVDKFDF++ + A+ GV F SV+ GL +
Sbjct  414  PLFHYTPLVVLSAIIIAAMLGLIDYEAAIHLWKVDKFDFVICMSAYIGVVFGSVEIGLVV  473

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +VLL + RP+T++LGN+P +  YR++D Y+ A   PG LIL I+AP+ F NT 
Sbjct  474  AVAISVMRVLLFVARPRTLVLGNLPNSTDYRNVDQYQSASNIPGILILEIDAPIYFANTN  533

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E +  ++  +S L++V+LDMSA+  IDTSGIS F +++  ++++G++
Sbjct  534  YLRERIIRWI-NDEEDRIKSAGESSLQYVILDMSAVGNIDTSGISMFDEVKKLIDRRGLQ  592

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ ++E  + +     ++LTV EAV+A +
Sbjct  593  LVLANPGGEVMKKMNKSELIERL-GQQWIYLTVAEAVAACN  632



>ref|XP_002314667.1| hypothetical protein POPTR_0010s09280g [Populus trichocarpa]
 gb|EEF00838.1| hypothetical protein POPTR_0010s09280g [Populus trichocarpa]
Length=653

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 161/221 (73%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA S+WKVDK DFIV + A+FGV F SV+ GL I
Sbjct  410  PLFHYTPLVVLSSIIIAAMLGLIDYEAAISLWKVDKCDFIVCMSAYFGVVFGSVEIGLVI  469

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ ++L+ + RP+T +LGNIP + IYR +D Y  A   PG LIL I+APV F N  
Sbjct  470  AVAISLLRMLMSVARPRTFLLGNIPNSMIYRSIDQYPIANNVPGVLILQIDAPVYFANAN  529

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI E E + + T   S L++V+LD+SA+ +IDTSGIS  ++++  ++++ ++
Sbjct  530  YLRERISRWIYEEEEKLKSTGG-SSLQYVILDLSAVGSIDTSGISMLEEVKKNIDRRDLK  588

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP  EV++KL++++  + I   + ++LTVGEAV+A +
Sbjct  589  LVLANPRSEVIKKLEKSKFMESI-GQEWIYLTVGEAVAACN  628



>ref|XP_006343117.1| PREDICTED: probable sulfate transporter 3.4-like [Solanum tuberosum]
Length=662

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 153/225 (68%), Gaps = 2/225 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVIL AII+TAV+GLID   A+ +WKVDK D I  L +FFGV FISV  GL I
Sbjct  429  PLFHYTPNVILAAIIITAVIGLIDYQGAFRLWKVDKLDCIACLSSFFGVLFISVAIGLLI  488

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGIS+FK+LL +TRP T +LG I  T  ++ L  Y  A+  P FLI+++EAP  F N+T
Sbjct  489  AVGISVFKILLHVTRPNTNVLGYISSTRSFQSLSRYTTAVRIPSFLIIAVEAPFYFANST  548

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL ER  RWI   E +  +  ++  ++ V+LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  549  YLHERTLRWI-REEEDRIKANQEPPIKCVILDMTAVTAIDTSGIDTICELRRILEKRSLK  607

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIK  260
            LVL NP+G V+EKL  +    +    D L+LTV EAV  +SS+ K
Sbjct  608  LVLANPVGNVMEKLFNSNAL-EAFGLDGLYLTVSEAVDDISSSWK  651



>ref|XP_011002697.1| PREDICTED: probable sulfate transporter 3.4 isoform X2 [Populus 
euphratica]
Length=621

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTPNVILGAII++AV+GLID  AAY +WKVDK DF+  LC+FFGV FISV  GL I
Sbjct  427  PLFYYTPNVILGAIIISAVIGLIDYQAAYCLWKVDKLDFLACLCSFFGVLFISVPLGLGI  486

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVG+S+FK+LL +TRP ++++GNI GT IY  L  YKEA   P FLIL+IE+P+ F N+T
Sbjct  487  AVGVSVFKILLHVTRPNSLIMGNIKGTQIYHSLSRYKEASRVPSFLILAIESPIYFANST  546

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI RWI   E E  +    S L+ ++LDM+A++AIDTSGI    +LR  LEK+ ++
Sbjct  547  YLQERILRWI-REEDEWIKANDGSPLKCIILDMTAVTAIDTSGIDLLCELRKMLEKRSLK  605

Query  394  LVL  386
             VL
Sbjct  606  FVL  608



>ref|XP_003632327.1| PREDICTED: sulfate transporter 3.1-like [Vitis vinifera]
Length=654

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 161/221 (73%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA  +WKVDKFDFIV + A+ GV F SV+ GL +
Sbjct  418  PLFHYTPLVVLSSIIIAAMLGLIDYDAAIHLWKVDKFDFIVCIAAYIGVVFGSVEIGLVL  477

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +++L + RP+T +LGNIP + IYR +D Y  A T PG LIL I+AP+ F N  
Sbjct  478  AVAISLLRMVLFVARPRTTVLGNIPNSKIYRSVDQYPAASTVPGVLILEIDAPIYFANAG  537

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI + E ++ +   +S L++V+LDM A+  IDTSGIS  ++++ ++E+ G++
Sbjct  538  YLRERISRWI-DEEEDKLKAAGESSLQYVILDMGAVGNIDTSGISMLEEVKKSMERSGLK  596

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ +++   +++  + ++LTVGEAV A +
Sbjct  597  LVLANPGGEVMKKMNKSKFI-EVLGQEWIYLTVGEAVGACN  636



>emb|CBI28733.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 161/221 (73%), Gaps = 2/221 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L +II+ A++GLID  AA  +WKVDKFDFIV + A+ GV F SV+ GL +
Sbjct  416  PLFHYTPLVVLSSIIIAAMLGLIDYDAAIHLWKVDKFDFIVCIAAYIGVVFGSVEIGLVL  475

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AV IS+ +++L + RP+T +LGNIP + IYR +D Y  A T PG LIL I+AP+ F N  
Sbjct  476  AVAISLLRMVLFVARPRTTVLGNIPNSKIYRSVDQYPAASTVPGVLILEIDAPIYFANAG  535

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERISRWI + E ++ +   +S L++V+LDM A+  IDTSGIS  ++++ ++E+ G++
Sbjct  536  YLRERISRWI-DEEEDKLKAAGESSLQYVILDMGAVGNIDTSGISMLEEVKKSMERSGLK  594

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALS  272
            LVL NP GEV++K+ +++   +++  + ++LTVGEAV A +
Sbjct  595  LVLANPGGEVMKKMNKSKFI-EVLGQEWIYLTVGEAVGACN  634



>gb|AAN06871.1| Putative sulfate transporter ATST1 [Oryza sativa Japonica Group]
Length=637

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 161/230 (70%), Gaps = 2/230 (1%)
 Frame = -2

Query  934  PLFQYTPNVILGAIIVTAVVGLIDIPAAYSIWKVDKFDFIVLLCAFFGVTFISVQNGLAI  755
            PLF YTP V+L AII++A++GLID PAA  +W+VDK DF V L A+ GV F SV+ GL +
Sbjct  397  PLFHYTPLVVLSAIIMSAMLGLIDYPAAVHLWQVDKVDFCVCLGAYLGVVFGSVEIGLVV  456

Query  754  AVGISIFKVLLQITRPKTMMLGNIPGTGIYRDLDHYKEAITTPGFLILSIEAPVNFVNTT  575
            AVGISI +VLL + RP+T +LGNIP T IYR +D Y  A   PG L+L +++P+ F N +
Sbjct  457  AVGISILRVLLFVARPRTTVLGNIPNTMIYRRMDQYTAAQRVPGVLVLRVDSPIYFTNAS  516

Query  574  YLKERISRWIeeyeaeeEQTKKQSDLRFVVLDMSAISAIDTSGISFFKDLRMTLEKKGVE  395
            YL+ERI+RWI++ E + ++ K +  +++VVLDM A+ +IDTSG S   +LR TL+++G++
Sbjct  517  YLRERIARWIDDEEDQCKE-KGEMGIQYVVLDMGAVGSIDTSGTSMLDELRKTLDRRGLQ  575

Query  394  LVLVNPLGEVLEKLQRAEETKDIVKSDSLFLTVGEAVSALSSTIKFQVPA  245
            +VL NP  E+++KL  + +  + +  + +F TVGEAV+     +  Q P 
Sbjct  576  IVLANPGSEIMKKLD-SSKVLEAIGHEWIFPTVGEAVAECDFVMHSQKPG  624



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2213930630844