BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6756

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU52654.1|  beta-1,3-glucanase 21                                   300   2e-96   Solanum tuberosum [potatoes]
ref|XP_006354142.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    301   4e-96   Solanum tuberosum [potatoes]
ref|XP_010316236.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      300   1e-95   Solanum lycopersicum
ref|XP_009631831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      298   1e-94   
ref|XP_009778460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      296   8e-94   Nicotiana sylvestris
ref|XP_011087559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    284   4e-90   
ref|XP_012067108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    285   2e-89   Jatropha curcas
ref|XP_011087532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    284   2e-89   Sesamum indicum [beniseed]
ref|XP_012067103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    285   3e-89   
ref|XP_012067107.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    284   4e-89   
emb|CAN72077.1|  hypothetical protein VITISV_020314                     282   7e-89   Vitis vinifera
ref|XP_011025159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    282   1e-88   Populus euphratica
ref|XP_010651369.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   2e-88   Vitis vinifera
ref|XP_002304004.2|  hypothetical protein POPTR_0003s21250g             279   2e-88   
ref|XP_008354983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   3e-88   
ref|XP_009375652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    280   6e-88   Pyrus x bretschneideri [bai li]
ref|XP_004294998.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      278   4e-87   Fragaria vesca subsp. vesca
ref|XP_009364124.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    278   5e-87   Pyrus x bretschneideri [bai li]
emb|CDP16794.1|  unnamed protein product                                278   9e-87   Coffea canephora [robusta coffee]
ref|XP_008229211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      277   1e-86   Prunus mume [ume]
ref|XP_008384395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    277   1e-86   
ref|XP_007205107.1|  hypothetical protein PRUPE_ppa004732mg             277   1e-86   Prunus persica
ref|XP_011048218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    274   2e-85   Populus euphratica
ref|XP_004504325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    273   4e-85   Cicer arietinum [garbanzo]
ref|XP_007161273.1|  hypothetical protein PHAVU_001G056400g             273   5e-85   Phaseolus vulgaris [French bean]
ref|XP_002297638.2|  hypothetical protein POPTR_0001s04360g             272   1e-84   
ref|XP_008352033.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    271   1e-84   
gb|KJB23365.1|  hypothetical protein B456_004G094500                    271   1e-84   Gossypium raimondii
gb|KHG18393.1|  hypothetical protein F383_22096                         271   2e-84   Gossypium arboreum [tree cotton]
gb|KHN12071.1|  Glucan endo-1,3-beta-glucosidase 4                      271   3e-84   Glycine soja [wild soybean]
ref|XP_006601114.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    271   3e-84   Glycine max [soybeans]
ref|XP_010276339.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    269   7e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010276332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    269   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006596127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    269   2e-83   Glycine max [soybeans]
ref|XP_003531243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    268   5e-83   Glycine max [soybeans]
ref|XP_003524953.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    267   7e-83   Glycine max [soybeans]
ref|XP_007159412.1|  hypothetical protein PHAVU_002G236300g             266   1e-82   Phaseolus vulgaris [French bean]
ref|XP_006495278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   2e-82   
ref|XP_007014685.1|  O-Glycosyl hydrolases family 17 protein isof...    266   3e-82   
ref|XP_006445640.1|  hypothetical protein CICLE_v10015028mg             265   7e-82   
ref|XP_010044948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      265   8e-82   Eucalyptus grandis [rose gum]
ref|XP_010257592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    265   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_003629715.1|  Glucan endo-1,3-beta-glucosidase                   264   1e-81   Medicago truncatula
gb|KJB66066.1|  hypothetical protein B456_010G126400                    263   2e-81   Gossypium raimondii
ref|XP_010097806.1|  Glucan endo-1,3-beta-glucosidase 4                 263   2e-81   Morus notabilis
ref|XP_006488904.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   2e-81   Citrus sinensis [apfelsine]
ref|XP_011093510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    263   4e-81   Sesamum indicum [beniseed]
gb|AFK37243.1|  unknown                                                 262   6e-81   Medicago truncatula
ref|XP_010673492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      261   2e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004502208.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    258   2e-79   
ref|XP_003601614.1|  Glucan endo-1,3-beta-glucosidase                   257   8e-79   Medicago truncatula
ref|XP_004502207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    256   1e-78   Cicer arietinum [garbanzo]
gb|KHG04722.1|  hypothetical protein F383_29074                         254   8e-78   Gossypium arboreum [tree cotton]
ref|XP_010673491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    253   1e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008354986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    250   3e-76   
gb|EYU27069.1|  hypothetical protein MIMGU_mgv1a004989mg                249   6e-76   Erythranthe guttata [common monkey flower]
ref|XP_004139073.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      249   9e-76   Cucumis sativus [cucumbers]
ref|XP_008450301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    249   1e-75   Cucumis melo [Oriental melon]
gb|EPS57592.1|  hypothetical protein M569_17225                         239   6e-75   Genlisea aurea
ref|XP_011653551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    245   7e-74   Cucumis sativus [cucumbers]
ref|XP_011653549.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    245   7e-74   Cucumis sativus [cucumbers]
ref|XP_009413316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    244   8e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002884972.1|  glycosyl hydrolase family 17 protein               244   9e-74   
ref|XP_010542461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    243   2e-73   Tarenaya hassleriana [spider flower]
dbj|BAH57260.1|  AT3G13560                                              241   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449819.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    242   6e-73   Cucumis melo [Oriental melon]
ref|XP_009406533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   9e-73   
ref|XP_008449817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    242   1e-72   Cucumis melo [Oriental melon]
ref|NP_187965.1|  glucan endo-1,3-beta-glucosidase 4                    241   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001060087.2|  Os07g0577300                                       241   1e-72   
ref|XP_008449814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   1e-72   Cucumis melo [Oriental melon]
ref|XP_009406534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   1e-72   
gb|EEC82319.1|  hypothetical protein OsI_26597                          241   1e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_010552278.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_009406531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    241   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658732.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    239   3e-72   
gb|EEE67465.1|  hypothetical protein OsJ_24859                          241   4e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009146477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      239   5e-72   Brassica rapa
ref|XP_006407197.1|  hypothetical protein EUTSA_v10020572mg             238   2e-71   Eutrema salsugineum [saltwater cress]
gb|KJB66065.1|  hypothetical protein B456_010G126400                    236   2e-71   Gossypium raimondii
ref|XP_010500722.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      237   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010465199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      237   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008789151.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   5e-71   
dbj|BAC83070.1|  putative elicitor inducible beta-1,3-glucanase         240   5e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008789143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   5e-71   Phoenix dactylifera
gb|EMT26371.1|  Glucan endo-1,3-beta-glucosidase 4                      233   1e-70   
ref|XP_006297495.1|  hypothetical protein CARUB_v10013514mg             234   4e-70   Capsella rubella
ref|XP_010236492.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      233   1e-69   Brachypodium distachyon [annual false brome]
ref|XP_004958122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    236   1e-69   
tpg|DAA63295.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    232   2e-69   
ref|XP_010934539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      232   3e-69   Elaeis guineensis
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   7e-69   Nicotiana sylvestris
ref|XP_002460914.1|  hypothetical protein SORBIDRAFT_02g037380          231   9e-69   Sorghum bicolor [broomcorn]
ref|XP_006828511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    231   1e-68   
gb|EMS60322.1|  Glucan endo-1,3-beta-glucosidase 4                      233   2e-68   Triticum urartu
ref|XP_010527795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      230   2e-68   Tarenaya hassleriana [spider flower]
ref|NP_001131285.1|  putative O-Glycosyl hydrolase superfamily pr...    229   2e-68   Zea mays [maize]
ref|NP_001149308.1|  glucan endo-1,3-beta-glucosidase 4 precursor       229   3e-68   Zea mays [maize]
ref|XP_011628180.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   7e-68   Amborella trichopoda
gb|EMS53703.1|  Glucan endo-1,3-beta-glucosidase 4                      228   8e-68   Triticum urartu
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    228   2e-67   Nicotiana tomentosiformis
ref|XP_004236940.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      228   2e-67   Solanum lycopersicum
dbj|BAJ89950.1|  predicted protein                                      227   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009388452.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    225   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23618.1|  BnaC05g39760D                                          223   1e-66   Brassica napus [oilseed rape]
ref|XP_006599426.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    224   1e-66   Glycine max [soybeans]
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    224   1e-66   Vitis vinifera
gb|AFU52641.1|  beta-1,3-glucanase 6                                    225   2e-66   Solanum tuberosum [potatoes]
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    225   2e-66   Vitis vinifera
emb|CBI26850.3|  unnamed protein product                                224   2e-66   Vitis vinifera
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    224   2e-66   Glycine max [soybeans]
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    224   3e-66   Solanum tuberosum [potatoes]
ref|XP_010528550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      224   5e-66   Tarenaya hassleriana [spider flower]
gb|KEH40581.1|  glucan endo-1,3-beta-glucosidase-like protein           223   6e-66   Medicago truncatula
gb|KEH40580.1|  glucan endo-1,3-beta-glucosidase-like protein           224   6e-66   Medicago truncatula
ref|XP_004297451.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      223   8e-66   Fragaria vesca subsp. vesca
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    223   1e-65   Populus euphratica
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    223   1e-65   Populus euphratica
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             221   1e-65   
emb|CDP00829.1|  unnamed protein product                                223   1e-65   Coffea canephora [robusta coffee]
ref|XP_006448191.1|  hypothetical protein CICLE_v10014990mg             222   2e-65   Citrus clementina [clementine]
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      222   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             221   3e-65   
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             221   3e-65   Populus trichocarpa [western balsam poplar]
gb|EMT28432.1|  Glucan endo-1,3-beta-glucosidase 4                      225   6e-65   
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            220   8e-65   
gb|KDO64566.1|  hypothetical protein CISIN_1g0108331mg                  220   8e-65   Citrus sinensis [apfelsine]
gb|KFK41053.1|  hypothetical protein AALP_AA2G079300                    220   8e-65   Arabis alpina [alpine rockcress]
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      220   9e-65   Sesamum indicum [beniseed]
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      220   1e-64   Glycine soja [wild soybean]
dbj|BAB01763.1|  beta-1,3-glucanase-like protein                        219   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    220   1e-64   
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             219   3e-64   Phaseolus vulgaris [French bean]
gb|KJB30775.1|  hypothetical protein B456_005G159100                    218   3e-64   Gossypium raimondii
gb|KJB15377.1|  hypothetical protein B456_002G174100                    217   4e-64   Gossypium raimondii
ref|XP_008366987.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    218   5e-64   
ref|XP_004498268.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    218   5e-64   Cicer arietinum [garbanzo]
gb|KHG06295.1|  hypothetical protein F383_32557                         218   6e-64   Gossypium arboreum [tree cotton]
ref|XP_008775310.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   6e-64   
gb|KJB30776.1|  hypothetical protein B456_005G159100                    218   7e-64   Gossypium raimondii
ref|XP_007160410.1|  hypothetical protein PHAVU_002G319500g             214   9e-64   Phaseolus vulgaris [French bean]
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                217   1e-63   Erythranthe guttata [common monkey flower]
ref|XP_010267790.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   2e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   2e-63   Elaeis guineensis
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      217   2e-63   Prunus mume [ume]
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    217   2e-63   Phoenix dactylifera
gb|KJB15376.1|  hypothetical protein B456_002G174100                    217   2e-63   Gossypium raimondii
gb|KHG27056.1|  hypothetical protein F383_08405                         217   2e-63   Gossypium arboreum [tree cotton]
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             216   3e-63   Phaseolus vulgaris [French bean]
ref|XP_006391369.1|  hypothetical protein EUTSA_v10018427mg             216   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   3e-63   Cucumis melo [Oriental melon]
gb|KHG27055.1|  hypothetical protein F383_08405                         217   4e-63   Gossypium arboreum [tree cotton]
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      216   4e-63   Cucumis sativus [cucumbers]
ref|XP_002532062.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    214   4e-63   
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    216   4e-63   Eucalyptus grandis [rose gum]
ref|XP_010651370.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   5e-63   
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    215   8e-63   Tarenaya hassleriana [spider flower]
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    216   9e-63   
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      215   9e-63   Fragaria vesca subsp. vesca
ref|XP_012072282.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      215   1e-62   Jatropha curcas
ref|XP_006372566.1|  glycosyl hydrolase family 17 family protein        214   1e-62   
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   2e-62   Glycine max [soybeans]
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      214   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_007160409.1|  hypothetical protein PHAVU_002G319500g             214   2e-62   Phaseolus vulgaris [French bean]
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   2e-62   Glycine max [soybeans]
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               214   2e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   3e-62   
ref|XP_006858991.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 4      214   3e-62   Amborella trichopoda
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    214   3e-62   Ricinus communis
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   3e-62   Cucumis sativus [cucumbers]
ref|XP_002265396.3|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   3e-62   Vitis vinifera
gb|EPS61988.1|  hypothetical protein M569_12804                         211   3e-62   Genlisea aurea
ref|XP_011001568.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      213   4e-62   Populus euphratica
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   5e-62   Glycine max [soybeans]
ref|XP_010511554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   6e-62   Camelina sativa [gold-of-pleasure]
emb|CDY58676.1|  BnaCnng33550D                                          213   6e-62   Brassica napus [oilseed rape]
ref|XP_004503127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   6e-62   Cicer arietinum [garbanzo]
ref|XP_010415170.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   6e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010470501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010470500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    213   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009388453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    212   9e-62   Sesamum indicum [beniseed]
ref|XP_008452393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    212   1e-61   Cucumis melo [Oriental melon]
ref|XP_009382992.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    214   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009127476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    212   1e-61   Brassica rapa
emb|CDY16440.1|  BnaA02g12440D                                          212   1e-61   Brassica napus [oilseed rape]
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    211   2e-61   Solanum tuberosum [potatoes]
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   2e-61   Solanum tuberosum [potatoes]
ref|XP_012086410.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      212   2e-61   Jatropha curcas
gb|KDP25782.1|  hypothetical protein JCGZ_22504                         211   2e-61   Jatropha curcas
gb|EYU45799.1|  hypothetical protein MIMGU_mgv1a004953mg                211   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             211   3e-61   Prunus persica
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        211   3e-61   
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    211   4e-61   
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 211   5e-61   Morus notabilis
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             211   5e-61   Phaseolus vulgaris [French bean]
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   6e-61   Solanum lycopersicum
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   6e-61   Solanum lycopersicum
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             210   6e-61   Citrus clementina [clementine]
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    210   6e-61   Citrus sinensis [apfelsine]
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   7e-61   
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           209   1e-60   Medicago truncatula
ref|XP_008802448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   1e-60   Phoenix dactylifera
ref|XP_003600716.1|  Glucan endo-1,3-beta-glucosidase                   209   2e-60   
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   2e-60   Cicer arietinum [garbanzo]
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    209   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    207   5e-60   
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    207   8e-60   
gb|EPS65983.1|  hypothetical protein M569_08793                         206   9e-60   Genlisea aurea
ref|XP_010670126.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   9e-60   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI16509.3|  unnamed protein product                                207   1e-59   Vitis vinifera
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     206   1e-59   Eucalyptus grandis [rose gum]
ref|XP_011007238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    207   2e-59   Populus euphratica
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      206   3e-59   Eucalyptus grandis [rose gum]
ref|XP_008777063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   3e-59   Phoenix dactylifera
ref|XP_006300850.1|  hypothetical protein CARUB_v10019942mg             209   3e-59   
ref|XP_008777061.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   3e-59   Phoenix dactylifera
ref|XP_008777062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   3e-59   Phoenix dactylifera
ref|XP_011023912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    206   4e-59   Populus euphratica
ref|XP_011023920.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   4e-59   Populus euphratica
gb|KJB10513.1|  hypothetical protein B456_001G204900                    206   4e-59   Gossypium raimondii
gb|KHG17836.1|  hypothetical protein F383_07126                         206   4e-59   Gossypium arboreum [tree cotton]
ref|XP_009129217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      205   6e-59   Brassica rapa
gb|KJB10512.1|  hypothetical protein B456_001G204900                    207   7e-59   Gossypium raimondii
ref|XP_009390355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    205   8e-59   
ref|XP_006395868.1|  hypothetical protein EUTSA_v10004013mg             202   9e-59   
ref|NP_176799.2|  glucan endo-1,3-beta-glucosidase 2                    204   9e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59252.1|  BnaA05g36990D                                          202   9e-59   Brassica napus [oilseed rape]
gb|ABI93926.1|  At1g66250                                               204   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    203   1e-58   Populus euphratica
emb|CDY48807.1|  BnaC02g34070D                                          204   1e-58   Brassica napus [oilseed rape]
gb|EMT05308.1|  Glucan endo-1,3-beta-glucosidase 3                      204   1e-58   
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    204   2e-58   Glycine max [soybeans]
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      204   2e-58   Glycine soja [wild soybean]
ref|XP_006395869.1|  hypothetical protein EUTSA_v10004013mg             202   4e-58   
gb|ACN30650.1|  unknown                                                 202   5e-58   Zea mays [maize]
ref|NP_001150141.1|  glucan endo-1,3-beta-glucosidase 3 precursor       202   5e-58   
ref|XP_003558472.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      202   6e-58   Brachypodium distachyon [annual false brome]
ref|XP_006395867.1|  hypothetical protein EUTSA_v10004013mg             202   6e-58   Eutrema salsugineum [saltwater cress]
emb|CDP01635.1|  unnamed protein product                                202   6e-58   Coffea canephora [robusta coffee]
ref|XP_002468258.1|  hypothetical protein SORBIDRAFT_01g042560          202   6e-58   Sorghum bicolor [broomcorn]
ref|XP_010916186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    202   6e-58   
emb|CAN82488.1|  hypothetical protein VITISV_006804                     201   9e-58   Vitis vinifera
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      201   1e-57   Glycine soja [wild soybean]
ref|XP_006602009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   1e-57   Glycine max [soybeans]
gb|EMS47617.1|  Glucan endo-1,3-beta-glucosidase 3                      202   1e-57   Triticum urartu
ref|XP_006293165.1|  hypothetical protein CARUB_v10019481mg             201   1e-57   Capsella rubella
ref|NP_001130376.1|  putative O-Glycosyl hydrolase superfamily pr...    201   1e-57   Zea mays [maize]
gb|AIR93909.1|  glucanase                                               200   2e-57   Cicer arietinum [garbanzo]
ref|XP_002876767.1|  hypothetical protein ARALYDRAFT_484077             201   2e-57   
ref|XP_010100650.1|  Glucan endo-1,3-beta-glucosidase 3                 199   4e-57   
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   4e-57   Glycine max [soybeans]
ref|XP_004503372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   4e-57   Cicer arietinum [garbanzo]
ref|NP_001077866.1|  glucan endo-1,3-beta-glucosidase 3                 197   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049413.1|  Os03g0221500                                       200   4e-57   
ref|XP_006599427.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   5e-57   Glycine max [soybeans]
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   202   5e-57   
ref|XP_006649652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    200   9e-57   Oryza brachyantha
ref|XP_009792881.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    199   1e-56   Nicotiana sylvestris
gb|AAK85402.2|  beta-1,3-glucanase                                      198   2e-56   Camellia sinensis [black tea]
ref|XP_006580439.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   2e-56   Glycine max [soybeans]
gb|KHN07542.1|  Glucan endo-1,3-beta-glucosidase 2                      198   2e-56   Glycine soja [wild soybean]
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   3e-56   
ref|XP_010513892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    198   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010424935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      198   3e-56   Camelina sativa [gold-of-pleasure]
ref|NP_565269.1|  glucan endo-1,3-beta-glucosidase 3                    197   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225735.1|  hypothetical protein PRUPE_ppa005356mg             197   4e-56   
ref|XP_010502143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    197   5e-56   Camelina sativa [gold-of-pleasure]
gb|EPS74061.1|  hypothetical protein M569_00697                         196   6e-56   Genlisea aurea
ref|XP_009589694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    196   1e-55   Nicotiana tomentosiformis
gb|KJB15378.1|  hypothetical protein B456_002G174100                    196   1e-55   Gossypium raimondii
ref|XP_011096055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      196   1e-55   Sesamum indicum [beniseed]
gb|ERN17398.1|  hypothetical protein AMTR_s00037p00209440               195   3e-55   Amborella trichopoda
ref|XP_011627616.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      194   7e-55   Amborella trichopoda
gb|KJB22745.1|  hypothetical protein B456_004G064200                    194   9e-55   Gossypium raimondii
ref|XP_009593892.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      194   1e-54   Nicotiana tomentosiformis
ref|XP_011655956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   2e-54   Cucumis sativus [cucumbers]
ref|XP_009772723.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      194   2e-54   Nicotiana sylvestris
ref|XP_010324461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    192   3e-54   
ref|XP_010686818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      193   3e-54   
ref|XP_008452394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   5e-54   
gb|KHG14816.1|  hypothetical protein F383_17797                         192   6e-54   
ref|NP_172647.2|  O-glycosyl hydrolases family 17 protein               188   1e-53   
ref|XP_011008030.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   1e-53   
ref|XP_008224690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      191   2e-53   
ref|XP_009127478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    190   2e-53   
gb|KDO78272.1|  hypothetical protein CISIN_1g010394mg                   190   2e-53   
ref|XP_007211541.1|  hypothetical protein PRUPE_ppa003984mg             191   2e-53   
ref|XP_008384081.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    191   3e-53   
ref|XP_009359235.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    190   5e-53   
ref|XP_003610449.1|  Glucan endo-1,3-beta-glucosidase                   189   7e-53   
ref|XP_006348130.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   7e-53   
ref|XP_007026106.1|  O-Glycosyl hydrolases family 17 protein            189   8e-53   
ref|XP_012091328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   8e-53   
ref|XP_008365635.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    191   8e-53   
gb|AAC17632.1|  Similar to glucan endo-1,3-beta-D-glucosidase pre...    188   9e-53   
gb|EYU27773.1|  hypothetical protein MIMGU_mgv1a006342mg                187   9e-53   
ref|XP_002312452.2|  glucan endo-1 family protein                       188   1e-52   
ref|NP_001184967.1|  O-glycosyl hydrolases family 17 protein            188   1e-52   
ref|XP_012091327.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    189   1e-52   
ref|XP_009357466.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
ref|XP_006584084.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
gb|KHN35732.1|  Glucan endo-1,3-beta-glucosidase 1                      188   2e-52   
ref|XP_003529639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    188   2e-52   
ref|XP_006389594.1|  hypothetical protein POPTR_0021s00450g             188   2e-52   
ref|XP_002892658.1|  predicted protein                                  187   2e-52   
ref|XP_004232702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      188   2e-52   
ref|XP_010476119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   4e-52   
ref|XP_010476120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   5e-52   
ref|XP_006467418.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    187   5e-52   
ref|XP_010493346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      187   5e-52   
gb|KFK43454.1|  hypothetical protein AALP_AA1G127200                    186   8e-52   
ref|XP_010052862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   9e-52   
ref|XP_010458589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   1e-51   
ref|XP_010458588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   1e-51   
ref|XP_010458590.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   1e-51   
ref|XP_010916187.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   2e-51   
gb|AAG51762.1|AC066691_2  beta-1,3-glucanase precursor, putative;...    183   2e-51   
ref|XP_010052861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    186   2e-51   
ref|XP_006584862.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   2e-51   
gb|ACF80565.1|  unknown                                                 184   2e-51   
ref|XP_003532507.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   3e-51   
gb|KHG03844.1|  hypothetical protein F383_07460                         185   3e-51   
gb|KJB57758.1|  hypothetical protein B456_009G179400                    184   3e-51   
emb|CDP04414.1|  unnamed protein product                                189   3e-51   
gb|KJB57757.1|  hypothetical protein B456_009G179400                    184   4e-51   
ref|XP_010278646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   4e-51   
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              183   4e-51   
ref|XP_009110702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      184   4e-51   
ref|XP_010278647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    185   4e-51   
ref|XP_010546762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      184   5e-51   
ref|XP_010244498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   5e-51   
gb|KJB57756.1|  hypothetical protein B456_009G179400                    184   5e-51   
ref|XP_010244497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   6e-51   
ref|XP_003632942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      184   6e-51   
ref|XP_006600304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   7e-51   
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              182   1e-50   
ref|XP_003549783.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    184   1e-50   
gb|KEH28239.1|  glucan endo-1,3-beta-glucosidase-like protein           185   1e-50   
ref|XP_006417308.1|  hypothetical protein EUTSA_v10006713mg             187   1e-50   
ref|XP_002518468.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    183   2e-50   
ref|XP_004295275.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   2e-50   
ref|XP_011459999.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    183   2e-50   
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             182   3e-50   
ref|XP_009792882.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   4e-50   
ref|XP_010094029.1|  Glucan endo-1,3-beta-glucosidase 1                 182   5e-50   
ref|XP_007153962.1|  hypothetical protein PHAVU_003G079900g             182   5e-50   
ref|XP_010057914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   7e-50   
ref|XP_006306488.1|  hypothetical protein CARUB_v10012467mg             184   8e-50   
emb|CBI23232.3|  unnamed protein product                                184   1e-49   
ref|XP_004507681.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   1e-49   
ref|XP_010553447.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   1e-49   
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             180   1e-49   
ref|XP_011046950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      180   2e-49   
ref|XP_010553445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    181   2e-49   
emb|CDY31214.1|  BnaC08g15090D                                          179   3e-49   
gb|KHN21581.1|  Glucan endo-1,3-beta-glucosidase 3                      177   5e-49   
gb|ACF87545.1|  unknown                                                 174   8e-48   
ref|XP_004145115.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      176   1e-47   
ref|XP_008440948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 1      174   3e-47   
ref|XP_004486169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    171   4e-46   
gb|AIR93901.1|  glucanase                                               171   5e-46   
ref|XP_010681924.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44   
gb|KHN16561.1|  Glucan endo-1,3-beta-glucosidase 3                      164   3e-44   
ref|XP_002962275.1|  hypothetical protein SELMODRAFT_76256              164   5e-44   
ref|XP_006584863.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   1e-43   
ref|XP_002965189.1|  hypothetical protein SELMODRAFT_82513              161   3e-43   
ref|XP_002974888.1|  hypothetical protein SELMODRAFT_102117             160   3e-42   
ref|XP_002963799.1|  hypothetical protein SELMODRAFT_79527              159   8e-42   
ref|XP_010553446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   4e-41   
ref|XP_006383906.1|  hypothetical protein POPTR_0004s01110g             156   6e-41   
ref|XP_010059559.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    155   3e-40   
ref|XP_007147720.1|  hypothetical protein PHAVU_006G149100g             153   1e-39   
ref|XP_007147719.1|  hypothetical protein PHAVU_006G149100g             153   1e-39   
ref|XP_010923877.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   1e-38   
ref|XP_010923875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38   
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             150   2e-38   
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             148   8e-38   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    146   3e-37   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    146   3e-37   
gb|KHG05496.1|  hypothetical protein F383_30989                         145   7e-37   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    145   1e-36   
ref|XP_002969476.1|  hypothetical protein SELMODRAFT_231287             145   1e-36   
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    145   1e-36   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   1e-36   
ref|XP_002961242.1|  hypothetical protein SELMODRAFT_402967             144   2e-36   
ref|XP_009397776.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_006599425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   2e-36   
ref|XP_001751439.1|  predicted protein                                  143   2e-36   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             144   2e-36   
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     143   5e-36   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            140   7e-36   
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             142   7e-36   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   142   1e-35   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            140   1e-35   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             142   1e-35   
dbj|BAD93486.1|  pollen allergen CJP38                                  140   1e-35   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    142   1e-35   
ref|XP_001766544.1|  predicted protein                                  141   1e-35   
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             141   1e-35   
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   1e-35   
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             141   1e-35   
ref|XP_011626761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     142   1e-35   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     140   2e-35   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
gb|ERN15184.1|  hypothetical protein AMTR_s00056p00158530               142   2e-35   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     141   2e-35   
ref|XP_006837267.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     141   2e-35   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   2e-35   
ref|XP_001772420.1|  predicted protein                                  141   2e-35   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   2e-35   
ref|NP_001048260.1|  Os02g0771700                                       141   3e-35   
gb|ERN00121.1|  hypothetical protein AMTR_s00112p00108890               140   3e-35   
gb|KCW75916.1|  hypothetical protein EUGRSUZ_D00293                     139   3e-35   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   
ref|XP_010052055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     139   3e-35   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   3e-35   
ref|XP_001767901.1|  predicted protein                                  140   3e-35   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   4e-35   
gb|ACN39797.1|  unknown                                                 140   4e-35   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   5e-35   
ref|XP_012080639.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     140   5e-35   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    140   6e-35   
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   7e-35   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             139   8e-35   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    139   9e-35   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     139   1e-34   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     139   1e-34   
emb|CDY18049.1|  BnaC07g04210D                                          139   1e-34   
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     137   1e-34   
gb|AAD26909.1|  putative beta-1,3-glucanase                             139   1e-34   
emb|CDY56498.1|  BnaAnng14330D                                          138   2e-34   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    138   2e-34   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        139   2e-34   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    138   2e-34   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               138   2e-34   
ref|XP_010094541.1|  Glucan endo-1,3-beta-glucosidase 12                138   2e-34   
ref|XP_001780506.1|  predicted protein                                  137   2e-34   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             137   3e-34   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    137   4e-34   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    137   4e-34   
gb|ABR16583.1|  unknown                                                 136   4e-34   
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                137   4e-34   
ref|XP_007039346.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 4      136   4e-34   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             137   5e-34   
ref|XP_007039348.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 6      136   5e-34   
ref|XP_007039343.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 1      137   5e-34   
ref|XP_007039345.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 3      137   5e-34   
ref|XP_007039344.1|  Glucan endo-1,3-beta-glucosidase 11 isoform 2      137   5e-34   
ref|XP_009622831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     136   7e-34   
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             135   7e-34   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   135   7e-34   
ref|XP_009778930.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     136   8e-34   
dbj|BAJ87688.1|  predicted protein                                      137   9e-34   
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        136   9e-34   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
ref|XP_002300634.2|  hypothetical protein POPTR_0002s00860g             136   1e-33   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     137   1e-33   
gb|AIR93910.1|  glucanase                                               136   1e-33   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   1e-33   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   1e-33   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     136   1e-33   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     136   1e-33   
ref|XP_002462968.1|  hypothetical protein SORBIDRAFT_02g035490          136   1e-33   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    136   2e-33   
ref|XP_011034841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
ref|XP_003601410.1|  Glucan endo-1,3-beta-glucosidase                   135   2e-33   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  135   2e-33   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     135   2e-33   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   2e-33   
emb|CDP18512.1|  unnamed protein product                                135   2e-33   
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  135   2e-33   
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  135   3e-33   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   3e-33   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             135   3e-33   
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_009128829.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     135   3e-33   
gb|KHG26459.1|  hypothetical protein F383_04538                         135   3e-33   
ref|XP_004513066.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   3e-33   
emb|CDY06818.1|  BnaC01g09170D                                          135   3e-33   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    135   3e-33   
emb|CDP05678.1|  unnamed protein product                                135   3e-33   
ref|XP_009772777.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
ref|XP_001771454.1|  predicted protein                                  135   4e-33   
ref|XP_006285688.1|  hypothetical protein CARUB_v10007158mg             135   4e-33   
gb|KJB27173.1|  hypothetical protein B456_004G282300                    135   4e-33   
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    134   4e-33   
gb|KFK29497.1|  hypothetical protein AALP_AA7G142000                    135   4e-33   
emb|CDY62033.1|  BnaC03g77660D                                          135   5e-33   



>gb|AFU52654.1| beta-1,3-glucanase 21 [Solanum tuberosum]
Length=443

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVGINIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML AL+NT IEVI+GV
Sbjct  22   NVIGAFVGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLKALANTSIEVIIGV  81

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++ LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNA
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNA  201

Query  674  YPYYEYVKSD  703
            YPYYEYV SD
Sbjct  202  YPYYEYVHSD  211



>ref|XP_006354142.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Solanum tuberosum]
Length=501

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVGINIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML+AL+NT IEVI+GV
Sbjct  22   NVIGAFVGINIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGV  81

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++ LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNA
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNA  201

Query  674  YPYYEYVKSD  703
            YPYYEYV SD
Sbjct  202  YPYYEYVHSD  211



>ref|XP_010316236.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
 ref|XP_010316237.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Solanum lycopersicum]
Length=501

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDV+NLP A DVV LLKARQI HVRLF+ADAHML+AL+NT IEVI+GV
Sbjct  22   NLIGAFVGVNIGTDVTNLPPASDVVALLKARQITHVRLFNADAHMLNALANTSIEVIIGV  81

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVN+NVAAY+P TNITAIAVGSEVLT+IPNAAPVLVPA+NYLH
Sbjct  82   TNEEVLGIGESPSTAAAWVNRNVAAYMPGTNITAIAVGSEVLTAIPNAAPVLVPALNYLH  141

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++ LN+QVKVSTPQS D+IAK FPPSTATFN S NST+FQILQFL+NTNSYYMLNA
Sbjct  142  KALVASRLNNQVKVSTPQSMDVIAKAFPPSTATFNSSWNSTIFQILQFLRNTNSYYMLNA  201

Query  674  YPYYEYVKSD  703
            YPYYEYV+SD
Sbjct  202  YPYYEYVQSD  211



>ref|XP_009631831.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631832.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631833.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631834.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631835.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
 ref|XP_009631836.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana tomentosiformis]
Length=499

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVGINIGTDVSNLP A DVV LLKA QI HVRLF+ADAHML+AL+N+ IEV++GV
Sbjct  22   NVIGAFVGINIGTDVSNLPPASDVVALLKANQITHVRLFNADAHMLNALANSSIEVVIGV  81

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN+EVLGIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  82   TNDEVLGIGESPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  141

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++ LN+QVKVSTPQS D+IA+ FPPSTATFN S NST+FQILQFL+NTNSY+MLNA
Sbjct  142  KALVASQLNNQVKVSTPQSMDVIARAFPPSTATFNSSWNSTIFQILQFLRNTNSYFMLNA  201

Query  674  YPYYEYVKSD  703
            YPYYEYV SD
Sbjct  202  YPYYEYVHSD  211



>ref|XP_009778460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778463.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778464.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
 ref|XP_009778465.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Nicotiana sylvestris]
Length=496

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGTDVSNLP A DVV LLK  QI HVRLF+ADAHML+AL+N+ IEVI+GV
Sbjct  19   NVTGAFVGINIGTDVSNLPPASDVVALLKVNQITHVRLFNADAHMLNALANSSIEVIIGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN+EVLGIG+S S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IPNAAPVLVPAMNYLH
Sbjct  79   TNDEVLGIGESPSAAAAWVNKNVAAYMPSTNITAIAVGSEVLTAIPNAAPVLVPAMNYLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++ LN QVKVSTPQS D+IA+ FPPSTATFN S NST+FQILQFL+NTNSY+MLNA
Sbjct  139  KALVASQLNHQVKVSTPQSMDVIARAFPPSTATFNSSWNSTIFQILQFLRNTNSYFMLNA  198

Query  674  YPYYEYVKSD  703
            YPYYEYV SD
Sbjct  199  YPYYEYVHSD  208



>ref|XP_011087559.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Sesamum indicum]
Length=440

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGTDVSNLPSA D+V +LKA+QI HVRLFDADAHML+ALSNTGIEV+V VTN 
Sbjct  22   GAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVMVSVTNE  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN L+KAL
Sbjct  82   EVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMNNLYKAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +++NLN QVK+STP S D+I + FPPSTATFN +SNST+FQILQFL+NT SYYMLNAYPY
Sbjct  142  LASNLNYQVKISTPHSMDIIPRSFPPSTATFNATSNSTIFQILQFLKNTKSYYMLNAYPY  201

Query  683  YEYVKSD  703
            YEYVKS+
Sbjct  202  YEYVKSN  208



>ref|XP_012067108.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Jatropha 
curcas]
 gb|KDP42112.1| hypothetical protein JCGZ_01900 [Jatropha curcas]
Length=496

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVGINIGTDVSNLP A D+V +LKA QI HVRLFDADAHML AL+N+GIEV+VGVTN
Sbjct  22   IGAFVGINIGTDVSNLPPASDIVAILKANQITHVRLFDADAHMLKALANSGIEVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIG+S + AAAWVNKNV +YLP+TNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA
Sbjct  82   EEVLGIGESPATAAAWVNKNVNSYLPATNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN QVKVSTPQS D+I + FPPSTATFN S NST++Q+LQFL+NTNSYYMLNAYP
Sbjct  142  LVASNLNFQVKVSTPQSMDVIPRPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y   +
Sbjct  202  YYGYTTGN  209



>ref|XP_011087532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087540.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011087550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Sesamum indicum]
Length=499

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGTDVSNLPSA D+V +LKA+QI HVRLFDADAHML+ALSNTGIEV+V VTN 
Sbjct  22   GAFVGINIGTDVSNLPSAVDIVGILKAQQITHVRLFDADAHMLNALSNTGIEVMVSVTNE  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLTSIP+AAP+LVPAMN L+KAL
Sbjct  82   EVLGIGELPSTAAAWVNKNVAAYVPSTNITAIAVGSEVLTSIPHAAPILVPAMNNLYKAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +++NLN QVK+STP S D+I + FPPSTATFN +SNST+FQILQFL+NT SYYMLNAYPY
Sbjct  142  LASNLNYQVKISTPHSMDIIPRSFPPSTATFNATSNSTIFQILQFLKNTKSYYMLNAYPY  201

Query  683  YEYVKSD  703
            YEYVKS+
Sbjct  202  YEYVKSN  208



>ref|XP_012067103.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Jatropha 
curcas]
 ref|XP_012067104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Jatropha 
curcas]
 ref|XP_012067105.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Jatropha 
curcas]
 ref|XP_012067106.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Jatropha 
curcas]
 ref|XP_012067109.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Jatropha 
curcas]
Length=527

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVGINIGTDVSNLP A D+V +LKA QI HVRLFDADAHML AL+N+GIEV+VGVTN
Sbjct  22   IGAFVGINIGTDVSNLPPASDIVAILKANQITHVRLFDADAHMLKALANSGIEVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIG+S + AAAWVNKNV +YLP+TNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA
Sbjct  82   EEVLGIGESPATAAAWVNKNVNSYLPATNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN QVKVSTPQS D+I + FPPSTATFN S NST++Q+LQFL+NTNSYYMLNAYP
Sbjct  142  LVASNLNFQVKVSTPQSMDVIPRPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y   +
Sbjct  202  YYGYTTGN  209



>ref|XP_012067107.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Jatropha 
curcas]
Length=526

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVGINIGTDVSNLP A D+V +LKA QI HVRLFDADAHML AL+N+GIEV+VGVTN
Sbjct  22   IGAFVGINIGTDVSNLPPASDIVAILKANQITHVRLFDADAHMLKALANSGIEVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIG+S + AAAWVNKNV +YLP+TNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA
Sbjct  82   EEVLGIGESPATAAAWVNKNVNSYLPATNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN QVKVSTPQS D+I + FPPSTATFN S NST++Q+LQFL+NTNSYYMLNAYP
Sbjct  142  LVASNLNFQVKVSTPQSMDVIPRPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y   +
Sbjct  202  YYGYTTGN  209



>emb|CAN72077.1| hypothetical protein VITISV_020314 [Vitis vinifera]
Length=473

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q+LQFL+NTNSY+MLNA
Sbjct  140  KALVASNLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQMLQFLKNTNSYFMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   D
Sbjct  200  YPYYGYTNGD  209



>ref|XP_011025159.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025160.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025161.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011025162.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGTDVSN+PSA DVV +LKA QI HVRL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINIGTDVSNMPSAPDVVAMLKANQITHVRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+LGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKAL
Sbjct  79   EILGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN QVKVSTPQ+ D+I K FPPSTATFN S NST++QILQFL+NTNSYYMLNAYPY
Sbjct  139  VASNLNFQVKVSTPQAMDVIPKPFPPSTATFNSSWNSTIYQILQFLKNTNSYYMLNAYPY  198

Query  683  YEYVKSD  703
            + Y   +
Sbjct  199  FGYTSGN  205



>ref|XP_010651369.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Vitis 
vinifera]
Length=494

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q+LQFL+NTNSY+MLNA
Sbjct  140  KALVASNLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQMLQFLKNTNSYFMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   D
Sbjct  200  YPYYGYTNGD  209



>ref|XP_002304004.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
 gb|EEE78983.2| hypothetical protein POPTR_0003s21250g [Populus trichocarpa]
Length=412

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGTDVSN+PSA DVV +LK  QI HVRL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINIGTDVSNMPSAPDVVAILKTNQITHVRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+LGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVLT+IPN  PVLVPAMNYLHKAL
Sbjct  79   EILGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLTTIPNVVPVLVPAMNYLHKAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN QVKVSTPQ+ D+I + FPPSTATFN S +ST++QILQFL+NTNSYYMLNAYPY
Sbjct  139  VASNLNFQVKVSTPQAMDVIPRPFPPSTATFNSSWDSTIYQILQFLKNTNSYYMLNAYPY  198

Query  683  YEYVKSD  703
            + Y   +
Sbjct  199  FGYTSGN  205



>ref|XP_008354983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354984.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
 ref|XP_008354985.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Malus domestica]
Length=494

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +G+F+GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGV
Sbjct  20   NVLGSFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLH
Sbjct  80   TNEEVLGIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNA
Sbjct  140  KALVASNLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   D
Sbjct  200  YPYYGYTSGD  209



>ref|XP_009375652.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
 ref|XP_009375659.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=494

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +G+F+GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGV
Sbjct  20   NVLGSFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLH
Sbjct  80   TNEEVLGIGESASVAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNA
Sbjct  140  KALVASNLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   D
Sbjct  200  YPYYGYTSGD  209



>ref|XP_004294998.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
 ref|XP_011461676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAF+G+NIGTDVS+LPSA ++V +L A QI HVRL+DADAHML ALSN+GIEV+VG+
Sbjct  20   NGLGAFIGVNIGTDVSDLPSATEMVAILTAHQITHVRLYDADAHMLRALSNSGIEVVVGI  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVNKNVA YLPSTNITAIAVGSEVLT IP+A+ VLV AMNY+H
Sbjct  80   TNEEVLGIGESPSVAAAWVNKNVAPYLPSTNITAIAVGSEVLTQIPHASSVLVSAMNYIH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+ NLN QVKVSTPQS D+I K FPPSTATF+ S NSTVFQILQFL+NTNSYYMLNA
Sbjct  140  KALVATNLNFQVKVSTPQSMDVIPKAFPPSTATFDPSWNSTVFQILQFLKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  200  YPYYGYTKGD  209



>ref|XP_009364124.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Pyrus x bretschneideri]
Length=493

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAF+GINIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+ IEV+VGV
Sbjct  20   NVLGAFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSRIEVMVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVL +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMNYLH
Sbjct  80   TNEEVLSVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN QVK+STPQS D+I K FPPSTATFN+S   T++QILQF++NTNSYYMLNA
Sbjct  140  KALVASNLNFQVKISTPQSMDIIPKPFPPSTATFNYSWGHTIYQILQFIKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   D
Sbjct  200  YPYYGYTNGD  209



>emb|CDP16794.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG NIGTD+SNLPSA +VV +LKA QI HVRLFDADAHML+AL++TGIEV+V VTN 
Sbjct  26   GAFVGFNIGTDLSNLPSATNVVAILKAHQITHVRLFDADAHMLTALADTGIEVMVSVTNE  85

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+LGIGQS S AAAWVNKNVAA++PSTNITAIAVGSEVLT+IPNAA +LVP+MNYL KAL
Sbjct  86   EILGIGQSPSVAAAWVNKNVAAFVPSTNITAIAVGSEVLTTIPNAARILVPSMNYLQKAL  145

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN Q+KVSTPQS D+I + FPPSTA FN + NST+FQ+LQFL+NTNSYYMLNAYPY
Sbjct  146  VASNLNDQIKVSTPQSMDVIPRPFPPSTAAFNSTWNSTIFQMLQFLKNTNSYYMLNAYPY  205

Query  683  YEYVKSD  703
            Y YV S+
Sbjct  206  YGYVNSN  212



>ref|XP_008229211.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008229885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
 ref|XP_008230593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Prunus mume]
Length=494

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAF+GINIGTDVS+LPS  D V LLKA QI HVRL++AD HML ALSN+GIEV+VGVTN
Sbjct  22   LGAFIGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             E+LGIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKA
Sbjct  82   EEILGIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN QVKVSTPQS D+I K FPPSTA FN S   T++QILQF++NTNSYYMLNAYP
Sbjct  142  LVASNLNYQVKVSTPQSMDIIPKPFPPSTAGFNLSWGPTIYQILQFIKNTNSYYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y + +
Sbjct  202  YYGYTEGN  209



>ref|XP_008384395.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349413.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
 ref|XP_008349414.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Malus domestica]
Length=494

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+GINIGTDVS+LPS  D V LLKA QI HVRL++ADAH+L ALSN+GIEV+VG+TN 
Sbjct  23   GAFIGINIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHILKALSNSGIEVMVGITNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL +G+SSS AAAW+NKNVAAYLPSTNITAIAVGSEV+TSIP+AAPVLV AMNYLHKAL
Sbjct  83   EVLSVGESSSAAAAWINKNVAAYLPSTNITAIAVGSEVITSIPHAAPVLVDAMNYLHKAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN QVKVSTPQS D+I K FPPSTATFN+S   T++QILQF++NTNSYYMLNAYPY
Sbjct  143  VASNLNFQVKVSTPQSMDIIPKPFPPSTATFNYSWGHTIYQILQFIKNTNSYYMLNAYPY  202

Query  683  YEYVKSD  703
            Y Y   D
Sbjct  203  YGYTNGD  209



>ref|XP_007205107.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
 gb|EMJ06306.1| hypothetical protein PRUPE_ppa004732mg [Prunus persica]
Length=494

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAF+GINIGTDVS+LPS  D V LLKA QI HVRL++AD HML ALSN+GIEV+VGVTN
Sbjct  22   LGAFIGINIGTDVSDLPSETDTVALLKAHQISHVRLYNADTHMLKALSNSGIEVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             E+LGIGQS S AAAW+NKNVAAYLPSTNITAIAVGSEVLTSIP+AAPVLV AMN LHKA
Sbjct  82   EEILGIGQSPSTAAAWINKNVAAYLPSTNITAIAVGSEVLTSIPHAAPVLVSAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN QVKVSTPQS D+I K FPPSTA FN S   T++QILQF++NTNSYYMLNAYP
Sbjct  142  LVASNLNYQVKVSTPQSMDVIPKPFPPSTAGFNLSWGPTIYQILQFIKNTNSYYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y + +
Sbjct  202  YYGYTEGN  209



>ref|XP_011048218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048220.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048221.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048222.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048223.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011048224.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016027.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016028.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016029.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016031.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016032.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016033.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
 ref|XP_011016034.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Populus euphratica]
Length=493

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGIN+GTDVSN+PSA DVV +LKA QI H+RL+DADAHML AL+++GI+V+VGV N 
Sbjct  19   GAFVGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIKVMVGVPNE  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+S+S+AAAW+N+NVAAYLPSTNITAIAVGSEVL+SIPN  PVLVPAMNYLHKAL
Sbjct  79   EVLGIGESASKAAAWINQNVAAYLPSTNITAIAVGSEVLSSIPNLVPVLVPAMNYLHKAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN QVK+STPQ+ D+I + FPPSTATFN S ++TV+QILQFL+NT+SYYMLNAYPY
Sbjct  139  VASNLNFQVKISTPQAMDIIPRPFPPSTATFNSSWSATVYQILQFLKNTDSYYMLNAYPY  198

Query  683  YEYVKSD  703
            + Y   +
Sbjct  199  FGYTSGN  205



>ref|XP_004504325.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cicer arietinum]
Length=496

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALSNTGI+VIVGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSNTGIDVIVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVL IG+S S AAAW+NKNV AYLPSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLKIGESPSAAAAWINKNVVAYLPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV+ANLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYP
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKSFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y K D
Sbjct  202  YYGYTKGD  209



>ref|XP_007161273.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
 gb|ESW33267.1| hypothetical protein PHAVU_001G056400g [Phaseolus vulgaris]
Length=503

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N VGAFVG+NIGTDV++LPSA ++V +LKA QI HVRL+DA+ HML ALS TGIEVIVGV
Sbjct  23   NAVGAFVGVNIGTDVTDLPSASNMVAILKAHQITHVRLYDANEHMLQALSKTGIEVIVGV  82

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+P  APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPKVAPVLVPAMNHLH  142

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN +VK+STPQS D+I++ FPPSTATFN S NST++Q+LQFLQNTNS YMLNA
Sbjct  143  KALVASNLNFRVKISTPQSMDIISRPFPPSTATFNSSWNSTIYQLLQFLQNTNSSYMLNA  202

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  203  YPYYGYTKGD  212



>ref|XP_002297638.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
 gb|EEE82443.2| hypothetical protein POPTR_0001s04360g [Populus trichocarpa]
Length=493

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGIN+GTDVSN+PSA DVV +LKA QI H+RL+DADAHML AL+++GIEV+VGVTN 
Sbjct  19   GAFVGINLGTDVSNMPSAPDVVSILKANQITHLRLYDADAHMLKALADSGIEVMVGVTNE  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+S S+AAAW+N+NVAAYLPST+ITAIAVGSEVLTSIPN   VLVPAMNYLHKAL
Sbjct  79   EVLGIGESPSKAAAWINQNVAAYLPSTSITAIAVGSEVLTSIPNLVTVLVPAMNYLHKAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN QVK+STPQ+ D+I + FPPSTATFN S ++TV+QILQFL+NT+S+YMLNAYPY
Sbjct  139  VASNLNFQVKISTPQAMDIIPRPFPPSTATFNSSWSATVYQILQFLKNTDSFYMLNAYPY  198

Query  683  YEYVKSD  703
            + Y   +
Sbjct  199  FGYTSGN  205



>ref|XP_008352033.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
4 [Malus domestica]
Length=469

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  152  VGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVL  331
            +G NIGTDVS+LPS  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN EVL
Sbjct  1    MGDNIGTDVSDLPSETDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNEEVL  60

Query  332  GIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSA  511
            GIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKALV++
Sbjct  61   GIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKALVAS  120

Query  512  NLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEY  691
            NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPYY Y
Sbjct  121  NLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPYYGY  180

Query  692  VKSD  703
               D
Sbjct  181  TSGD  184



>gb|KJB23365.1| hypothetical protein B456_004G094500 [Gossypium raimondii]
Length=492

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVS++P A DVV ++KA QI H+RL+DAD HML AL+ +GIEV VGV
Sbjct  19   NVLGAFVGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LH
Sbjct  79   TNEEVLGIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+A+LN QVKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNSYYMLNA
Sbjct  139  KALVAADLNFQVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSYYMLNA  198

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  199  YPYYGYTNGN  208



>gb|KHG18393.1| hypothetical protein F383_22096 [Gossypium arboreum]
Length=492

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVS++P A DVV ++KA QI H+RL+DAD HML AL+ +GIEV VGV
Sbjct  19   NVLGAFVGVNIGTDVSSMPPASDVVAIVKAHQITHIRLYDADPHMLKALAGSGIEVTVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAW+NKNVAAY+PSTNITAIAVGSEVLTS+P+AAPVLV AMN LH
Sbjct  79   TNEEVLGIGESASAAAAWINKNVAAYMPSTNITAIAVGSEVLTSVPHAAPVLVTAMNNLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+A+LN Q+KVSTPQS D+I K FPPST+TFN S NST++Q+LQFL+NTNSYYMLNA
Sbjct  139  KALVAADLNFQIKVSTPQSMDIIPKPFPPSTSTFNSSWNSTIYQLLQFLKNTNSYYMLNA  198

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  199  YPYYGYTNGN  208



>gb|KHN12071.1| Glucan endo-1,3-beta-glucosidase 4, partial [Glycine soja]
Length=501

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVG+NIGTDV++LPSA +VV +LK+ QI HVRL++A+ HML ALSNTGIEVIVGV
Sbjct  23   NAAGAFVGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGV  82

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  142

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV++NLN +VKVSTPQS D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNA
Sbjct  143  TALVASNLNFRVKVSTPQSMDVISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNA  202

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  203  YPYYGYTKGD  212



>ref|XP_006601114.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=498

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVG+NIGTDV++LPSA +VV +LK+ QI HVRL++A+ HML ALSNTGIEVIVGV
Sbjct  20   NAAGAFVGVNIGTDVTDLPSASNVVAILKSHQITHVRLYNANGHMLQALSNTGIEVIVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  80   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV++NLN +VKVSTPQS D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNA
Sbjct  140  TALVASNLNFRVKVSTPQSMDVISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  200  YPYYGYTKGD  209



>ref|XP_010276339.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT V++LPSA DVV +LKA QI HVRL+DAD HML+AL+ TG+EV+VGV
Sbjct  21   NASGAFVGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGV  80

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH
Sbjct  81   TNEEVLGIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLH  140

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL+++NLN QVKVS+PQS D+I + FPPSTATFN + NST++Q LQFL+NT S+YMLNA
Sbjct  141  HALLASNLNFQVKVSSPQSMDMIPRPFPPSTATFNSTWNSTMYQFLQFLKNTGSFYMLNA  200

Query  674  YPYYEYVKSD  703
            YPYY Y + +
Sbjct  201  YPYYGYTRGN  210



>ref|XP_010276332.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276333.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276334.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276335.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276336.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276337.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010276338.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Nelumbo 
nucifera]
Length=496

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT V++LPSA DVV +LKA QI HVRL+DAD HML+AL+ TG+EV+VGV
Sbjct  21   NASGAFVGINIGTAVTDLPSAADVVAMLKANQITHVRLYDADGHMLNALAGTGVEVMVGV  80

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S S AAAWVNKNVA+YLP TNITAIAVGSEVLTSIPNAAPVLV AMNYLH
Sbjct  81   TNEEVLGIGESPSAAAAWVNKNVASYLPETNITAIAVGSEVLTSIPNAAPVLVRAMNYLH  140

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL+++NLN QVKVS+PQS D+I + FPPSTATFN + NST++Q LQFL+NT S+YMLNA
Sbjct  141  HALLASNLNFQVKVSSPQSMDMIPRPFPPSTATFNSTWNSTMYQFLQFLKNTGSFYMLNA  200

Query  674  YPYYEYVKSD  703
            YPYY Y + +
Sbjct  201  YPYYGYTRGN  210



>ref|XP_006596127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN20600.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=501

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVG+NIGTDV++LPSA +VV +LKA QI HVRL++A+ HML ALSNTGIEVIVGV
Sbjct  23   NAAGAFVGVNIGTDVTDLPSASNVVAILKAHQITHVRLYNANEHMLRALSNTGIEVIVGV  82

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            T+ E+LGIG+S+S AAAW++KNVAAY+PSTNITAI+VGSEVLTS+PN APVLVPAMN+LH
Sbjct  83   TDEEILGIGESASVAAAWISKNVAAYMPSTNITAISVGSEVLTSVPNVAPVLVPAMNHLH  142

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV++NLN ++KVSTP S D+I++ FPPSTATFN S NST++Q+LQFL+NTNS YMLNA
Sbjct  143  TALVASNLNFRIKVSTPLSMDIISRPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNA  202

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  203  YPYYGYTKGD  212



>ref|XP_003531243.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
 gb|KHN47972.1| Glucan endo-1,3-beta-glucosidase 4 [Glycine soja]
Length=496

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVG+NIGTDVS+LPSA ++V++L+A QI HVRL+DA+AH+L ALSNT IEVIVGVTN
Sbjct  22   LGAFVGVNIGTDVSDLPSASNIVDILQANQITHVRLYDANAHLLQALSNTSIEVIVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVL IG+S S AA W+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAATWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV+ANLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS YMLNAYP
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y K D
Sbjct  202  YYGYTKGD  209



>ref|XP_003524953.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Glycine max]
Length=496

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVS+LPSA ++V +L+A QI H RL+DA+AH+L ALSNT IEVIVGV
Sbjct  20   NTLGAFVGVNIGTDVSDLPSASNIVGILQANQITHARLYDANAHLLQALSNTSIEVIVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVL IG+S S AAAW+NKNV AY+PSTNIT IAVGSEVL++IPN APVLVPAMN LH
Sbjct  80   TNEEVLRIGESPSAAAAWINKNVVAYVPSTNITGIAVGSEVLSTIPNVAPVLVPAMNSLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+ANLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS YMLNA
Sbjct  140  KALVAANLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQLLQFLKNTNSSYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y K D
Sbjct  200  YPYYGYTKGD  209



>ref|XP_007159412.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 ref|XP_007159413.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31406.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
 gb|ESW31407.1| hypothetical protein PHAVU_002G236300g [Phaseolus vulgaris]
Length=492

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GA VG+NIGTDVS++PSA ++V++L+A QI HVRL+DA+ H+L ALSNT IEVIVGVTN
Sbjct  22   LGALVGVNIGTDVSDMPSASNIVDILQANQITHVRLYDANVHLLQALSNTSIEVIVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLKIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV+ANLN QVKVSTPQS D+I K FPPS A+FN S NST++Q+LQFL+NTNS YMLNAYP
Sbjct  142  LVAANLNFQVKVSTPQSMDIIPKPFPPSAASFNSSWNSTMYQLLQFLKNTNSSYMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y K D
Sbjct  202  YYGYTKGD  209



>ref|XP_006495278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like, partial [Citrus 
sinensis]
Length=373

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N EVLGIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+++LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNA
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_007014685.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 ref|XP_007014686.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32304.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY32305.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=496

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVGINIGTDVS++PSA +VV ++KA QI H+RL+DAD+HML A +++GIEV VGV
Sbjct  20   NVLGAFVGINIGTDVSSMPSASEVVAVVKAHQITHIRLYDADSHMLKAFADSGIEVTVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AA W+NKNVA+Y+PSTNITAIAVGSEVLTSIP+AA VLV AMN LH
Sbjct  80   TNEEVLGIGESASAAAVWINKNVASYVPSTNITAIAVGSEVLTSIPHAASVLVTAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN QVKVSTPQS D+I K FPPSTA FN S NST++Q+LQFL+NTNSYYMLNA
Sbjct  140  KALVASNLNFQVKVSTPQSMDIIPKPFPPSTAAFNSSWNSTIYQLLQFLKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_006445640.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 ref|XP_006445641.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58880.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
 gb|ESR58881.1| hypothetical protein CICLE_v10015028mg [Citrus clementina]
Length=493

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N EVLGIG+S+S AAAW+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAAWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+++LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNA
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_010044948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 ref|XP_010044949.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Eucalyptus grandis]
 gb|KCW87080.1| hypothetical protein EUGRSUZ_B03614 [Eucalyptus grandis]
Length=495

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGTDV+NLP A D+V +LK+ +I HVRL++ADAHML AL+N+GI V+VGVTN 
Sbjct  23   GAFVGINIGTDVTNLPEASDIVAVLKSNEITHVRLYNADAHMLKALANSGINVMVGVTNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+  + AAAW+NKNVAAYLP+TNITAIAVGSEVLT+IP+AAPVLVPAMN LHKAL
Sbjct  83   EVLGIGEYPATAAAWINKNVAAYLPATNITAIAVGSEVLTAIPHAAPVLVPAMNNLHKAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN  VKVSTPQSTD+I K FPPS A FN S NST++Q+LQFL+NTNS YMLNAYPY
Sbjct  143  VASNLNFVVKVSTPQSTDVIPKPFPPSAAAFNSSWNSTLYQLLQFLKNTNSSYMLNAYPY  202

Query  683  YEYVKSD  703
            Y Y + +
Sbjct  203  YGYTQGN  209



>ref|XP_010257592.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257595.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
 ref|XP_010257598.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Nelumbo nucifera]
Length=514

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
             GAFVGINIG DV++LPSA DVV +LKA QI HVRL+DAD  ML+AL+ TGIEV+VGV N
Sbjct  39   TGAFVGINIGMDVTDLPSASDVVAILKANQITHVRLYDADNRMLNALAGTGIEVMVGVAN  98

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIGQS S AAAW+NKNV +YLPSTNITAIAVGSEVLTSIPNAAP+LVPAMNYLH A
Sbjct  99   EEVLGIGQSPSVAAAWINKNVVSYLPSTNITAIAVGSEVLTSIPNAAPILVPAMNYLHNA  158

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++N+N QVKVS+PQS D+I + FPPS ATFN + +S ++Q LQFL+NT S+YMLNA P
Sbjct  159  LVASNINFQVKVSSPQSMDMIPRPFPPSDATFNSTWSSIMYQFLQFLKNTGSFYMLNANP  218

Query  680  YYEYVKSD  703
            YY Y K +
Sbjct  219  YYGYTKGN  226



>ref|XP_003629715.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AET04191.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALS T I+V+VGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV+ANLN +VKVSTPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS +MLNAYP
Sbjct  142  LVAANLNFRVKVSTPQSMDIIPKPFPPSTATFNSSWNSTIYQVLQFLRNTNSSFMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y K D
Sbjct  202  YYGYTKGD  209



>gb|KJB66066.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66067.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66069.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=494

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAF+GINIGTDVS++PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGV
Sbjct  20   NVLGAFIGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAWVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LH
Sbjct  80   TNEEVLGIGESASAAAAWVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN QVKVS+PQ  D+I + FPP TA FN S NSTV+Q+LQFL NTNSY+MLNA
Sbjct  140  KALVASNLNFQVKVSSPQPLDIIPEPFPPCTAAFNSSPNSTVYQLLQFLNNTNSYFMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_010097806.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
 gb|EXB71433.1| Glucan endo-1,3-beta-glucosidase 4 [Morus notabilis]
Length=494

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVGINIGTDVS LPS  D+V +LKA Q  HVRL+DA+  +L AL+ +GIEV+VGV
Sbjct  20   NALGAFVGINIGTDVSTLPSEIDIVAILKAHQFTHVRLYDANTRLLKALAGSGIEVMVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N EVLGIG+S S AAAWVNKNVAAY+P+TNIT IAVGSEVLTSIPNAA VLV AMNYLH
Sbjct  80   ANEEVLGIGESPSVAAAWVNKNVAAYVPTTNITTIAVGSEVLTSIPNAASVLVSAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+ANLN QVKVSTPQS D+I + FPPSTA FN S NST++Q+LQFL+NTNSYYMLNA
Sbjct  140  KALVAANLNFQVKVSTPQSMDIIPRSFPPSTANFNSSWNSTIYQLLQFLKNTNSYYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y + +
Sbjct  200  YPYYGYTRGN  209



>ref|XP_006488904.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006488905.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006488906.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Citrus sinensis]
 gb|KDO63056.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
 gb|KDO63057.1| hypothetical protein CISIN_1g011131mg [Citrus sinensis]
Length=493

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GA+VG+NIGTDVSN+PSA D+V +L+A QI HVRL+DAD+HML ALS +GIEVIVGV
Sbjct  20   NVLGAYVGVNIGTDVSNMPSASDIVAILRANQITHVRLYDADSHMLKALSKSGIEVIVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N EVLGIG+S+S AA W+NKNVAAY+P+TNITAIAVGS+VLTSIPNAA VLV AMN LH
Sbjct  80   LNEEVLGIGESASAAAGWINKNVAAYMPTTNITAIAVGSQVLTSIPNAASVLVSAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+++LN QVK+STP S D+I + FPPSTATFN + NST++QILQFL+NT S+YMLNA
Sbjct  140  KALVASDLNFQVKISTPHSMDIIPRPFPPSTATFNSAWNSTIYQILQFLKNTKSFYMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_011093510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093512.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093513.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093514.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
 ref|XP_011093515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Sesamum indicum]
Length=502

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N VG+FVGINIGTDVSNLPSA ++V +L+A  I HVRLF+ADA ML+ALSNTGIEV++ V
Sbjct  19   NAVGSFVGINIGTDVSNLPSAVEIVAILRAHSISHVRLFNADARMLNALSNTGIEVMISV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EV  IG+S S AA W+NKNVAAY+P+TNITAIAVGSEVLTS+PNA+ V+VPAMNYL+
Sbjct  79   TNEEVTTIGESPSAAADWINKNVAAYVPTTNITAIAVGSEVLTSLPNASAVIVPAMNYLN  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN  VKVSTP S  +I++ FPPSTATFN + NST++QILQFL+NTNS+YMLNA
Sbjct  139  KALVASNLNYLVKVSTPHSMGIISRPFPPSTATFNATWNSTIYQILQFLKNTNSFYMLNA  198

Query  674  YPYYEYVKSD  703
            YPYYEYVKS+
Sbjct  199  YPYYEYVKSN  208



>gb|AFK37243.1| unknown [Medicago truncatula]
Length=498

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAFVG+NIGTDVS++PSA +VV +LKA QI HVRL+DA+AH+L ALS T I+V+VGVTN
Sbjct  22   LGAFVGVNIGTDVSDMPSASNVVAILKANQITHVRLYDANAHLLQALSKTNIDVMVGVTN  81

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVL IG+S S AAAW+NKNV AY+PSTNITAIAVGSEVL++IPN APVLVPAMN LHKA
Sbjct  82   EEVLRIGESPSAAAAWINKNVVAYVPSTNITAIAVGSEVLSTIPNVAPVLVPAMNSLHKA  141

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV+ANLN +VKV TPQS D+I K FPPSTATFN S NST++Q+LQFL+NTNS +MLNAYP
Sbjct  142  LVAANLNFRVKVPTPQSMDIIPKPFPPSTATFNSSWNSTIYQVLQFLRNTNSSFMLNAYP  201

Query  680  YYEYVKSD  703
            YY Y K D
Sbjct  202  YYGYTKGD  209



>ref|XP_010673492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAF+GI+IGT +S LP A DVV +L   +I HVRLFDADAHML AL+NT IEV+VGVTN
Sbjct  21   LGAFIGIDIGTHLSKLPPASDVVAILTDNKITHVRLFDADAHMLRALANTSIEVMVGVTN  80

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKA
Sbjct  81   EEVLGIGQSPSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKA  140

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NLN +VKVSTP S D+I++ FPPSTA FN S NST++Q+LQFL+NTNSY+MLNAYP
Sbjct  141  LVASNLNFKVKVSTPHSMDIISRPFPPSTAIFNSSWNSTMYQVLQFLKNTNSYFMLNAYP  200

Query  680  YYEYVKSD  703
            Y+ Y   D
Sbjct  201  YHGYTTGD  208



>ref|XP_004502208.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cicer arietinum]
Length=478

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            VGAFVG+NIG+DVS+LPSA +VV +LK+ QI HVRL+DA+ HML ALSNTGIEV+VGVT+
Sbjct  4    VGAFVGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTD  63

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             E+L IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH A
Sbjct  64   EEILTIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSA  123

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++NL+ +VKVSTPQS DLI + FPPSTATFN S NST+ Q+LQFL+NTNS YMLNAYP
Sbjct  124  LVASNLHFRVKVSTPQSMDLIPRPFPPSTATFNSSWNSTIHQLLQFLKNTNSSYMLNAYP  183

Query  680  YYEYVKSD  703
            YY Y   D
Sbjct  184  YYGYTNGD  191



>ref|XP_003601614.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES71865.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=498

 Score =   257 bits (656),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGT V++LPSA ++V +LK+ QI HVRL+DA+AHML ALSNTGIE++VGV
Sbjct  20   NVLGAFVGVNIGTHVTDLPSASNIVAILKSHQITHVRLYDANAHMLQALSNTGIELLVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            T+ E+L IG+S S AA W++KNVAAY+P TNIT IAVGSEVLTSIPN A VLVPAMN+LH
Sbjct  80   TDEEILRIGESPSVAATWISKNVAAYMPHTNITTIAVGSEVLTSIPNVARVLVPAMNHLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV++NL+ +VK+STPQS DLI K FPPSTATFN S NST+ QILQFL+NTNS YMLNA
Sbjct  140  SALVASNLHFRVKISTPQSMDLIPKPFPPSTATFNSSWNSTIHQILQFLKNTNSSYMLNA  199

Query  674  YPYYEYVKSD  703
            +PYY Y K D
Sbjct  200  HPYYGYTKGD  209



>ref|XP_004502207.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cicer arietinum]
Length=506

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+NIG+DVS+LPSA +VV +LK+ QI HVRL+DA+ HML ALSNTGIEV+VGVT+ 
Sbjct  33   GAFVGVNIGSDVSDLPSASNVVTILKSHQITHVRLYDANPHMLQALSNTGIEVLVGVTDE  92

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+L IG S S AA+W+ KNVAAY+P TNIT+IAVGS+VLTSIPN APVLVPAMN+LH AL
Sbjct  93   EILTIGDSPSVAASWITKNVAAYMPHTNITSIAVGSQVLTSIPNVAPVLVPAMNHLHSAL  152

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NL+ +VKVSTPQS DLI + FPPSTATFN S NST+ Q+LQFL+NTNS YMLNAYPY
Sbjct  153  VASNLHFRVKVSTPQSMDLIPRPFPPSTATFNSSWNSTIHQLLQFLKNTNSSYMLNAYPY  212

Query  683  YEYVKSD  703
            Y Y   D
Sbjct  213  YGYTNGD  219



>gb|KHG04722.1| hypothetical protein F383_29074 [Gossypium arboreum]
Length=495

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAF+GINIGTDVS++PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGV
Sbjct  20   NVLGAFIGINIGTDVSSMPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AAAWV+KNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LH
Sbjct  80   TNEEVLGIGESASAAAAWVSKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN QVKVS+PQS D+I + FPPSTA FN S NSTV+Q+LQFL NTNSY+MLNA
Sbjct  140  KALVASNLNFQVKVSSPQSLDIIPEPFPPSTAAFNSSPNSTVYQLLQFLNNTNSYFMLNA  199

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  200  YPYYGYTNGN  209



>ref|XP_010673491.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +2

Query  140  VGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTN  319
            +GAF+GI+IGT +S LP A DVV++L    I HVRLFDADAHML AL++T IEV+VGVTN
Sbjct  21   LGAFIGIDIGTHLSKLPQASDVVDILTNNVITHVRLFDADAHMLRALASTSIEVMVGVTN  80

Query  320  NEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKA  499
             EVLGIGQS S AAAWVNKNVAAY+P TNITAIAVGSEVLT+IP+AAP+LVPAMN LHKA
Sbjct  81   EEVLGIGQSQSVAAAWVNKNVAAYVPGTNITAIAVGSEVLTAIPHAAPILVPAMNNLHKA  140

Query  500  LVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYP  679
            LV++ LN +VKVSTP S D+I++ FPPSTA FN S NST++Q+LQFL+NTNS +MLNAYP
Sbjct  141  LVASKLNLKVKVSTPHSMDIISRPFPPSTAIFNSSWNSTMYQVLQFLKNTNSCFMLNAYP  200

Query  680  YYEYVKSD  703
            Y+ Y   D
Sbjct  201  YHGYTTGD  208



>ref|XP_008354986.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Malus domestica]
Length=475

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G ++G  I   V    +  D V LLKA QI HVRL++ADAHML ALSN+GIEV+VGVTN 
Sbjct  4    GKWIGGMILLLVGMFTNVLDTVALLKAHQITHVRLYNADAHMLKALSNSGIEVMVGVTNE  63

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVLGIG+S+S AAAW+NKNVAAYLPSTNITAIAVGSEV+T+IPNAAPVLV AMNYLHKAL
Sbjct  64   EVLGIGESASAAAAWINKNVAAYLPSTNITAIAVGSEVITTIPNAAPVLVSAMNYLHKAL  123

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN Q+KVSTPQS D+I K FPPSTATFN+S   T+++ILQF++NTNSYYMLNAYPY
Sbjct  124  VASNLNFQIKVSTPQSMDIIPKPFPPSTATFNYSWGPTIYRILQFIKNTNSYYMLNAYPY  183

Query  683  YEYVKSD  703
            Y Y   D
Sbjct  184  YGYTSGD  190



>gb|EYU27069.1| hypothetical protein MIMGU_mgv1a004989mg [Erythranthe guttata]
Length=501

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N VGA++G+NIGTDV+NLP   ++V +L+A QI HVRLFD+DA +L+ALS TGI+V V V
Sbjct  19   NSVGAYIGVNIGTDVTNLPPPVEIVAILRAHQITHVRLFDSDARILNALSATGIQVHVSV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S+S AA W++KN+AAYLPSTNITAI+VGSEVLTS+PNAAP+L  AM+ LH
Sbjct  79   TNQEVLGIGESTSAAATWISKNIAAYLPSTNITAISVGSEVLTSLPNAAPILFSAMSNLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV++NLN +VK+STP + D+I   FPPSTA FN + N+T+FQILQFL+NT S+Y +NA
Sbjct  139  KALVASNLNDRVKISTPFAMDVIPNPFPPSTANFNSTFNTTIFQILQFLKNTKSFYTVNA  198

Query  674  YPYYEYVKSD  703
            YPYYEYVKS+
Sbjct  199  YPYYEYVKSN  208



>ref|XP_004139073.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Cucumis sativus]
 gb|KGN66575.1| hypothetical protein Csa_1G630300 [Cucumis sativus]
Length=495

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+N+GT VSNLPSA D+V +LK+ QI H+RL++AD  +L AL+N+ IEVIVGV
Sbjct  19   NALGAFVGVNLGTGVSNLPSASDIVAILKSHQITHLRLYNADFQLLKALTNSSIEVIVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PVLVPAM  LH
Sbjct  79   TNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPVLVPAMYSLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+ANLN  +KVSTPQS D+I + FPPSTA+F+ S NST++Q+LQFL+NT S+YMLNA
Sbjct  139  KALVAANLNYLIKVSTPQSMDIIPRAFPPSTASFDASWNSTIYQLLQFLKNTKSFYMLNA  198

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  199  YPYYGYTSGN  208



>ref|XP_008450301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Cucumis melo]
Length=495

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+N+GT VSNLPS  D+V +LK+ QI H+RL++AD  +L AL+N+ IEVIVGV
Sbjct  19   NALGAFVGVNLGTSVSNLPSPSDIVAILKSHQITHLRLYNADPQLLKALANSSIEVIVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVL IG+S + AAAWVNKNVAA+LP TNITAIAVGSEVLT+IP+  PVLVPAM  LH
Sbjct  79   TNEEVLRIGESPAAAAAWVNKNVAAHLPGTNITAIAVGSEVLTTIPHVGPVLVPAMYSLH  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            KALV+ANLN  +KVSTPQS D+I + FPPSTA+F+ S NST++Q+LQFL+NT SYYMLNA
Sbjct  139  KALVAANLNYLIKVSTPQSMDIIPRPFPPSTASFDASWNSTIYQLLQFLKNTKSYYMLNA  198

Query  674  YPYYEYVKSD  703
            YPYY Y   +
Sbjct  199  YPYYGYTSGN  208



>gb|EPS57592.1| hypothetical protein M569_17225, partial [Genlisea aurea]
Length=237

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVGINIGTD+SN PS  D+V LL++  I HVRLFD+D H+L ALS TGIEV + V N E
Sbjct  1    AFVGINIGTDISNPPSPADMVSLLRSHHITHVRLFDSDPHILRALSGTGIEVAITVKNEE  60

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            ++GIG+  S+AA W+N+NV  +LPSTNITA+ VG+EVLTS P+ APVLVPAM  LH+ALV
Sbjct  61   LVGIGEIPSRAADWINRNVVPHLPSTNITAVCVGTEVLTSAPHVAPVLVPAMANLHRALV  120

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            S++LN  VKVSTP S D++   FPPS+A FN + N+T+F+ILQFL+NT SY+MLNAYPYY
Sbjct  121  SSDLNFLVKVSTPHSMDVVPAPFPPSSAAFNATWNATMFRILQFLRNTESYFMLNAYPYY  180

Query  686  EYVKS  700
            EYVKS
Sbjct  181  EYVKS  185



>ref|XP_011653551.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Cucumis sativus]
Length=523

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN 
Sbjct  43   GAFVGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  102

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  103  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKAL  162

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+NTNSYYMLN YPY
Sbjct  163  VAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKNTNSYYMLNVYPY  222

Query  683  YEYVKSD  703
            Y Y+K +
Sbjct  223  YGYIKGN  229



>ref|XP_011653549.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cucumis sativus]
 ref|XP_011653550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Cucumis sativus]
 gb|KGN54064.1| hypothetical protein Csa_4G280410 [Cucumis sativus]
Length=526

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN 
Sbjct  46   GAFVGINIGTHVSSLPPASDVVSMLKQFEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  105

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  106  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLLRAMKYLHKAL  165

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+NTNSYYMLN YPY
Sbjct  166  VAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKNTNSYYMLNVYPY  225

Query  683  YEYVKSD  703
            Y Y+K +
Sbjct  226  YGYIKGN  232



>ref|XP_009413316.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+GINIGT +S+LPSA ++V +LK +QIKHVRLFDAD  ML+ALSNTGIEV VGV N+
Sbjct  22   GAFIGINIGTQMSSLPSAAEIVSILKTQQIKHVRLFDADHQMLNALSNTGIEVTVGVPND  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG+S S+AA W+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VLVPAM +L  AL
Sbjct  82   QLLRIGESRSEAANWINKNVAAFVPATNITCIAVGNEVLTTIPNAALVLVPAMQFLQSAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN QVKVS+PQS D+I K FPPSTATFN S NS ++Q LQFL+NT S +MLNA PY
Sbjct  142  VAANLNFQVKVSSPQSMDMIPKHFPPSTATFNLSWNSVMYQYLQFLKNTGSSFMLNAQPY  201

Query  683  YEYVK  697
            Y Y K
Sbjct  202  YAYAK  206



>ref|XP_002884972.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61231.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTD++N+PS  D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTNNE
Sbjct  24   AYIGVNIGTDLTNMPSPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNNE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV
Sbjct  84   ILRIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYY  203

Query  686  EYVKSD  703
             Y  ++
Sbjct  204  GYTTAN  209



>ref|XP_010542461.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
 ref|XP_010542462.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=509

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+NIGTD++N+PS  D V LLK+ QI H+RLFDA++HML AL+ +GIEV V VTN+
Sbjct  23   GAFVGVNIGTDITNMPSPSDAVVLLKSHQITHIRLFDANSHMLKALAGSGIEVTVSVTND  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+LGIG+  S AA+WVNKNVA+Y+PSTNITAIAVGSEVLT+IP+ AP LV A+N +HKAL
Sbjct  83   ELLGIGRYPSSAASWVNKNVASYVPSTNITAIAVGSEVLTTIPHVAPALVSALNNIHKAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN +VKVS+P S D+I K FPPSTATFN S N+T +Q+L+FL+NT SY+MLNAYPY
Sbjct  143  VAANLNFRVKVSSPMSMDIIPKPFPPSTATFNASWNATFYQLLRFLKNTGSYFMLNAYPY  202

Query  683  YEYVKSD  703
            Y Y   +
Sbjct  203  YGYTTGN  209



>dbj|BAH57260.1| AT3G13560 [Arabidopsis thaliana]
Length=452

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
             AF+G+NIGTD++N+P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN 
Sbjct  23   AAFIGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKAL
Sbjct  83   EILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPY
Sbjct  143  VASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPY  202

Query  683  YEYVKSD  703
            Y Y  ++
Sbjct  203  YGYTTAN  209



>ref|XP_008449819.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X3 [Cucumis 
melo]
Length=498

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN 
Sbjct  19   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  79   EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YPY
Sbjct  139  VAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYPY  198

Query  683  YEYVKSD  703
            + Y+K +
Sbjct  199  HGYIKGN  205



>ref|XP_009406533.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=500

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  50   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  109

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  110  QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  169

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++ANLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PY
Sbjct  170  LAANLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPY  229

Query  683  YEYVK  697
            Y Y K
Sbjct  230  YVYTK  234



>ref|XP_008449817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Cucumis 
melo]
Length=522

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN 
Sbjct  43   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  102

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  103  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  162

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YPY
Sbjct  163  VAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYPY  222

Query  683  YEYVKSD  703
            + Y+K +
Sbjct  223  HGYIKGN  229



>ref|NP_187965.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974302.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 ref|NP_974303.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 sp|Q94CD8.1|E134_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 4; AltName: Full=(1->3)-beta-glucan 
endohydrolase 4; Short=(1->3)-beta-glucanase 
4; AltName: Full=Beta-1,3-endoglucanase 4; Short=Beta-1,3-glucanase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59446.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 gb|AAL34291.1| putative glucan endo-1,3-beta-glucosidase precursor [Arabidopsis 
thaliana]
 dbj|BAH19959.1| AT3G13560 [Arabidopsis thaliana]
 gb|AEE75372.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75373.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
 gb|AEE75374.1| glucan endo-1,3-beta-glucosidase 4 [Arabidopsis thaliana]
Length=505

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD++N+P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYY  203

Query  686  EYVKSD  703
             Y  ++
Sbjct  204  GYTTAN  209



>ref|NP_001060087.2| Os07g0577300 [Oryza sativa Japonica Group]
 dbj|BAH01358.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22001.2| Os07g0577300 [Oryza sativa Japonica Group]
Length=498

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV
Sbjct  25   NVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  84

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  85   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  144

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  145  SALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNA  204

Query  674  YPYYEYVK  697
             PYY+YVK
Sbjct  205  QPYYDYVK  212



>ref|XP_008449814.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449815.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
 ref|XP_008449816.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Cucumis 
melo]
Length=525

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVGINIGT VS+LP A DVV +LK  +  HVRL+DA+A +L A +N+  EV+VGVTN 
Sbjct  46   GAFVGINIGTHVSSLPPASDVVSMLKQYEFTHVRLYDANAQLLKAFANSSTEVMVGVTNE  105

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            EVL IG+S S AAAWVNKNV  Y P+TNITAIAVGSEVLTSIPNAA VL+ AM YLHKAL
Sbjct  106  EVLKIGKSPSAAAAWVNKNVVLYTPATNITAIAVGSEVLTSIPNAARVLIRAMKYLHKAL  165

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN Q+KVSTPQS D+I   FPPSTATFN S NST++Q+LQFL+ TNSYYMLN YPY
Sbjct  166  VAANLNLQIKVSTPQSMDVILTSFPPSTATFNSSLNSTIYQLLQFLKKTNSYYMLNVYPY  225

Query  683  YEYVKSD  703
            + Y+K +
Sbjct  226  HGYIKGN  232



>ref|XP_009406534.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406535.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=496

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  22   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  82   QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++ANLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PY
Sbjct  142  LAANLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPY  201

Query  683  YEYVK  697
            Y Y K
Sbjct  202  YVYTK  206



>gb|EEC82319.1| hypothetical protein OsI_26597 [Oryza sativa Indica Group]
Length=521

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGIN+GTD+SN PSA D+V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV
Sbjct  48   NAHGAFVGINVGTDISNPPSASDIVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  107

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  108  PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  167

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  168  SALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNA  227

Query  674  YPYYEYVK  697
             PYY+YVK
Sbjct  228  QPYYDYVK  235



>ref|XP_010552278.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Tarenaya 
hassleriana]
Length=507

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+N+GTD++ +PS  DVV LLK+ QI H+RL++AD+HML AL+N+ IEV+VGVTN+
Sbjct  23   GAFVGVNLGTDITKMPSPSDVVSLLKSHQITHIRLYNADSHMLKALANSNIEVMVGVTND  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E++ IG++ S AA+W+++NV +Y+PSTNITAI++GSEVLT+IP+ APVLV A+N +HKAL
Sbjct  83   ELISIGRNPSSAASWISENVVSYVPSTNITAISIGSEVLTTIPHVAPVLVLALNNVHKAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANLN +VKVSTP S D+I K FPPSTATF+ S N+TV+QIL+FL+NT SY+MLNAYPY
Sbjct  143  VAANLNFKVKVSTPMSMDIIPKPFPPSTATFDSSWNTTVYQILRFLKNTGSYFMLNAYPY  202

Query  683  YEYVKSD  703
            Y Y   D
Sbjct  203  YGYTTGD  209



>ref|XP_009406531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009406532.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=524

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+GINIGT +S+LPSA ++V +LK ++IKHVRLFDAD  ML+AL+NTGIEV+VGV N+
Sbjct  50   GAFIGINIGTQMSSLPSAAEIVSILKTQRIKHVRLFDADHQMLNALANTGIEVLVGVPND  109

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG+S S+AAAW+NKNVAA++P+TNIT IAVG+EVLT+IPNAA VL+PAM +LH AL
Sbjct  110  QLLRIGESQSEAAAWINKNVAAFVPATNITYIAVGNEVLTTIPNAALVLIPAMQFLHSAL  169

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++ANLN QVKVS+PQS D+I K FPPSTA+FN S NS + Q LQFL+NT S +MLNA PY
Sbjct  170  LAANLNFQVKVSSPQSMDMIPKHFPPSTASFNSSWNSIMNQYLQFLKNTGSSFMLNAQPY  229

Query  683  YEYVK  697
            Y Y K
Sbjct  230  YVYTK  234



>ref|XP_006658732.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Oryza brachyantha]
Length=457

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  G+FVGIN+GTD+S  PSA D+V +LK ++I+HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  29   NVSGSFVGINVGTDISKPPSASDIVSILKEKKIQHVRLLDSDHQMLTALANTGIEVMVGV  88

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT++PNAA VL+PA+ +L 
Sbjct  89   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGNEVLTTVPNAALVLIPALQFLQ  148

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  149  SALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMSQYLQFLNNTGSSFMLNA  208

Query  674  YPYYEYVK  697
             PYY+YVK
Sbjct  209  QPYYDYVK  216



>gb|EEE67465.1| hypothetical protein OsJ_24859 [Oryza sativa Japonica Group]
Length=555

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV
Sbjct  82   NAHGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  141

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  142  PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  201

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  202  SALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNA  261

Query  674  YPYYEYVK  697
             PYY+YVK
Sbjct  262  QPYYDYVK  269



>ref|XP_009146477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
 ref|XP_009146478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brassica rapa]
Length=502

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML ALSNT I+V VGVTN E
Sbjct  25   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQE  84

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  85   ILKIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALV  144

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            + NLN QVKVSTP S D++ K FPPST+TF+ S N+TV QILQFL NT S++MLNAYPYY
Sbjct  145  ATNLNFQVKVSTPMSMDVMPKPFPPSTSTFSPSWNTTVHQILQFLDNTGSFFMLNAYPYY  204

Query  686  EYVKSD  703
             Y  ++
Sbjct  205  GYTTAN  210



>ref|XP_006407197.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407198.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 ref|XP_006407199.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48650.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48651.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
 gb|ESQ48652.1| hypothetical protein EUTSA_v10020572mg [Eutrema salsugineum]
Length=500

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT ++N+PS  D+V LLK+RQI HVRL+DA++HML A +NT IEV+VGVTN E
Sbjct  21   AFIGVNIGTGLTNMPSPSDIVTLLKSRQITHVRLYDANSHMLKAFANTSIEVMVGVTNEE  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  81   ILKIGRYPSAAASWVNKNVAAYVPSTNITAIAVGSEVLTITPHVAPILASALNNIHKALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY
Sbjct  141  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYY  200

Query  686  EYVKSD  703
             Y  ++
Sbjct  201  GYTTAN  206



>gb|KJB66065.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
 gb|KJB66068.1| hypothetical protein B456_010G126400 [Gossypium raimondii]
Length=458

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = +2

Query  185  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  364
            +PSA +VV ++K  +I HVRL+DAD+HML AL+++GIEV VGVTN EVLGIG+S+S AAA
Sbjct  1    MPSASEVVSIIKTHRITHVRLYDADSHMLKALADSGIEVTVGVTNEEVLGIGESASAAAA  60

Query  365  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  544
            WVNKNVA+Y+PSTNITAIAVGSEVLTSIP+AAP+LV AMN LHKALV++NLN QVKVS+P
Sbjct  61   WVNKNVASYVPSTNITAIAVGSEVLTSIPHAAPILVTAMNNLHKALVASNLNFQVKVSSP  120

Query  545  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  703
            Q  D+I + FPP TA FN S NSTV+Q+LQFL NTNSY+MLNAYPYY Y   +
Sbjct  121  QPLDIIPEPFPPCTAAFNSSPNSTVYQLLQFLNNTNSYFMLNAYPYYGYTNGN  173



>ref|XP_010500722.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010500729.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTDV+N+PS  D+V LL ++QI HVRL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNGE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAAPHVAPILASALHNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT+S++MLNAYPYY
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTDSFFMLNAYPYY  203

Query  686  EYVKSD  703
             Y  ++
Sbjct  204  GYTAAN  209



>ref|XP_010465199.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
 ref|XP_010465200.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Camelina sativa]
Length=507

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTDV+N+PS  D+V LL ++QI HVRL+DA++HML A +NT IEV+VGVTN E
Sbjct  24   AFIGVNIGTDVTNMPSPSDIVALLNSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNGE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVL++ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYVPSTNITAIAVGSEVLSAAPHVAPILASALHNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT+S++MLNAYPYY
Sbjct  144  ASNLNFKVKVSSPMSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTDSFFMLNAYPYY  203

Query  686  EYVKSD  703
             Y  ++
Sbjct  204  GYTAAN  209



>ref|XP_008789151.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Phoenix 
dactylifera]
Length=460

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  G FVGI IGTD+SNLPSA D+V +LKA+ IKHVRLFD D  ML+AL+NTGIEV+VGV
Sbjct  14   NVSGVFVGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGV  73

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  74   PNDQLLSVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQ  133

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV+ANLN QVKVS+PQS D++ K FPP TATFN + NS ++Q LQFL+NT S +MLNA
Sbjct  134  SALVAANLNFQVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYQYLQFLKNTGSSFMLNA  193

Query  674  YPYYEYVK  697
             PYY Y K
Sbjct  194  QPYYGYTK  201



>dbj|BAC83070.1| putative elicitor inducible beta-1,3-glucanase [Oryza sativa 
Japonica Group]
Length=666

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGIN+GTD+SN PSA D V +LK ++I+HVRL D+D  MLSAL+NTGIEV+VGV
Sbjct  19   NVSGAFVGINVGTDISNPPSASDTVSILKEKKIQHVRLLDSDHQMLSALANTGIEVVVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG+EVLT+ PNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITHIAVGNEVLTTEPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P STD+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  139  SALLAANLNTQVKISSPHSTDMISKPFPPSTATFNSTWSSIMLQYLQFLNNTASPFMLNA  198

Query  674  YPYYEYVK  697
             PYY+YVK
Sbjct  199  QPYYDYVK  206



>ref|XP_008789143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X1 [Phoenix 
dactylifera]
Length=486

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  G FVGI IGTD+SNLPSA D+V +LKA+ IKHVRLFD D  ML+AL+NTGIEV+VGV
Sbjct  14   NVSGVFVGITIGTDMSNLPSASDIVSILKAQHIKHVRLFDTDHQMLNALANTGIEVMVGV  73

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS + AA W+NKNVA+++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  74   PNDQLLSVGQSRTVAADWINKNVASFVPATNITYIAVGNEVLSTIPNASLVLVPAMKFLQ  133

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV+ANLN QVKVS+PQS D++ K FPP TATFN + NS ++Q LQFL+NT S +MLNA
Sbjct  134  SALVAANLNFQVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYQYLQFLKNTGSSFMLNA  193

Query  674  YPYYEYVK  697
             PYY Y K
Sbjct  194  QPYYGYTK  201



>gb|EMT26371.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=390

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT+VS+LPSA D+V +LKA++I+HVRL D++  ML AL+NTGIEV+VGV
Sbjct  51   NASGAFVGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  110

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             NNE+L +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  111  PNNELLRVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  170

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q L FL+ T S +MLNA
Sbjct  171  SALLAANLNTQVKLSSPHSMDMISKAFPPSTATFNSTWSSIMLQYLGFLKKTGSSFMLNA  230

Query  674  YPYYEYVK  697
             PYY YVK
Sbjct  231  QPYYGYVK  238



>ref|XP_006297495.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
 gb|EOA30393.1| hypothetical protein CARUB_v10013514mg [Capsella rubella]
Length=499

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD++N+PS  +VVELL ++QI HVRL+DA++HML A +N+ IEV+VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPSPSEVVELLNSQQITHVRLYDANSHMLKAFANSSIEVMVGVTNEE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AAAWVNKNVAAY+PSTNITAIAVGSEVLT+ P+ AP+L  A++ +HKALV
Sbjct  84   ILKIGRFPSAAAAWVNKNVAAYIPSTNITAIAVGSEVLTTNPHVAPILASALHNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NLN +VKVS+P S  ++ K FPPST+TF+ S N+TV+Q+LQFL+NT+S++MLNAYPYY
Sbjct  144  ASNLNFKVKVSSPMSMGIMPKPFPPSTSTFSPSWNTTVYQLLQFLENTDSFFMLNAYPYY  203

Query  686  EYVKSD  703
             Y  ++
Sbjct  204  GYTTAN  209



>ref|XP_010236492.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Brachypodium distachyon]
Length=501

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVG+++GT VS+LPS  D+V +LKA++I+HVRL D+D  ML AL+NTGIEV+VGV
Sbjct  28   NASGAFVGVHVGTGVSDLPSPSDIVSILKAKRIQHVRLVDSDHKMLVALANTGIEVMVGV  87

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VLVPA+ +L 
Sbjct  88   PNDQLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGDEVLTTIPNAALVLVPALQFLQ  147

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q LQFL NT S +MLNA
Sbjct  148  SALLAANLNTQVKISSPHSMDMISKAFPPSTATFNSTWSSIMSQYLQFLNNTGSSFMLNA  207

Query  674  YPYYEYVK  697
             PYY YVK
Sbjct  208  QPYYGYVK  215



>ref|XP_004958122.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like [Setaria italica]
Length=653

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGI IG D+SNLPSA D+V +LKA++I+HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNLPSATDIVAILKAKKIQHVRLIDSDHQMLTALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY+P+TNIT IAVG EVLT+IPNAA VL+PA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYVPATNITYIAVGDEVLTNIPNAALVLIPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPSTATFN + +S + Q LQFL+NT S +MLNA
Sbjct  139  SALLAANLNTQVKISSPHSMDMISKAFPPSTATFNSTWSSIMSQYLQFLKNTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYSYV  205



>tpg|DAA63295.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63296.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=494

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGI IG D+SN+P A D+V +LKA++I+HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLNALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+NT S +MLNA
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATFNLTWSSIMSQYLQFLKNTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYGYV  205



>ref|XP_010934539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934546.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
 ref|XP_010934552.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Elaeis guineensis]
Length=492

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  G +VGI IGTD+SNLPSA D+V +LKA++IKHVRLFD D  ML+AL+NTGIEV+VGV
Sbjct  20   NVSGVYVGITIGTDMSNLPSASDIVSILKAQRIKHVRLFDTDHQMLNALANTGIEVMVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L IGQS + AA W+NKNVAA++P+TNIT IAVG+EVL++IPNA+ VLVPAM +L 
Sbjct  80   PNDQLLSIGQSRTVAADWINKNVAAFVPATNITYIAVGNEVLSTIPNASFVLVPAMKFLQ  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV+ANLN  VKVS+PQS D++ K FPP TATFN + NS +++ LQFL+NT S +MLNA
Sbjct  140  SALVAANLNFLVKVSSPQSMDVMPKSFPPFTATFNSTWNSVMYEYLQFLKNTGSSFMLNA  199

Query  674  YPYYEYVK  697
             PYY Y K
Sbjct  200  QPYYGYTK  207



>ref|XP_009762818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
sylvestris]
Length=508

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL+NTGI V V V N++
Sbjct  31   AFVGVNIGTDVSDMPSPAKVVALLKAQQIRHVRLFDADQAMLLALANTGIHVTVSVPNDQ  90

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLTS+PNAAPVLV AM ++H ALV
Sbjct  91   LLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTSLPNAAPVLVSAMRFIHSALV  150

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+S++KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  151  AANLDSKIKVSTPHSSSIVLDSFPPSQAFFNRSLDPVMVPLLKFLQSTGSYLMLNVYPYY  210

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  211  DYMKSN  216



>ref|XP_002460914.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
 gb|EER97435.1| hypothetical protein SORBIDRAFT_02g037380 [Sorghum bicolor]
Length=494

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGI IG D+SN+P A D+V +LKA++ +HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNMPPATDIVSILKAKKTQHVRLLDSDHQMLTALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNVAAY P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVAAYTPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q L+FL+NT S +MLNA
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATFNSTWSSIMSQYLEFLKNTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYGYV  205



>ref|XP_006828511.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Amborella 
trichopoda]
 gb|ERM95927.1| hypothetical protein AMTR_s00060p00188740 [Amborella trichopoda]
Length=526

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +2

Query  137  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  316
            F GAFVG+N+GTDV+N+PS   VV LLK +QI   RL+DAD  ML+AL+NTGI V+V V 
Sbjct  47   FAGAFVGVNVGTDVTNMPSPTQVVALLKKQQIHDARLYDADRAMLTALANTGIRVVVSVP  106

Query  317  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  496
            NN++L +GQS++ AA WV +NVAAYLP+TNIT IAVGSEVLTSIPNAA VLVPAMN+LH 
Sbjct  107  NNQLLAVGQSNATAANWVARNVAAYLPATNITGIAVGSEVLTSIPNAALVLVPAMNFLHS  166

Query  497  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  676
            ALV+ANL+ QVKVSTP S+D+I   FPPS A FN +    +  +L FLQ T + +MLN Y
Sbjct  167  ALVAANLDRQVKVSTPHSSDIILDSFPPSQAFFNRTWTPVLVPMLSFLQKTGAPFMLNVY  226

Query  677  PYYEYVKSD  703
            PYY Y++S+
Sbjct  227  PYYVYMQSN  235



>gb|EMS60322.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=627

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT+VS+LPSA D+V +LKA++I+HVRL D++  ML AL+NTGIEV+VGV
Sbjct  95   NASGAFVGINIGTNVSDLPSASDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  154

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             NNE+L +GQS   AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  155  PNNELLRVGQSRPTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  214

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q L FL+ T S +MLNA
Sbjct  215  SALLAANLNTQVKLSSPHSMDMISKAFPPSAATFNSTWSSIMLQYLGFLKRTGSSFMLNA  274

Query  674  YPYYEYVK  697
             PYY YVK
Sbjct  275  QPYYGYVK  282



>ref|XP_010527795.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Tarenaya hassleriana]
Length=499

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTD++++PS   VV LLK + I+HVRL+DAD  ML AL+NTGIEVIV V N++
Sbjct  21   AFVGVNIGTDLTDMPSPTQVVALLKTQNIRHVRLYDADRAMLLALANTGIEVIVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NVAAY+P+TNITA+AVGSEVLT++PNAAPVLV A+ YL  ALV
Sbjct  81   LLGIGQSNATAANWVTRNVAAYVPATNITAVAVGSEVLTTVPNAAPVLVSALKYLQSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN +    +  +L+FLQ+T SY MLN YPYY
Sbjct  141  AANLDRQIKVSTPHSSSIILDSFPPSQAFFNKTWEPVIVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +YV+S+
Sbjct  201  DYVQSN  206



>ref|NP_001131285.1| putative O-Glycosyl hydrolase superfamily protein isoform 1 precursor 
[Zea mays]
 gb|ACF79625.1| unknown [Zea mays]
 gb|ACL53366.1| unknown [Zea mays]
 tpg|DAA41198.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
1 [Zea mays]
 tpg|DAA41199.1| TPA: putative O-Glycosyl hydrolase superfamily protein isoform 
2 [Zea mays]
Length=492

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGI IG D+SN+P A D+V +LKA++I+HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATDIVSILKAKKIQHVRLLDSDHQMLTALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VL+PA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVNAYIPATNITYIAVGNEVLTTIPNAALVLIPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANL++QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+NT S +MLNA
Sbjct  139  SALLAANLDTQVKISSPHSMDVISKAFPPSAATFNSTWSSIMSQYLQFLKNTESSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYGYV  205



>ref|NP_001149308.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
 gb|ACG34964.1| glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays]
Length=494

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGI IG D+SN+P A  +V +LKA++I+HVRL D+D  ML+AL+NTGIEV+VGV
Sbjct  19   NVSGAFVGITIGNDMSNIPPATGIVSILKAKKIQHVRLLDSDHQMLNALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS S AA W+NKNV AY+P+TNIT IAVG+EVLT+IPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRSTAADWINKNVGAYIPATNITYIAVGNEVLTTIPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPS ATFN + +S + Q LQFL+NT S +MLNA
Sbjct  139  SALLAANLNTQVKISSPHSMDVISKAFPPSAATFNLTWSSIMSQYLQFLKNTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYGYV  205



>ref|XP_011628180.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Amborella 
trichopoda]
Length=498

 Score =   228 bits (582),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+N+GTDV+N+PS   VV LLK +QI   RL+DAD  ML+AL+NTGI V+V V NN
Sbjct  21   GAFVGVNVGTDVTNMPSPTQVVALLKKQQIHDARLYDADRAMLTALANTGIRVVVSVPNN  80

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV +NVAAYLP+TNIT IAVGSEVLTSIPNAA VLVPAMN+LH AL
Sbjct  81   QLLAVGQSNATAANWVARNVAAYLPATNITGIAVGSEVLTSIPNAALVLVPAMNFLHSAL  140

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ QVKVSTP S+D+I   FPPS A FN +    +  +L FLQ T + +MLN YPY
Sbjct  141  VAANLDRQVKVSTPHSSDIILDSFPPSQAFFNRTWTPVLVPMLSFLQKTGAPFMLNVYPY  200

Query  683  YEYVKSD  703
            Y Y++S+
Sbjct  201  YVYMQSN  207



>gb|EMS53703.1| Glucan endo-1,3-beta-glucosidase 4 [Triticum urartu]
Length=477

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT VS+LPSA D++  LKA +I+HVRL D+D  ML AL+NTGIEV+VGV
Sbjct  19   NASGAFVGINIGTGVSDLPSASDIISTLKAMKIQHVRLVDSDHQMLVALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS   AA WVNKNVAAY P+TNIT IAVG EVLTSIPNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRPAAADWVNKNVAAYTPATNITYIAVGDEVLTSIPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I K FPPSTATFN + +S +   LQFL++T S +MLNA
Sbjct  139  SALLAANLNTQVKLSSPHSMDMIPKAFPPSTATFNSTWSSVMLPYLQFLKSTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYSYV  205



>ref|XP_009602434.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nicotiana 
tomentosiformis]
Length=512

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL+NTGI V V V N++
Sbjct  31   AFVGVNIGTDVSDMPSPSKVVALLKAQQIRHVRLFDADQAMLLALANTGIRVTVSVPNDQ  90

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+  + P+TNITAIA+GSEVLT++PNAAPVLV AM +++ ALV
Sbjct  91   LLGIGQSNSTAANWVSRNILTHFPATNITAIAIGSEVLTTLPNAAPVLVSAMRFIYSALV  150

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+S++KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  151  AANLDSKIKVSTPHSSSIVLDSFPPSQAFFNRSLDPVMVPLLKFLQSTGSYLMLNVYPYY  210

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  211  DYMKSN  216



>ref|XP_004236940.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Solanum lycopersicum]
Length=505

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I VIV V N++
Sbjct  28   AFVGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVIVSVPNDQ  87

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  88   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  147

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY+MLN YPYY
Sbjct  148  AANLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTDSYFMLNVYPYY  207

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  208  DYMKSN  213



>dbj|BAJ89950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 152/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT VS+L S  D+V +LKA++I+HVRL D++  ML AL+NTGIEV+VGV
Sbjct  25   NTSGAFVGINIGTRVSDLTSPSDIVSILKAKKIQHVRLVDSNHEMLVALANTGIEVMVGV  84

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             NN +L +GQS S AA W+NKNVAAY+P+TNIT IAVG E+LT++PNAA VLVPA+ +L 
Sbjct  85   PNNHLLRVGQSRSTAADWINKNVAAYIPATNITYIAVGDEILTTVPNAALVLVPALQFLQ  144

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I+K FPPSTATFN + N T+ Q L+FL+ T S +MLNA
Sbjct  145  SALLAANLNTQVKISSPHSMDMISKAFPPSTATFNSTWNLTMSQYLEFLRTTGSSFMLNA  204

Query  674  YPYYEYVK  697
             PYY YVK
Sbjct  205  QPYYGYVK  212



>ref|XP_009388452.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=494

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  G +VGINIG  VSNLPSA D+V +LK +QIKHVRLFDA+  ML AL+NTGI+V++GV
Sbjct  19   NASGVYVGINIGNMVSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L IG S S+AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L 
Sbjct  79   PNDQLLRIGNSRSEAADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             ALV++NLNSQVKVS+P S D+I K FPPSTATFN S NS + Q L FL+NT S  M+NA
Sbjct  139  SALVASNLNSQVKVSSPLSMDMIPKSFPPSTATFNSSWNSVMSQYLLFLKNTGSPLMVNA  198

Query  674  YPYYEYVK  697
             PYY Y+K
Sbjct  199  QPYYGYIK  206



>emb|CDY23618.1| BnaC05g39760D [Brassica napus]
Length=421

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML A +NT I+V VGVTN E
Sbjct  38   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKAFANTTIQVTVGVTNQE  97

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AA+W+NKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  98   ILKIGRFPSSAASWINKNVAAYVPSTNITAIAVGSEVLTQSPHVAPILASALNNIHKALV  157

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
            + NLN QVKVSTP S D++ K FPPST+TF+ S N+TV QILQFL NT S++MLNA
Sbjct  158  AMNLNFQVKVSTPMSMDVMPKPFPPSTSTFSPSWNTTVHQILQFLDNTGSFFMLNA  213



>ref|XP_006599426.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Glycine max]
Length=445

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_010653417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Vitis 
vinifera]
Length=480

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N++
Sbjct  3    AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  62

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  63   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  122

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY
Sbjct  123  AANLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYY  182

Query  686  EYVKSD  703
            +Y++S+
Sbjct  183  DYMQSN  188



>gb|AFU52641.1| beta-1,3-glucanase 6 [Solanum tuberosum]
Length=501

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I V V V N++
Sbjct  24   AFVGVNIGTDVSDMPSPAQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPNDQ  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  84   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  144  AANLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTGSYFMLNVYPYY  203

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  204  DYMKSN  209



>ref|XP_010653375.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Vitis 
vinifera]
Length=512

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N++
Sbjct  35   AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  94

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  95   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  154

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY
Sbjct  155  AANLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYY  214

Query  686  EYVKSD  703
            +Y++S+
Sbjct  215  DYMQSN  220



>emb|CBI26850.3| unnamed protein product [Vitis vinifera]
Length=498

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+SN+P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N++
Sbjct  21   AFIGVNIGTDLSNMPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+SQ+KVSTP S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY
Sbjct  141  AANLDSQIKVSTPHSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_003548935.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Glycine max]
Length=496

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDVTNMPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_006355069.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Solanum tuberosum]
Length=505

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTDVS++PS   VV LLKA+QI+HVRLFDAD  ML AL++T I V V V N++
Sbjct  28   AFVGVNIGTDVSDMPSPVQVVALLKAQQIRHVRLFDADQAMLLALAHTEIRVTVSVPNDQ  87

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ +++P+TNITAIA+GSEVLT++PNAAP+LV AM ++H ALV
Sbjct  88   LLGIGQSNSTAANWVSRNILSHVPATNITAIAIGSEVLTTLPNAAPLLVSAMKFIHSALV  147

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL++++KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  148  AANLDTKIKVSTPHSSFIILDSFPPSQAFFNRSLDPVMVPLLKFLQDTGSYFMLNVYPYY  207

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  208  DYMKSN  213



>ref|XP_010528550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Tarenaya hassleriana]
Length=500

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+G+NIGTD+S++P    VV LLKA+QIKH+RL+D+D  ML ALSNTGI+V+V V N+
Sbjct  26   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIKHIRLYDSDPGMLIALSNTGIKVVVSVPND  85

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+TNITAIAVGSEVLT++PNAAP+LV A+  +H AL
Sbjct  86   QLLGIGQSNSTAANWVKRNVIAHYPATNITAIAVGSEVLTTLPNAAPILVNAIKNIHSAL  145

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+ ++KVSTP STDLI   FPPS A FN S N  +  +L FLQ+T+SY MLN YPY
Sbjct  146  LSANLDGRIKVSTPLSTDLILDPFPPSQAFFNRSWNLVLVPLLSFLQSTDSYLMLNVYPY  205

Query  683  YEYVKSD  703
             +Y++S+
Sbjct  206  DDYMRSN  212



>gb|KEH40581.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=498

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTDV+N+PS  + V LLKA+ I+HVRLFDAD  ML AL+ TGI+VIV V N+E
Sbjct  22   AYIGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDE  81

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALV  141

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP ST +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY
Sbjct  142  AANLDDQIKVSTPLSTSIILDSFPPSQAFFNRTWDPVMSPLLKFLQSTGSYLMLNVYPYY  201

Query  686  EYVKSD  703
            +Y++S+
Sbjct  202  DYMQSN  207



>gb|KEH40580.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=506

 Score =   224 bits (570),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTDV+N+PS  + V LLKA+ I+HVRLFDAD  ML AL+ TGI+VIV V N+E
Sbjct  22   AYIGVNIGTDVTNMPSPTETVALLKAQNIQHVRLFDADKSMLLALAKTGIQVIVSVPNDE  81

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPSTNITAIAVGSEVLTSLPNAAPVLVSALQFIQSALV  141

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP ST +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPYY
Sbjct  142  AANLDDQIKVSTPLSTSIILDSFPPSQAFFNRTWDPVMSPLLKFLQSTGSYLMLNVYPYY  201

Query  686  EYVKSD  703
            +Y++S+
Sbjct  202  DYMQSN  207



>ref|XP_004297451.2| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   223 bits (569),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N++
Sbjct  27   AFVGVNLGTDLSDMPSPTVVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQ  86

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA W+ +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  87   LLGIGQSNATAANWITRNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALV  146

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLNAYPYY
Sbjct  147  ASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDKVMVPVLKFLQSTDSYLMLNAYPYY  206

Query  686  EYVKSD  703
            +Y++S+
Sbjct  207  DYMQSN  212



>ref|XP_011021800.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Populus euphratica]
Length=498

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT VS++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  141  ASNLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_011021799.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Populus euphratica]
Length=499

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT VS++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  22   AFIGVNIGTAVSDMPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQ  81

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  82   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  141

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  142  ASNLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYY  201

Query  686  EYVKSD  703
            +Y++S+
Sbjct  202  DYMQSN  207



>ref|XP_006378439.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56236.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=424

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  4    AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  63

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  64   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  123

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  124  ASNLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYY  183

Query  686  EYVKSD  703
            +Y++S+
Sbjct  184  DYMQSN  189



>emb|CDP00829.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
             F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI V V V N++
Sbjct  30   GFIGVNIGTDLSDMPDPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  89

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV AMN++  ALV
Sbjct  90   LLGIGQSNATAANWVSRNVIAHIPATNITAIAVGSEVLTTLPNAAPVLVAAMNFIQSALV  149

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL SQ+KVSTP S+ +I   FPPS A FN +    +  +L+FLQ+T S+ MLN YPYY
Sbjct  150  ASNLASQIKVSTPHSSSIILDSFPPSQAFFNRTLEPVMVPLLKFLQSTGSFLMLNVYPYY  209

Query  686  EYVKSD  703
            +YV+S+
Sbjct  210  DYVQSN  215



>ref|XP_006448191.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
 ref|XP_006469226.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Citrus sinensis]
 gb|ESR61431.1| hypothetical protein CICLE_v10014990mg [Citrus clementina]
Length=499

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N++
Sbjct  22   AFIGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNDQ  81

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NVAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H ALV
Sbjct  82   LLGIGQSNATAANWVARNVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSALV  141

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  142  AANLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  201

Query  686  EYVKSD  703
            +Y++S+
Sbjct  202  DYMQSN  207



>ref|XP_010271297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Nelumbo nucifera]
Length=495

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++P+   VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N E
Sbjct  21   AFIGVNIGTALSDMPNPTQVVALLKAQQIRHVRLYDADRAMLLALANTGIQVTVSVPNEE  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV AM ++H ALV
Sbjct  81   LLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSAMKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+  I   FPPS A FN S ++ +  +L+FLQ++ SY+MLN+YPYY
Sbjct  141  ASNLDDQIKVSTPHSSSFILDSFPPSQAFFNRSWDNVMVPMLKFLQSSGSYFMLNSYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_006378440.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|ERP56237.1| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=481

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  4    AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  63

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  64   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  123

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  124  ASNLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYY  183

Query  686  EYVKSD  703
            +Y++S+
Sbjct  184  DYMQSN  189



>ref|XP_002314794.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
 gb|EEF00965.2| hypothetical protein POPTR_0010s11880g [Populus trichocarpa]
Length=498

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLHALANTGIRVTVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTPQS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY
Sbjct  141  ASNLDGQIKVSTPQSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>gb|EMT28432.1| Glucan endo-1,3-beta-glucosidase 4 [Aegilops tauschii]
Length=695

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAFVGINIGT VS+LPSA D+V  LK  +I+HVRL D+D  ML AL+NTGIEV+VGV
Sbjct  19   NASGAFVGINIGTGVSDLPSASDIVSTLKTMKIQHVRLVDSDHQMLVALANTGIEVMVGV  78

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
             N+++L +GQS   A  WVNKNVAAY+P+TNIT IAVG EVLTS+PNAA VLVPA+ +L 
Sbjct  79   PNDQLLRVGQSRPAAVDWVNKNVAAYIPATNITYIAVGDEVLTSLPNAALVLVPALQFLQ  138

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNA  673
             AL++ANLN+QVK+S+P S D+I K FPPSTATFN + +S +   LQFL++T S +MLNA
Sbjct  139  SALLAANLNTQVKLSSPHSMDMIPKAFPPSTATFNSTWSSVMLPYLQFLKSTGSSFMLNA  198

Query  674  YPYYEYV  694
             PYY YV
Sbjct  199  QPYYSYV  205



>ref|XP_007045239.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY01071.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=498

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGTD+S++PS   VV LLKA+ IK+VRL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFVGVNIGTDLSDMPSPTQVVALLKAQSIKYVRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>gb|KDO64566.1| hypothetical protein CISIN_1g0108331mg, partial [Citrus sinensis]
Length=478

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N++
Sbjct  1    AFIGVNIGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNDQ  60

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV ++VAA++P+TNITAIAVGSEVLT +PNA PVLV A+ ++H ALV
Sbjct  61   LLGIGQSNATAANWVARHVAAHVPTTNITAIAVGSEVLTVLPNAGPVLVSALKFIHSALV  120

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  121  AANLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  180

Query  686  EYVKSD  703
            +Y++S+
Sbjct  181  DYMQSN  186



>gb|KFK41053.1| hypothetical protein AALP_AA2G079300 [Arabis alpina]
Length=498

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NTGI+VI+ + N+
Sbjct  24   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPND  83

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAPVLV A+  +H AL
Sbjct  84   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPVLVSAIKNIHSAL  143

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +S+NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  144  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPY  203

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  204  YDYMQSN  210



>ref|XP_011070588.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=499

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AFVG+NIGT +S++P    VV LLKA+QI+HVRL+D D  ML AL+N+GI VIV V N++
Sbjct  22   AFVGVNIGTALSDMPDPTQVVALLKAQQIRHVRLYDTDQAMLRALANSGIRVIVSVPNDQ  81

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV++N+ A++P+TNI+AIAVGSEVLT++PNAAPVLV AMN++H ALV
Sbjct  82   LLGIGQSNATAANWVSRNILAHVPATNISAIAVGSEVLTTLPNAAPVLVSAMNFIHSALV  141

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+S +KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S+ MLN YPYY
Sbjct  142  AANLDSHIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSFLMLNVYPYY  201

Query  686  EYVKSD  703
            +Y++++
Sbjct  202  DYMQAN  207



>gb|KHN00662.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=483

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD +N+PS  +VV LLKA+ I+HVRL+DAD  ML  L+NTGI VIV V N++
Sbjct  8    AFIGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVPNDQ  67

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  68   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  127

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY
Sbjct  128  AANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYY  187

Query  686  EYVKSD  703
            +Y++++
Sbjct  188  DYMQTN  193



>dbj|BAB01763.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=469

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +2

Query  185  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  364
            +P   D+V LLK++QI HVRL+DA++HML A +NT IEV+VGVTN E+L IG+  S AAA
Sbjct  1    MPPPSDIVTLLKSQQITHVRLYDANSHMLKAFANTSIEVMVGVTNEEILKIGRFPSAAAA  60

Query  365  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  544
            WVNKNVAAY+PSTNITAIAVGSEVLT+IP+ AP+L  A+N +HKALV++NLN +VKVS+P
Sbjct  61   WVNKNVAAYIPSTNITAIAVGSEVLTTIPHVAPILASALNNIHKALVASNLNFKVKVSSP  120

Query  545  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  703
             S D++ K FPPST+TF+ S N+TV+Q+LQFL+NT S++MLNAYPYY Y  ++
Sbjct  121  MSMDIMPKPFPPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGYTTAN  173



>ref|XP_003518194.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Glycine max]
Length=496

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD +N+PS  +VV LLKA+ I+HVRL+DAD  ML  L+NTGI VIV V N++
Sbjct  21   AFIGVNIGTDATNMPSPTEVVALLKAQGIQHVRLYDADRAMLRTLANTGIRVIVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY
Sbjct  141  AANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++++
Sbjct  201  DYMQTN  206



>ref|XP_007151812.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
 gb|ESW23806.1| hypothetical protein PHAVU_004G077000g [Phaseolus vulgaris]
Length=495

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTDV+N+PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N++
Sbjct  20   AFIGVNIGTDVTNMPSPTEVVTLLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQ  79

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLTS+ NAAPVLV A+ +L  ALV
Sbjct  80   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLTNAAPVLVSALKFLQAALV  139

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ ++   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  140  AANLDQQIKVSTPHSSSVMVNSFPPSQAFFNKSWDPVMVPLLKFLQSTGSYLMLNVYPYY  199

Query  686  EYVK  697
            +++K
Sbjct  200  DFMK  203



>gb|KJB30775.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=465

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>gb|KJB15377.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=439

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_008366987.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Malus domestica]
Length=498

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+N+GTD+S +PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V+V V N++
Sbjct  21   AFIGVNLGTDLSAMPSPTQVVALLKAQNIRHIRLYDADRTMLLALANTGIQVMVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            ++GIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  81   LIGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q++VSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY
Sbjct  141  ASNLDRQIRVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +YV+S+
Sbjct  201  DYVQSN  206



>ref|XP_004498268.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Cicer arietinum]
Length=496

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTDV+N+PS  + V LLKA+ I+HVRL+DAD  ML AL+ TGI+VIV V N+E
Sbjct  20   AYIGVNIGTDVTNMPSPTETVSLLKAQSIQHVRLYDADRSMLLALAKTGIQVIVSVPNDE  79

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++PSTNITAIAVGSEVLTS+PN APVLV A+ ++H ALV
Sbjct  80   LLGIGQSNATAANWVTRNVIAHVPSTNITAIAVGSEVLTSLPNVAPVLVSALQFIHSALV  139

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP ++ +I    PPS A FN + +  +  +L+FLQ+T SY MLN YPYY
Sbjct  140  AANLDQQIKVSTPLASSIILDXXPPSQAFFNRTWDPVMTPLLKFLQSTGSYLMLNVYPYY  199

Query  686  EYVKSD  703
            +Y +S+
Sbjct  200  DYRQSN  205



>gb|KHG06295.1| hypothetical protein F383_32557 [Gossypium arboreum]
Length=497

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_008775310.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X2 
[Phoenix dactylifera]
Length=445

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+N+GT +S++PS   VV LLK++QI+HVRL+DAD  +L+AL+NTGI V V V N+
Sbjct  19   GAYIGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPND  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H AL
Sbjct  79   QLLAVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPY
Sbjct  139  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLDPVIVPMLKFLQSTGSYLMLNVYPY  198

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  199  YDYMQSN  205



>gb|KJB30776.1| hypothetical protein B456_005G159100 [Gossypium raimondii]
Length=497

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A++G+NIGTD+S++P+  +VV LLKA++I+HVRL+DAD  ML AL+ TGI+V V V N++
Sbjct  21   AYIGVNIGTDLSDMPTPTEVVALLKAQRIRHVRLYDADQAMLLALAKTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +N+ A++P+TNITAIAVGSEVLT++PNAAP+LV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNIVAHVPATNITAIAVGSEVLTALPNAAPILVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_007160410.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32404.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=352

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIG D+S++P   ++V LLKA+ I+HVRL+DAD  +L AL+ TGI V V V N++
Sbjct  23   AFIGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQ  82

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  83   LLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  142

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVS+P S+ +I   FPPS A FN + N  +  +L+FLQ+T SY MLN YPYY
Sbjct  143  AANLDQQIKVSSPHSSSIILDSFPPSQAFFNRTWNPVMVPMLKFLQSTGSYLMLNVYPYY  202

Query  686  EYVKSD  703
            +Y +++
Sbjct  203  DYQQAN  208



>gb|EYU41109.1| hypothetical protein MIMGU_mgv1a005128mg [Erythranthe guttata]
Length=496

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++PS   VV LLK++QI+HVRL+D+D  ML AL+NTGI V V V N++
Sbjct  21   AFIGVNIGTSLSDMPSPTQVVSLLKSQQIRHVRLYDSDRAMLLALANTGIRVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IGQS+  AA WV++N+ ++ P+TNIT+I+VG+EVL+++PNAAPVL+PAM +LH ALV
Sbjct  81   LLAIGQSNLTAANWVSRNILSHYPATNITSISVGTEVLSTLPNAAPVLLPAMKFLHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL SQ+K+STP S+ +I   FPPS A FN + +  +  +LQFLQ+TNS+ MLN YPYY
Sbjct  141  AANLQSQIKLSTPHSSSIILDSFPPSQAFFNRTWDPLMVPLLQFLQSTNSFLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_010267790.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Nelumbo nucifera]
Length=495

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++P    VV LL+A+QI+HVRL+DAD  ML AL+NTGI V V V N++
Sbjct  20   AFIGVNIGTALSDMPDPTQVVALLRAQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQ  79

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LG+GQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  80   LLGVGQSNATAANWVARNVVAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  139

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L+FLQ+T SY MLN YPYY
Sbjct  140  ASNLDNQIKVSTPHSSSIILDSFPPSQAFFNHSWNPVMVPLLKFLQSTGSYLMLNVYPYY  199

Query  686  EYVKSD  703
            +Y++S+
Sbjct  200  DYMQSN  205



>ref|XP_010926119.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Elaeis guineensis]
Length=501

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+N+GT +S++PS   VV LLK+++I+HVRL+DAD  ML+AL+N+GI V V V N 
Sbjct  22   GAYIGVNVGTALSDMPSPTQVVALLKSQEIRHVRLYDADPAMLAALANSGIRVTVSVPNE  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAAP+LVPA+ Y+H AL
Sbjct  82   QLLAVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAAPLLVPAVRYVHSAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ Q+KVSTP S+ +I   FPPS A FN S    +  +L+FLQ+T SY MLN YPY
Sbjct  142  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLEPVMVPMLKFLQSTGSYLMLNVYPY  201

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  202  YDYMQSN  208



>ref|XP_008221445.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Prunus mume]
Length=513

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N++
Sbjct  36   AFIGVNLGTDLSDMPSPTQVVALLKAQNIRHIRLYDADRAMLLALANTGIQVTVSVPNDQ  95

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA W+ +NV A++P+TNIT+IAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  96   LLGIGQSNATAANWIARNVIAHVPATNITSIAVGSEVLSALPNAAPVLVSALKFIHSALV  155

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY
Sbjct  156  ASNLDRQIKVSTPHSSAIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYY  215

Query  686  EYVKSD  703
            +Y++S+
Sbjct  216  DYMQSN  221



>ref|XP_008775304.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Phoenix dactylifera]
Length=497

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+N+GT +S++PS   VV LLK++QI+HVRL+DAD  +L+AL+NTGI V V V N+
Sbjct  19   GAYIGVNLGTALSDMPSPTQVVALLKSQQIRHVRLYDADPAILAALANTGIRVTVSVPND  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV++NV  ++P+ NITA+AVGSEVLT++PNAAP++VPA+ Y+H AL
Sbjct  79   QLLAVGQSNATAANWVSRNVVGHVPAVNITAVAVGSEVLTALPNAAPLVVPALRYVHSAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPY
Sbjct  139  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLDPVIVPMLKFLQSTGSYLMLNVYPY  198

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  199  YDYMQSN  205



>gb|KJB15376.1| hypothetical protein B456_002G174100 [Gossypium raimondii]
Length=498

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>gb|KHG27056.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=509

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPYY
Sbjct  141  ASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_007141916.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
 gb|ESW13910.1| hypothetical protein PHAVU_008G236700g [Phaseolus vulgaris]
Length=498

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGIEV+V V N E
Sbjct  21   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIEVVVTVPNEE  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IGQS+S AA WV++NV A+ P+TNITAI VGS+VLTS+PNAA VLV A+ Y+H ALV
Sbjct  81   LLAIGQSNSTAANWVSRNVVAHYPATNITAICVGSDVLTSLPNAAKVLVSAIKYIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY
Sbjct  141  ASNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLDPLLDFLQSTGSYLMLNIYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMRSN  206



>ref|XP_006391369.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
 gb|ESQ28655.1| hypothetical protein EUTSA_v10018427mg [Eutrema salsugineum]
Length=506

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAF+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+VI+ + N+
Sbjct  32   GAFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADPGMLIALANTKIKVIISIPND  91

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+PNAAP+LV A+  +H AL
Sbjct  92   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLPNAAPILVNAIKNVHSAL  151

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +S+NL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  152  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPY  211

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  212  YDYMQSN  218



>ref|XP_008460531.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Cucumis 
melo]
Length=481

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = +2

Query  137  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  316
            F   FVG+NIGT++S +P    V  LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V + 
Sbjct  3    FADVFVGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIP  62

Query  317  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  496
            N ++LGIGQS+S AA WVN+NV A+ P+TNITAI+VG +VLT++PNAA +LV A+ Y+H 
Sbjct  63   NEQILGIGQSNSTAANWVNRNVLAHYPATNITAISVGFDVLTTLPNAAKILVNALKYVHS  122

Query  497  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  676
            ALV++NL+ Q+KVSTP S+ +I   FPPS A FN S +S +  +L FLQ+TNS+ MLN Y
Sbjct  123  ALVASNLDHQIKVSTPLSSSIILDSFPPSQAFFNASLDSVIVPLLGFLQSTNSFLMLNVY  182

Query  677  PYYEYVKSD  703
            PYY+Y++SD
Sbjct  183  PYYDYMQSD  191



>gb|KHG27055.1| hypothetical protein F383_08405 [Gossypium arboreum]
Length=556

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = +2

Query  137  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  316
            +  AF+G+NIGTD+S++PS   VV LLKA+ + HVRL+DAD  ML AL+NTGI+V + V 
Sbjct  65   YAEAFIGVNIGTDLSDMPSPTQVVALLKAQNVWHVRLYDADRAMLLALANTGIQVTISVP  124

Query  317  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  496
            N ++LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+  +H 
Sbjct  125  NEQLLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTALPNAAPVLVSALKLIHS  184

Query  497  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  676
            ALV++NL+SQ+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN Y
Sbjct  185  ALVASNLDSQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYLMLNVY  244

Query  677  PYYEYVKSD  703
            PYY+Y++S+
Sbjct  245  PYYDYMQSN  253



>ref|XP_004140301.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Cucumis sativus]
 gb|KGN51058.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=503

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            FVG+NIGT++S +P    V  LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V + N ++
Sbjct  29   FVGVNIGTELSVMPHPTQVAALLKAQQIRHVRLYDADGGMLMALANTGIQVMVTIPNEQI  88

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WVN+NV A+ P+TNITAI+VGS+VLT++PNAA +LV A+ Y+H ALV+
Sbjct  89   LGIGQSNSTAANWVNRNVLAHYPATNITAISVGSDVLTTLPNAAKILVNALKYIHSALVA  148

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L FLQ+TNS+ MLN YPYY+
Sbjct  149  SNLDHQIKVSTPLSSSIILDSFPPSQAFFNASLDPVIVPLLGFLQSTNSFLMLNVYPYYD  208

Query  689  YVKSD  703
            Y++SD
Sbjct  209  YMQSD  213



>ref|XP_002532062.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30317.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=436

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N  GAF+GINIGTDVSN+P A DVV +LK  QI HVRL+DADAHML AL+N+GIEV+VG+
Sbjct  20   NTGGAFIGINIGTDVSNMPPASDVVAILKTNQITHVRLYDADAHMLKALANSGIEVMVGI  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIG+S + AAAW+NKNVA+YLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGESPAAAAAWINKNVASYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  139

Query  494  KALVSANLNSQVK  532
            KALV++NLN Q K
Sbjct  140  KALVASNLNFQSK  152



>ref|XP_010066584.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Eucalyptus 
grandis]
 gb|KCW64517.1| hypothetical protein EUGRSUZ_G02118 [Eucalyptus grandis]
Length=499

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G F+G+NIGTD+SN+PS   VV LLKA+ I+HVRL+D D  ML AL+N+GI V V V N+
Sbjct  21   GPFIGVNIGTDLSNMPSPTQVVALLKAQNIRHVRLYDTDHAMLLALANSGIRVTVSVPND  80

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS++ AA WV +N+ A++P+TNIT IAVGSEVLT++ NAAPVLV AM ++H AL
Sbjct  81   QLLGIGQSNATAAYWVARNIVAHVPATNITVIAVGSEVLTTLQNAAPVLVSAMKFIHSAL  140

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++NL+S++KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T SY MLN YPY
Sbjct  141  VASNLDSRIKVSTPHSSSIIIDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSYLMLNVYPY  200

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  201  YDYMQSN  207



>ref|XP_010651370.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 isoform X2 [Vitis 
vinifera]
Length=431

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  266  MLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTS  445
            ML+AL+NTGIEV+VGVTN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTS
Sbjct  1    MLNALANTGIEVVVGVTNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTS  60

Query  446  IPNAAPVLVPAMNYLHKALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQ  625
            IP+AAPVLVPAMNYLHKALV++NLN Q+KVS PQS D+I + FPPSTATFN + NST++Q
Sbjct  61   IPHAAPVLVPAMNYLHKALVASNLNFQIKVSAPQSLDIIPRPFPPSTATFNSTWNSTIYQ  120

Query  626  ILQFLQNTNSYYMLNAYPYYEYVKSD  703
            +LQFL+NTNSY+MLNAYPYY Y   D
Sbjct  121  MLQFLKNTNSYFMLNAYPYYGYTNGD  146



>ref|XP_010553889.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Tarenaya 
hassleriana]
Length=500

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI+H+RL+D D  ML+AL+NTGI+V+V V N++
Sbjct  27   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDTDPGMLTALANTGIKVVVSVPNDQ  86

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV +N+ A+ P+TNITAIAVGS+VLT++PN +PVLV A+  +H AL+
Sbjct  87   LLGIGQSNSTAANWVKRNIIAHYPATNITAIAVGSDVLTTLPNVSPVLVNAIKNIHSALL  146

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            S+NL+ ++KVSTP ST LI   FPPS A FN S N  +  +L FLQ+T+SY MLN YPYY
Sbjct  147  SSNLDGRIKVSTPLSTSLILDPFPPSQAFFNRSWNPVLVPLLSFLQSTDSYLMLNVYPYY  206

Query  686  EYVKSD  703
            +Y++S+
Sbjct  207  DYMQSN  212



>ref|XP_002527772.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF34582.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=533

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            +F+G+N+GT +S++PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  21   SFIGVNVGTALSDMPSPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T SY+M+N YPYY
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTGSYFMINVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_004288596.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT +S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+VI+ V N+++
Sbjct  31   FIGVNIGTSLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVIISVPNDQI  90

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++NV A+ P+TNITAI+VGSEVLT++PN A +LV A+ Y+H ALV+
Sbjct  91   LGIGQSNSTAANWVSQNVVAHYPATNITAISVGSEVLTAVPNTAKILVSALKYIHSALVA  150

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+SQ+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+
Sbjct  151  SNLDSQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLSFLQSTGSFLMLNVYPYYD  210

Query  689  YVKSD  703
            Y++S+
Sbjct  211  YMQSN  215



>ref|XP_012072282.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Jatropha curcas]
 gb|KDP38099.1| hypothetical protein JCGZ_04742 [Jatropha curcas]
Length=498

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT +S++P+   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N +
Sbjct  21   AFIGVNIGTALSDMPNPTQVVALLKAQNIRHVRLYDADRAMLLALANTGIRVTVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV++NV A++P+TNIT IAVGSEVLT++PNAAPVL+ A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVSRNVIAHVPATNITGIAVGSEVLTTLPNAAPVLLSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +++FLQ+T SY+MLN YPYY
Sbjct  141  ASNLDDQIKVSTPHSSSIILDSFPPSQAFFNRTWDPVMVPLIKFLQSTGSYFMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_006372566.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ERP50363.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=481

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V V N++
Sbjct  7    AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNDQ  66

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y+  ALV
Sbjct  67   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKYIQSALV  126

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY
Sbjct  127  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLIPMLNFLQSTGSHLMLNIYPYY  186

Query  686  EYVKSD  703
            +Y++S+
Sbjct  187  DYMQSN  192



>ref|XP_003519328.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN41067.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V+V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVTVPNEEI  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>ref|XP_009351539.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Pyrus x bretschneideri]
Length=498

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A +G+N+GTDVS++PS   V  LLKA+ I+H+RL+DAD  ML AL+NTGI+V + V N +
Sbjct  21   AVIGVNLGTDVSDMPSPTQVAALLKAQNIRHIRLYDADRAMLLALANTGIQVTISVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIAVGSEVL+++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLSALPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPY+
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYF  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMRSN  206



>ref|XP_007160409.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
 gb|ESW32403.1| hypothetical protein PHAVU_002G319500g [Phaseolus vulgaris]
Length=498

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIG D+S++P   ++V LLKA+ I+HVRL+DAD  +L AL+ TGI V V V N++
Sbjct  23   AFIGVNIGLDISDIPGPTEIVALLKAQSIQHVRLYDADRALLRALAKTGIRVTVSVPNDQ  82

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++PSTNITAI VGSEVLT++PNAAP+LV A+N++H ALV
Sbjct  83   LLGIGQSNATAANWVTRNVIAHIPSTNITAICVGSEVLTTLPNAAPILVSAINFIHSALV  142

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVS+P S+ +I   FPPS A FN + N  +  +L+FLQ+T SY MLN YPYY
Sbjct  143  AANLDQQIKVSSPHSSSIILDSFPPSQAFFNRTWNPVMVPMLKFLQSTGSYLMLNVYPYY  202

Query  686  EYVKSD  703
            +Y +++
Sbjct  203  DYQQAN  208



>ref|XP_006575486.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=505

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V+V V N E+
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVVVTVPNEEI  89

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  90   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  149

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  150  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLNIYPYYD  209

Query  689  YVKSD  703
            Y++S+
Sbjct  210  YMQSN  214



>ref|XP_002887020.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63279.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G+++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NTGI+VI+ + N+
Sbjct  26   GSYIGVNIGTDLSDMPHPTQVVSLLKAQQIRHIRLYDADPGMLIALANTGIKVIISIPND  85

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  86   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  145

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +S+NL+  +KVSTP ST LI   FPPS A FN S NS +  +L FLQ+TNSY M+N YPY
Sbjct  146  LSSNLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNSVIVPLLSFLQSTNSYLMMNVYPY  205

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  206  YDYMQSN  212



>ref|XP_006596503.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=448

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVAVTVPNEEI  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>ref|XP_006858991.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4 [Amborella trichopoda]
 gb|ERN20458.1| hypothetical protein AMTR_s00068p00134210 [Amborella trichopoda]
Length=506

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 143/183 (78%), Gaps = 0/183 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G FVG+NIG D+S+ PSA+D+  LL++  + HVRLFDAD  +L+AL+ TGI+V VG+ N 
Sbjct  23   GGFVGVNIGMDLSSSPSAEDIAALLRSEGVTHVRLFDADRKLLAALAGTGIQVTVGIPNT  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            E+L IGQS S AAAWVN NVAA LP TNITAIAVGSEVLTS+PNAA +LVPA+  +H AL
Sbjct  83   ELLRIGQSPSAAAAWVNLNVAAQLPDTNITAIAVGSEVLTSLPNAALILVPALTNIHAAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V++ L+SQ+KVS+PQ+ D++ + FPPSTA+FN S    +  +L FL+ T + +MLNAYPY
Sbjct  143  VASALDSQIKVSSPQAMDIVVQFFPPSTASFNRSILPVLSLLLNFLEKTEAPFMLNAYPY  202

Query  683  YEY  691
            Y Y
Sbjct  203  YAY  205



>ref|XP_002531922.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF30466.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=508

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML AL+N+GI+V+V V N ++
Sbjct  33   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADRGMLVALANSGIQVMVSVPNEQL  92

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++NV A+ P+TNITAI+VGSE+L ++PNAAPVLV AM ++H ALV+
Sbjct  93   LGIGQSNSTAANWVSRNVVAHYPATNITAISVGSEILNTLPNAAPVLVNAMKFIHSALVA  152

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  153  SNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNVYPYYD  212

Query  689  YVKSD  703
            Y++S+
Sbjct  213  YMQSN  217



>ref|XP_004142367.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
sativus]
 gb|KGN52361.1| hypothetical protein Csa_5G628660 [Cucumis sativus]
Length=500

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG S++ AA WV++NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++  ALV
Sbjct  81   LLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSEVLTTLPNAAPVLVSALKFIQSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_002265396.3| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Vitis vinifera]
 emb|CBI33479.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI+HVRLF+A+  ML+AL+NTGI V V + N +
Sbjct  20   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLFNAEPAMLTALANTGIRVTVAIPNEQ  79

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            VLG+GQS+S AA WV++N+ A+ P+TNIT IA+GSEVLT++PNAAPVLV A+ ++H AL+
Sbjct  80   VLGVGQSNSTAANWVSRNIVAHYPATNITTIAIGSEVLTTLPNAAPVLVNALKFIHSALL  139

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY
Sbjct  140  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVMVPMLNFLQSTGSFLMLNIYPYY  199

Query  686  EYVKSD  703
            +Y++S+
Sbjct  200  DYMQSN  205



>gb|EPS61988.1| hypothetical protein M569_12804, partial [Genlisea aurea]
Length=418

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLK++QI+HVRL++AD  ML AL+ TGI+V V V N+E
Sbjct  1    AFIGVNIGTDLSDMPHPTQVVALLKSQQIRHVRLYNADRGMLVALAGTGIKVAVSVPNDE  60

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LG+GQS+S AA WV++NV A+ P+TNITA+ VGSEVLTS+PN APVLV A+ ++H ALV
Sbjct  61   LLGVGQSNSTAANWVSQNVVAHYPATNITAVCVGSEVLTSLPNLAPVLVDALKFIHSALV  120

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY+MLN YPY+
Sbjct  121  ASNLDGQIKVSSPLASSVILDSFPPSQAFFNRSWNHVLVPMLGFLQSTGSYFMLNVYPYF  180

Query  686  EYVKSD  703
            +YV+S+
Sbjct  181  DYVRSN  186



>ref|XP_011001568.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Populus euphratica]
Length=503

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V V N +
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQ  88

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T+IPNAAPVLV AM Y+  ALV
Sbjct  89   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTTIPNAAPVLVNAMKYIQSALV  148

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY
Sbjct  149  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLIPMLNFLQSTGSHLMLNIYPYY  208

Query  686  EYVKSD  703
            +Y++S+
Sbjct  209  DYMQSN  214



>ref|XP_003544983.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Glycine max]
 gb|KHN39465.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+ TGI+V V V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLLALAKTGIQVAVTVPNEEI  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S AA WV++NV A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNSTAANWVSRNVVAHYPATNITAICVGSEVLTTLPNAAKVLVSAIKYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPLLDFLQSTGSYLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>ref|XP_010511554.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010511555.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X2 [Camelina 
sativa]
Length=512

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAP+LV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPILVSAIKNVHAAL  154

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S NS +  +L FLQ+TNSY M+N YPY
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNSVIVPLLSFLQSTNSYLMMNVYPY  214

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  215  YDYMQSN  221



>emb|CDY58676.1| BnaCnng33550D [Brassica napus]
Length=504

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  29   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANSGIKVIITIPND  88

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  148

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL   +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  149  LSANLERLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPY  208

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  209  YDYMQSN  215



>ref|XP_004503127.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Cicer arietinum]
Length=498

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLK++QI+H+RL++AD  ML+ALS +GI+V++ V N+E+
Sbjct  22   FIGVNIGTDLSDMPHPTQVVALLKSQQIRHIRLYNADLAMLTALSKSGIQVVISVPNDEL  81

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S A  WV+ NV AY PSTNITAI VGSEVLT++PNAA +LV A+NY+H ALV+
Sbjct  82   LSIGQSNSTATKWVHNNVLAYYPSTNITAICVGSEVLTTLPNAAKLLVNALNYIHSALVA  141

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
              L+ Q+KVSTP  + +I   FPPS A FN S N  +  IL+FLQ+TNSY MLN YPYY+
Sbjct  142  LKLDRQIKVSTPLPSTVILDSFPPSQAFFNSSLNQVIIPILEFLQSTNSYLMLNIYPYYD  201

Query  689  YVKSD  703
            Y++S+
Sbjct  202  YMESN  206



>ref|XP_010415170.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Camelina 
sativa]
Length=512

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPY  214

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  215  YDYMQSN  221



>ref|XP_010470501.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Camelina sativa]
Length=510

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPY  214

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  215  YDYMQSN  221



>ref|XP_010470500.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Camelina sativa]
Length=512

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+NT I+VI+ V N+
Sbjct  35   GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLIALANTKIKVIISVPND  94

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  95   QLLGIGQSNSTAANWVKRNVIAHSPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHAAL  154

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  155  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMMNVYPY  214

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  215  YDYMQSN  221



>ref|XP_009388453.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=463

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +2

Query  176  VSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQ  355
            VSNLPSA D+V +LK +QIKHVRLFDA+  ML AL+NTGI+V++GV N+++L IG S S+
Sbjct  2    VSNLPSAADIVSILKTQQIKHVRLFDANHQMLGALANTGIDVMLGVPNDQLLRIGNSRSE  61

Query  356  AAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKV  535
            AA W+NKNVAA++P TNIT IAVG+E+LTSIPNAA VLVPAM +L  ALV++NLNSQVKV
Sbjct  62   AADWINKNVAAFVPETNITYIAVGNEILTSIPNAALVLVPAMQFLQSALVASNLNSQVKV  121

Query  536  STPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVK  697
            S+P S D+I K FPPSTATFN S NS + Q L FL+NT S  M+NA PYY Y+K
Sbjct  122  SSPLSMDMIPKSFPPSTATFNSSWNSVMSQYLLFLKNTGSPLMVNAQPYYGYIK  175



>ref|XP_011097437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Sesamum indicum]
Length=496

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLK +QI+H+RL++AD  ML AL+NTGI V + V N +
Sbjct  23   AFIGVNIGTDLSDMPHPTQVVALLKTQQIRHIRLYNADRGMLLALANTGIRVTISVPNEQ  82

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++NV A+ P+TNIT I VGSEVLTS+PN APVLV A+ Y+H ALV
Sbjct  83   LLGIGQSNSTAANWVSQNVVAHYPATNITTICVGSEVLTSLPNVAPVLVNALKYIHSALV  142

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP ++ +I   FPPS A FN S N  +  +L+FLQ+T+SY+MLN YPY+
Sbjct  143  ASNLDRQIKVSTPLASSIILDSFPPSQAFFNRSWNPVLVPMLKFLQSTDSYFMLNIYPYF  202

Query  686  EYVKSD  703
            +Y++S+
Sbjct  203  DYMQSN  208



>ref|XP_008452393.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Cucumis 
melo]
Length=500

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+N+GTD+S++PS   VV LLKA+ I+H+RL+DAD  ML AL+NTGI+V V V N++
Sbjct  21   AFIGVNLGTDLSDMPSPTQVVALLKAQNIEHIRLYDADRAMLLALANTGIQVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG S++ AA WV++NV A++P+TNITAIAVGS+VLT++PNAAPVLV A+ ++  ALV
Sbjct  81   LLAIGMSNATAANWVSRNVIAHVPATNITAIAVGSDVLTTLPNAAPVLVSALKFIQSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T+SY MLN YPYY
Sbjct  141  ASNLDRQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTDSYLMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_009382992.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+N+GT +SN+PS   V  LLK++QI++VRL+DAD  ML+AL+NTGI V V V N 
Sbjct  102  GAYIGVNVGTALSNMPSPTMVAALLKSQQIRNVRLYDADPAMLAALTNTGIRVTVSVPNE  161

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAAP+LVPA+ Y+H AL
Sbjct  162  QLLAVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAAPLLVPALRYIHSAL  221

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+  +KVSTP S+ LI   FPPS A FN +       +L+FLQ+T SY MLN YPY
Sbjct  222  VAANLDGVIKVSTPHSSSLILDSFPPSQAFFNRTLEPVFVPMLKFLQSTGSYLMLNVYPY  281

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  282  YDYLQSN  288



>ref|XP_009127476.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLK +QI+H+RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  29   GAYIGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPND  88

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  148

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  149  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPY  208

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  209  YDYMQSN  215



>emb|CDY16440.1| BnaA02g12440D [Brassica napus]
Length=504

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLK +QI+H+RL+DAD  ML AL+N+GI+VI+ + N+
Sbjct  28   GAYIGVNIGTDLSDMPHPTQVVALLKVQQIRHIRLYDADPGMLIALANSGIKVIITIPND  87

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITAI+VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  88   QLLGIGQSNSTAANWVKRNVIAHYPATTITAISVGSEVLTSLSNAAPVLVSAIKNVHSAL  147

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N  +  +L FLQ+TNSY M+N YPY
Sbjct  148  LSANLDRLIKVSTPLSTSLILDPFPPSQAFFNRSLNPVIVPLLSFLQSTNSYLMINVYPY  207

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  208  YDYMQSN  214



>ref|NP_001275288.1| glucan endo-1,3-beta-glucosidase 2-like precursor [Solanum tuberosum]
 gb|AFU52636.1| beta-1,3-glucanase 1 [Solanum tuberosum]
Length=498

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LG+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLA  144

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP ++ +I   FPPS A FN +    +  +L+FLQ+TNSY+MLN YPYY+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHTVKPVLIPLLKFLQSTNSYFMLNVYPYYD  204

Query  689  YVKSD  703
            Y++S+
Sbjct  205  YMQSN  209



>ref|XP_006364623.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum tuberosum]
Length=499

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LG+GQS++ AA WV +NV ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNVISHYPATNITTICVGSEVLSALPNAAPILVNALKFIHSALLA  144

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP ++ +I   FPPS A FN +    +  +L+FLQ+TNSY+MLN YPYY+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHTVKPVLIPLLKFLQSTNSYFMLNVYPYYD  204

Query  689  YVKSD  703
            Y++S+
Sbjct  205  YMQSN  209



>ref|XP_012086410.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Jatropha curcas]
Length=507

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    +V LLKA+QI+HVRL+DAD  ML AL+N+GI+V+V V N ++
Sbjct  32   FIGVNIGTELSDMPHPTQIVALLKAQQIRHVRLYDADRGMLIALANSGIQVMVSVPNEQL  91

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV+ NV A+ P+TNITAI+VGSE+LT++PNAAPVLV A+ Y+H ALV+
Sbjct  92   LGIGQSNSTAANWVSHNVVAHYPATNITAISVGSEILTTLPNAAPVLVNALKYIHSALVA  151

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY  LN YPYY+
Sbjct  152  SNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLTLNVYPYYD  211

Query  689  YVKSD  703
            Y++S+
Sbjct  212  YMQSN  216



>gb|KDP25782.1| hypothetical protein JCGZ_22504 [Jatropha curcas]
Length=500

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    +V LLKA+QI+HVRL+DAD  ML AL+N+GI+V+V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQIVALLKAQQIRHVRLYDADRGMLIALANSGIQVMVSVPNEQL  84

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV+ NV A+ P+TNITAI+VGSE+LT++PNAAPVLV A+ Y+H ALV+
Sbjct  85   LGIGQSNSTAANWVSHNVVAHYPATNITAISVGSEILTTLPNAAPVLVNALKYIHSALVA  144

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T SY  LN YPYY+
Sbjct  145  SNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLTLNVYPYYD  204

Query  689  YVKSD  703
            Y++S+
Sbjct  205  YMQSN  209



>gb|EYU45799.1| hypothetical protein MIMGU_mgv1a004953mg [Erythranthe guttata]
Length=503

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+NTGI V + + N++
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADRGMLLALANTGIRVAISIPNDQ  88

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++NVAA+ P+TNIT I VGSEV TS+PN  PVLV A+ Y+  ALV
Sbjct  89   ILGIGQSNSTAANWVSQNVAAHYPATNITTICVGSEVPTSLPNVGPVLVAALKYIQSALV  148

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ ++KVSTP  + +I   FPPS A FN + N  +  +L+FLQ+TNSY MLN YPYY
Sbjct  149  ASNLDRRIKVSTPLPSLMILDSFPPSQAFFNRTWNPVLIPLLKFLQSTNSYLMLNVYPYY  208

Query  686  EYVKSD  703
            +Y+KS+
Sbjct  209  DYMKSN  214



>ref|XP_007215258.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
 ref|XP_008227924.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Prunus mume]
 gb|EMJ16457.1| hypothetical protein PRUPE_ppa004534mg [Prunus persica]
Length=504

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V++ V N ++
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRAMLVALANTGIQVMISVPNEQI  89

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++NV A+ P+TNITAIAVGS+VLT++PNAA +LV A+ Y+  ALV+
Sbjct  90   LGIGQSNSTAANWVSQNVVAHYPATNITAIAVGSDVLTTLPNAAKILVNALKYIQSALVA  149

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+
Sbjct  150  SNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLTFLQSTGSFLMLNIYPYYD  209

Query  689  YVKSD  703
            Y++S+
Sbjct  210  YMQSN  214



>ref|XP_002305879.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE86390.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=491

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V+V V N +
Sbjct  15   AFIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIQVMVSVPNEQ  74

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV+ NV A+ P+TNITAI VGSEV T++PNAA VLV AM ++  ALV
Sbjct  75   LLGIGQSNSTAANWVSHNVVAHYPATNITAICVGSEVFTAVPNAASVLVNAMKFIQSALV  134

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN + N  +  +L FLQ+T S+ MLN YPYY
Sbjct  135  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNKTWNPVLIPMLNFLQSTGSHLMLNIYPYY  194

Query  686  EYVKSD  703
            +Y++S+
Sbjct  195  DYMQSN  200



>ref|XP_008361481.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Malus domestica]
Length=504

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+Q +HVRL+DAD  ML AL+NTGI+V++ V N ++
Sbjct  30   FIGVNIGTDLSDMPHPTQVVALLKAQQJRHVRLYDADRAMLVALANTGIKVMISVPNEQI  89

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS++ AA WV++NV A+ P+TNITAIAVGSEVLT++PNAA +LV A+ Y+  ALV+
Sbjct  90   LGIGQSNATAANWVSQNVVAHYPATNITAIAVGSEVLTTLPNAAKILVNALKYIQSALVA  149

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ+T S+ MLN YPYY+
Sbjct  150  SNLDRQIKVSTPLSSSIILDSFPPSQAFFNRSLNPVLVPMLSFLQSTGSFLMLNIYPYYD  209

Query  689  YVKSD  703
            Y++S+
Sbjct  210  YMQSN  214



>ref|XP_010108988.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
 gb|EXC20628.1| Glucan endo-1,3-beta-glucosidase 2 [Morus notabilis]
Length=497

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+N+GI+VIV + N +
Sbjct  21   AFIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLIALANSGIQVIVSIPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA VLV A+ Y++ ALV
Sbjct  81   LLGIGQSNSTAANWVSQNIVAHYPATNITAICVGSEVLTTLPNAAKVLVNALKYINSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S NS +  +L+FLQ++ SY MLN YPYY
Sbjct  141  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNSSWNSVLVPMLEFLQSSGSYLMLNIYPYY  200

Query  686  EYVKSD  703
            +Y++++
Sbjct  201  DYMQAN  206



>ref|XP_007163382.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
 gb|ESW35376.1| hypothetical protein PHAVU_001G230000g [Phaseolus vulgaris]
Length=498

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTGIKVAVSVPNEEI  81

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV++NV A+ P+TNIT+I VGSEVLT++PNAA VLV A+ ++H AL++
Sbjct  82   LAIGQSNTTAAKWVSRNVVAHYPATNITSICVGSEVLTALPNAAKVLVSALKFIHSALLA  141

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+K+STP S+ +I   FPPS A FN S N  +  +L+FLQ T SY MLN YPYY+
Sbjct  142  SNLDHQIKISTPLSSSMIFDSFPPSQAFFNRSLNPVLVPMLEFLQTTGSYLMLNTYPYYD  201

Query  689  YVKSD  703
            Y+KS+
Sbjct  202  YMKSN  206



>ref|XP_010324460.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Solanum lycopersicum]
Length=501

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LG+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLA  144

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP ++ +I   FPPS A FN S    +  +L+FLQ+TNSY+MLN YPYY+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHSVKPVLIPLLKFLQSTNSYFMLNVYPYYD  204

Query  689  YVKSD  703
            Y++S+
Sbjct  205  YMQSN  209



>ref|XP_004244387.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRLF+AD  ML AL+NTGI+V V V N ++
Sbjct  25   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLFNADRGMLLALANTGIKVAVSVPNEQI  84

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LG+GQS++ AA WV +N+ ++ P+TNIT I VGSEVL+++PNAAP+LV A+ ++H AL++
Sbjct  85   LGVGQSNTTAANWVTQNIISHYPATNITTICVGSEVLSALPNAAPILVNALKFVHSALLA  144

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP ++ +I   FPPS A FN S    +  +L+FLQ+TNSY+MLN YPYY+
Sbjct  145  SNLDRQIKVSTPLASTIILDSFPPSQAFFNHSVKPVLIPLLKFLQSTNSYFMLNVYPYYD  204

Query  689  YVKSD  703
            Y++S+
Sbjct  205  YMQSN  209



>ref|XP_006430586.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
 gb|ESR43826.1| hypothetical protein CICLE_v10011549mg [Citrus clementina]
Length=497

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N +
Sbjct  21   AFIGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ LI   FPPS A FN S N  +  +L FLQ+T S  MLN YPYY
Sbjct  141  ASNLDHQIKVSTPLSSSLILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSSLMLNIYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_006482110.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Citrus sinensis]
 gb|KDO50803.1| hypothetical protein CISIN_1g010931mg [Citrus sinensis]
Length=497

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+NTGI+V V V N +
Sbjct  21   AFIGANIGTELSDMPHPTQVVALLKAQQIRHVRLYDADRGMLVALANTGIKVAVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++N+ A+ P+TNIT I VGSEVLT++PNAAPVLV A+ ++H ALV
Sbjct  81   LLGIGQSNSTAANWVSRNIVAHYPATNITTICVGSEVLTTLPNAAPVLVNALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ LI   FPPS A FN S N  +  +L FLQ+T S  MLN YPYY
Sbjct  141  ASNLDHQIKVSTPLSSSLILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSSLMLNIYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_004490818.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Cicer arietinum]
Length=448

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+ +GI+V++ V N E+
Sbjct  23   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEEL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S NS +  IL FLQ+T+SY MLN YPYY+
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNSVLVPILDFLQSTDSYLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>gb|AES70967.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=491

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML+ALS +GI+V++ V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQVVISVPNEEL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A+NY+H ALV+
Sbjct  83   LAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNALNYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPY++
Sbjct  143  SNLDRQIKVSTPLPSTMILDSFPPSQAFFNTSMNQVLKPMLDFLQSTQSYLMLNVYPYHD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMESN  207



>ref|XP_008802448.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Phoenix dactylifera]
Length=500

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++PS   VV LLK+++I+HVR++DAD  ML+AL+N+GI V V V N 
Sbjct  22   GAYIGVNIGTALSDMPSPTQVVALLKSQKIQHVRMYDADPAMLAALANSGIRVTVSVPNE  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV++NV A++P+ NITA+AVGSEVLT++PNAA +LV A+ Y+H AL
Sbjct  82   QLLAVGQSNATAANWVSRNVVAHVPAVNITAVAVGSEVLTALPNAATLLVSALRYVHSAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ Q+KVSTP S+ +I   FPPS A FN S    +  +L+FLQ+T+SY MLN YPY
Sbjct  142  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLEPIMVPMLKFLQSTDSYLMLNVYPY  201

Query  683  YEYVKSD  703
            Y+Y+ S+
Sbjct  202  YDYMHSN  208



>ref|XP_003600716.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=504

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+QI+H+RL++AD  ML+ALS +GI+V++ V N E+
Sbjct  23   FIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYNADQAMLTALSKSGIQVVISVPNEEL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS+S A+ WV++NV AY P+TNITAI VGSEVLT++PN A VLV A+NY+H ALV+
Sbjct  83   LAIGQSNSTASNWVSRNVLAYYPATNITAICVGSEVLTTLPNVAKVLVNALNYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPY++
Sbjct  143  SNLDRQIKVSTPLPSTMILDSFPPSQAFFNTSMNQVLKPMLDFLQSTQSYLMLNVYPYHD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMESN  207



>ref|XP_004490817.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Cicer arietinum]
Length=498

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGT++S++P    VV LLKA+QI+HVRL+DAD  ML AL+ +GI+V++ V N E+
Sbjct  23   FIGVNIGTELSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALAKSGIQVVITVPNEEL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV++NV A+ P+TNITAI VGSEVLT++PN A VLV A+ Y+H ALV+
Sbjct  83   LAIGQSNASAANWVSRNVVAHYPATNITAICVGSEVLTTLPNVAKVLVNAIKYIHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ QVKVSTP S+ +I   FPPS A FN S NS +  IL FLQ+T+SY MLN YPYY+
Sbjct  143  SNLDRQVKVSTPLSSSIILDSFPPSQAFFNRSLNSVLVPILDFLQSTDSYLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>ref|XP_010681923.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            A +G+NIG D+S+ PS   VV LL+A+ I+ +RLFDAD  ML AL+NTGI+VIV V N +
Sbjct  26   ASLGVNIGLDLSDAPSPTQVVSLLRAQSIQQIRLFDADRAMLRALANTGIQVIVSVPNEQ  85

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +N+ +++P+TNITAIAVGSEVLT +PNA P+LV AM Y+H ALV
Sbjct  86   LLGIGQSNTTAANWVARNIVSHVPATNITAIAVGSEVLTVLPNAGPILVSAMQYIHSALV  145

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+S++KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T+S+ MLN YPYY
Sbjct  146  ASNLDSKIKVSTPHASSIILDSFPPSQAFFNRTWDPVMVPLLKFLQSTSSFLMLNVYPYY  205

Query  686  EYVKSD  703
            +Y++S+
Sbjct  206  DYMQSN  211



>ref|XP_007032976.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
 gb|EOY03902.1| Glucan endo-1,3-beta-glucosidase, putative isoform 2, partial 
[Theobroma cacao]
Length=481

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            ++G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+N+GI V+V + N ++
Sbjct  23   YIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  83   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ S+ MLN YPYY+
Sbjct  143  SNLDNQIKVSTPLSSSIILDSFPPSQAFFNRSWNQVLVPMLNFLQSSGSFLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>ref|XP_007032975.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY03901.1| Glucan endo-1,3-beta-glucosidase, putative isoform 1 [Theobroma 
cacao]
Length=498

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            ++G+NIGTD+S++P    VV LLKA+QI+HVRL++AD  ML AL+N+GI V+V + N ++
Sbjct  23   YIGVNIGTDLSDMPHPTQVVALLKAQQIRHVRLYNADKGMLVALANSGIRVMVSIPNEQL  82

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  83   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAAPLLVNAIKFVHSALVA  142

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL++Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ S+ MLN YPYY+
Sbjct  143  SNLDNQIKVSTPLSSSIILDSFPPSQAFFNRSWNQVLVPMLNFLQSSGSFLMLNIYPYYD  202

Query  689  YVKSD  703
            Y++S+
Sbjct  203  YMQSN  207



>gb|EPS65983.1| hypothetical protein M569_08793, partial [Genlisea aurea]
Length=459

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGT++S +P    VV LLKA+ ++HVR++ AD  ML AL+ TGI V+V V N+E
Sbjct  1    AFLGVNIGTELSEMPDPTQVVALLKAQHLQHVRIYGADRGMLMALAKTGIRVVVSVPNDE  60

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV+KNV AY P+TNITAIAVGSEVLT++PNAAP+LV A++++  AL 
Sbjct  61   LLGIGQSNSTAANWVSKNVLAYYPATNITAIAVGSEVLTALPNAAPILVSAVSFISSALR  120

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+S++KVSTP S+ +I   FPPS A FN S +  +  +L+ LQ+T S+ MLN YPYY
Sbjct  121  AANLDSRIKVSTPHSSSVILDSFPPSQAFFNRSLDPVMVPLLELLQSTGSFLMLNVYPYY  180

Query  686  EYVKSD  703
            +Y++++
Sbjct  181  DYMQAN  186



>ref|XP_010670126.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLK++ I+HVRL+DAD  ML AL+NTGI+V + V N +
Sbjct  23   AFLGVNIGTDLSDMPHPTQVVALLKSQHIRHVRLYDADKGMLVALANTGIQVAITVPNEQ  82

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV++ V A+ P+TNIT I VGSEVL++IPNAAP+LV A+ ++  ALV
Sbjct  83   LLGIGQSNSTAAKWVSQYVVAHYPATNITTICVGSEVLSTIPNAAPILVNALRFIQSALV  142

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL  Q+KVSTP ST +I   FPPS A FN S    +  + +FLQ+TNSY MLN YPYY
Sbjct  143  ASNLERQIKVSTPLSTSVILDSFPPSQAFFNHSLLPVLVPMFKFLQSTNSYLMLNIYPYY  202

Query  686  EYVKSD  703
            +Y+ S+
Sbjct  203  DYMNSN  208



>emb|CBI16509.3| unnamed protein product [Vitis vinifera]
Length=528

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 129/181 (71%), Gaps = 42/181 (23%)
 Frame = +2

Query  134  NFVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGV  313
            N +GAFVG+NIGTDVSNLPSA  +V +LKA QI HVRL+DADAHML+AL+NTGIEV+VGV
Sbjct  20   NALGAFVGVNIGTDVSNLPSASVLVGILKAHQITHVRLYDADAHMLNALANTGIEVVVGV  79

Query  314  TNNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLH  493
            TN EVLGIGQS S AA W+N+NVAAY+PSTNITAIAVGSEVLTSIP+AAPVLVPAMNYLH
Sbjct  80   TNEEVLGIGQSPSTAATWINRNVAAYVPSTNITAIAVGSEVLTSIPHAAPVLVPAMNYLH  139

Query  494  KALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYY-MLN  670
            KAL                                         +LQFL+NTNSY+ ML+
Sbjct  140  KAL-----------------------------------------MLQFLKNTNSYFIMLD  158

Query  671  A  673
            A
Sbjct  159  A  159



>gb|KCW69377.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=451

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+ I+H+RL++ D  +L+AL+NTGI+VIV V N ++
Sbjct  26   FIGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQL  85

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  86   LGIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVA  145

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ SY MLN YPYY+
Sbjct  146  SNLDRQIKVSTPLSSSVILDSFPPSQAFFNKSLNPVLVPMLNFLQSSGSYLMLNVYPYYD  205

Query  689  YVKSD  703
            Y++S+
Sbjct  206  YMQSN  210



>ref|XP_011007238.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X1 
[Populus euphratica]
 ref|XP_011007239.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Populus euphratica]
Length=505

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLKA+QI HVRL+DAD  ML AL+NTGI+V+V V N +
Sbjct  29   AFIGVNIGTDLSDMPHPTQVVALLKAQQIWHVRLYDADRGMLVALANTGIQVMVSVPNEQ  88

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS+S AA WV+ N+ A+ P+TNITAI VGSEV T++PNAA VLV AM ++  ALV
Sbjct  89   LLGIGQSNSTAANWVSHNIVAHYPATNITAICVGSEVFTAVPNAASVLVNAMKFIQSALV  148

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN + N  +  ++ FLQ+T S+ MLN YPYY
Sbjct  149  ASNLDRQIKVSTPLSSSIILDSFPPSQAFFNKTWNPVLIPMVNFLQSTGSHLMLNIYPYY  208

Query  686  EYVKSD  703
            +Y++S+
Sbjct  209  DYMQSN  214



>ref|XP_010062264.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2 [Eucalyptus grandis]
 gb|KCW69376.1| hypothetical protein EUGRSUZ_F02860 [Eucalyptus grandis]
Length=499

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIGTD+S++P    VV LLKA+ I+H+RL++ D  +L+AL+NTGI+VIV V N ++
Sbjct  26   FIGVNIGTDLSDMPHPTQVVALLKAQNIRHIRLYNTDRGILAALANTGIQVIVSVPNEQL  85

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+  + P+TNIT I+VGSEVLT++PNAAP+LV A+ ++H ALV+
Sbjct  86   LGIGQSNSTAANWVSQNIIVHYPATNITGISVGSEVLTALPNAAPILVNALKFIHSALVA  145

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ++ SY MLN YPYY+
Sbjct  146  SNLDRQIKVSTPLSSSVILDSFPPSQAFFNKSLNPVLVPMLNFLQSSGSYLMLNVYPYYD  205

Query  689  YVKSD  703
            Y++S+
Sbjct  206  YMQSN  210



>ref|XP_008777063.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X3 
[Phoenix dactylifera]
Length=504

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  22   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  82   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  140

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++A+L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PY
Sbjct  141  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPY  200

Query  683  YEYVKSD  703
            Y + K +
Sbjct  201  YGHTKGE  207



>ref|XP_006300850.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
 gb|EOA33748.1| hypothetical protein CARUB_v10019942mg, partial [Capsella rubella]
Length=641

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGTD+S++P    VV LLKA+QI+H+RL+DAD  ML AL+N+ I+VI+ + N+
Sbjct  163  GAYIGVNIGTDLSDMPHPTQVVALLKAQQIRHIRLYDADPGMLVALANSAIKVIISIPND  222

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T I AI+VGS+VLTS+ NAAPVLV A+  +H AL
Sbjct  223  QLLGIGQSNSTAANWVKRNVIAHYPATTIIAISVGSDVLTSLSNAAPVLVSAIKNVHAAL  282

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPY
Sbjct  283  LSANLDRLIKVSTPLSTALILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMMNVYPY  342

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  343  YDYMESN  349



>ref|XP_008777061.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X1 
[Phoenix dactylifera]
Length=507

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  25   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  84

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  85   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  143

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++A+L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PY
Sbjct  144  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPY  203

Query  683  YEYVKSD  703
            Y + K +
Sbjct  204  YGHTKGE  210



>ref|XP_008777062.1| PREDICTED: glucan endo-1,3-beta-glucosidase 4-like isoform X2 
[Phoenix dactylifera]
Length=505

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GAFVG+NI TDV NL SA+ +V +L+A+QIKHVRLFDAD  ML+AL+NTGIEV++G+ N+
Sbjct  25   GAFVGVNIRTDVFNLQSAEGIVSVLQAQQIKHVRLFDADHQMLNALANTGIEVMIGIPND  84

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++  IG S   AA W+NKN+A +LP+T+IT IAVG+EVLT+ P+AA +L+PAM +LH AL
Sbjct  85   QLPVIGNSQEAAADWINKNIADFLPATDITCIAVGNEVLTTTPDAA-LLLPAMQFLHSAL  143

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            ++A+L+ QVKVS+P S  +I K FPPSTATFN   NS + Q L FL+NT+S ++ NA+PY
Sbjct  144  LAADLHYQVKVSSPHSMLMIPKSFPPSTATFNLKWNSLMHQFLLFLKNTDSSFLFNAHPY  203

Query  683  YEYVKSD  703
            Y + K +
Sbjct  204  YGHTKGE  210



>ref|XP_011023912.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X1 [Populus 
euphratica]
Length=498

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
             F+G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  +L AL+NTGI V V V N++
Sbjct  21   GFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRALLLALANTGIRVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIA+GSE+LT+IPNAAPVLV A+ ++H ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAIGSEILTTIPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLNAYPYY
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNAYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_011023920.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 isoform X2 [Populus 
euphratica]
Length=488

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
             F+G+NIGT +S++PS   VV LLKA+ I+HVRL+DAD  +L AL+NTGI V V V N++
Sbjct  21   GFIGVNIGTALSDMPSPTQVVALLKAQNIRHVRLYDADRALLLALANTGIRVTVSVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV +NV A++P+TNITAIA+GSE+LT+IPNAAPVLV A+ ++H ALV
Sbjct  81   ILGIGQSNATAANWVARNVIAHVPATNITAIAIGSEILTTIPNAAPVLVSALKFIHSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLNAYPYY
Sbjct  141  ASNLDGQIKVSTPHSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNAYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>gb|KJB10513.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=550

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            ++G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  124  YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  183

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  184  LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVA  243

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  244  SNLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYD  303

Query  689  YVKSD  703
            Y++S+
Sbjct  304  YMQSN  308



>gb|KHG17836.1| hypothetical protein F383_07126 [Gossypium arboreum]
Length=519

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            ++G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  11   YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  70

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  71   LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFVHSALVA  130

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  131  SNLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYD  190

Query  689  YVKSD  703
            Y++S+
Sbjct  191  YMQSN  195



>ref|XP_009129217.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brassica rapa]
 emb|CDY09427.1| BnaA02g25830D [Brassica napus]
Length=497

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+++PS   VV LLK++ I  VRL+DAD  ML A ++TGI++I+ V N++
Sbjct  21   SLIGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY+
Sbjct  141  TANLDRQIKVSTPHASTIILDSFPPSQAFFNKTWDPVIVPLLEFLQSTGSPLMLNVYPYF  200

Query  686  EYVKSD  703
            +YV+S+
Sbjct  201  DYVQSN  206



>gb|KJB10512.1| hypothetical protein B456_001G204900 [Gossypium raimondii]
Length=599

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            ++G+NIGTD+S +P    VV LLKA+QI+H+RL+DAD  ML AL+N+GI V+V + N ++
Sbjct  124  YIGVNIGTDLSIMPHPTQVVALLKAQQIRHIRLYDADRGMLVALANSGIRVMVSIPNEQL  183

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            LGIGQS+S AA WV++N+ A+ P+TNITAI VGSEVLT++PNAA +LV AM ++H ALV+
Sbjct  184  LGIGQSNSTAANWVSRNIVAHYPATNITAICVGSEVLTTLPNAARILVNAMKFIHSALVA  243

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL++Q+KVS+P ++ +I   FPPS A FN S N  +  +L FLQ+T SY MLN YPYY+
Sbjct  244  SNLDNQIKVSSPLASSIILDSFPPSQAFFNRSWNPVLVPMLNFLQSTGSYLMLNIYPYYD  303

Query  689  YVKSD  703
            Y++S+
Sbjct  304  YMQSN  308



>ref|XP_009390355.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G ++G+N+GT +S++PS   V  LLK ++I HVRL+DAD  ML+AL+NTGI V V V N 
Sbjct  21   GPYIGVNVGTALSDMPSPTQVAALLKTQKIDHVRLYDADPAMLAALANTGIRVTVSVPNE  80

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV +NV A++P+ NITAIAVGSEVLT++PNAA +LVPA+ Y+H AL
Sbjct  81   QLLAVGQSNATAANWVARNVVAHVPAVNITAIAVGSEVLTALPNAATLLVPALRYIHSAL  140

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+  +KVSTP ++ +I   FPPS A FN +    +  +L+FLQ++ SY MLN YPY
Sbjct  141  VAANLDGLIKVSTPHASSVILDSFPPSQAFFNRTFEPVIVPMLKFLQSSGSYLMLNVYPY  200

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  201  YDYLQSN  207



>ref|XP_006395868.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33154.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=422

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N++
Sbjct  4    SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  63

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  64   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  123

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY+
Sbjct  124  TANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYPYF  183

Query  686  EYVKSD  703
            +YV+S+
Sbjct  184  DYVQSN  189



>ref|NP_176799.2| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
 sp|Q9C7U5.2|E132_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 2; AltName: Full=(1->3)-beta-glucan 
endohydrolase 2; Short=(1->3)-beta-glucanase 
2; AltName: Full=Beta-1,3-endoglucanase 2; Short=Beta-1,3-glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE34485.1| glucan endo-1,3-beta-glucosidase 2 [Arabidopsis thaliana]
Length=505

 Score =   204 bits (520),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G+++G+NIGTD+S++P    VV LLKA++I+H+RL++AD  +L AL+NTGI+VI+ + N+
Sbjct  29   GSYIGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPND  88

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAAL  148

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPY
Sbjct  149  LSANLDKLIKVSTPLSTSLILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMVNVYPY  208

Query  683  YEYVKSD  703
             +Y++S+
Sbjct  209  IDYMQSN  215



>emb|CDY59252.1| BnaA05g36990D [Brassica napus]
Length=408

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD++N+PS  D+V LLK+ QI HVRL+DA++HML ALSNT I+V VGVTN E
Sbjct  24   AFIGVNIGTDLTNMPSPSDIVSLLKSHQITHVRLYDANSHMLKALSNTTIQVTVGVTNQE  83

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IG+  S AA+WVNKNVAAY+PSTNITAIAVGSEVLT  P+ AP+L  A+N +HKALV
Sbjct  84   ILKIGRFPSSAASWVNKNVAAYVPSTNITAIAVGSEVLTESPHVAPILASALNNIHKALV  143

Query  506  SANLNSQVKVSTPQSTDLIAKIFPP  580
            + NLN QVKVSTP S D++ K FPP
Sbjct  144  ATNLNFQVKVSTPMSMDVMPKPFPP  168



>gb|ABI93926.1| At1g66250 [Arabidopsis thaliana]
Length=505

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            G+++G+NIGTD+S++P    VV LLKA++I+H+RL++AD  +L AL+NTGI+VI+ + N+
Sbjct  29   GSYIGVNIGTDLSDMPHPTQVVALLKAQEIRHIRLYNADPGLLIALANTGIKVIISIPND  88

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIGQS+S AA WV +NV A+ P+T ITA++VGSEVLTS+ NAAPVLV A+  +H AL
Sbjct  89   QLLGIGQSNSTAANWVKRNVIAHYPATMITAVSVGSEVLTSLSNAAPVLVSAIKNVHAAL  148

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            +SANL+  +KVSTP ST LI   FPPS A FN S N+ +  +L FLQ+TNSY M+N YPY
Sbjct  149  LSANLDKLIKVSTPLSTSLILDPFPPSQAFFNRSLNAVIVPLLSFLQSTNSYLMVNVYPY  208

Query  683  YEYVKSD  703
             +Y++S+
Sbjct  209  IDYMQSN  215



>ref|XP_011021801.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X3 
[Populus euphratica]
Length=465

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  185  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  364
            +PS   VV LLKA+ I+HVRL+DAD  ML AL+NTGI V V V N ++LGIGQS++ AA 
Sbjct  1    MPSPTQVVALLKAQNIRHVRLYDADRAMLRALANTGIRVTVSVPNEQLLGIGQSNATAAN  60

Query  365  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  544
            WV +NV A++P+TNITAIAVGSE+LT++PNAAPVLV A+ ++H ALV++NL+ Q+KVSTP
Sbjct  61   WVARNVIAHVPATNITAIAVGSEILTTLPNAAPVLVSALKFIHSALVASNLDGQIKVSTP  120

Query  545  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  703
            QS+ +I   FPPS A FN S +  +  +L+FLQ+T SY+MLN YPYY+Y++S+
Sbjct  121  QSSSIILDSFPPSQAFFNRSWDPVMVPLLKFLQSTGSYFMLNVYPYYDYMQSN  173



>emb|CDY48807.1| BnaC02g34070D [Brassica napus]
Length=497

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + VG+NIGT+V+++PS   VV LLK++ I  VRL+DAD  ML A ++TGI++I+ V N++
Sbjct  21   SLVGVNIGTEVTDMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQLIISVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNITAIAVGSEVLTS+PNAAPVLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITAIAVGSEVLTSLPNAAPVLVSALKYIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP ++ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY+
Sbjct  141  TANLDRQIKVSTPHASTIILDSFPPSQAFFNKTWDPVIVPLLEFLQSTGSPLMLNVYPYF  200

Query  686  EYVKSD  703
            +YV S+
Sbjct  201  DYVLSN  206



>gb|EMT05308.1| Glucan endo-1,3-beta-glucosidase 3 [Aegilops tauschii]
Length=500

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+A  +  LL+++ I+H+RL+DAD  MLSAL+NTGI VI+ V N 
Sbjct  23   GAYIGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVPNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  AL
Sbjct  83   QLLAIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQNAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A L+  +K+STP S+ +I   FPPS A FN S +  +  +L+FLQ+T +  MLN YPY
Sbjct  143  VAAALDKYIKISTPHSSSIILDSFPPSQAFFNRSLDPVLVPMLKFLQSTGAPLMLNVYPY  202

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  203  YDYMRSN  209



>ref|XP_003538392.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like [Glycine max]
Length=498

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEI  81

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA VLV A+ +LH ALV+
Sbjct  82   LAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAAKVLVSALKFLHSALVA  141

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ T+SY MLN YPYY+
Sbjct  142  SNLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFLQTTDSYLMLNIYPYYD  201

Query  689  YVKSD  703
            Y++S+
Sbjct  202  YMQSN  206



>gb|KHN17951.1| Glucan endo-1,3-beta-glucosidase 2 [Glycine soja]
Length=498

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEI  81

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV+ NV A+ P+TNIT I VGSEVLT++P AA VLV A+ +LH ALV+
Sbjct  82   LAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSEVLTTLPYAAKVLVSALKFLHSALVA  141

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ T+SY MLN YPYY+
Sbjct  142  SNLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFLQTTDSYLMLNIYPYYD  201

Query  689  YVKSD  703
            Y++S+
Sbjct  202  YMQSN  206



>ref|XP_006395869.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33155.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=483

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N++
Sbjct  4    SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  63

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  64   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  123

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY+
Sbjct  124  TANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYPYF  183

Query  686  EYVKSD  703
            +YV+S+
Sbjct  184  DYVQSN  189



>gb|ACN30650.1| unknown [Zea mays]
 gb|ACN31599.1| unknown [Zea mays]
 gb|ACR36210.1| unknown [Zea mays]
 gb|AFW89170.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=501

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+   +  LL+++ I+HVRL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A L+  +K+STP S+ +I   FPPS A FN S +S +  +L+FLQ+T S  MLN YPY
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFFNRSLDSVLVPMLKFLQSTGSPLMLNVYPY  202

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  203  YDYMRSN  209



>ref|NP_001150141.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
 gb|ACG38014.1| glucan endo-1,3-beta-glucosidase 3 precursor [Zea mays]
Length=501

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+   +  LL+++ I+HVRL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A L+  +K+STP S+ +I   FPPS A FN S +S +  +L+FLQ+T S  MLN YPY
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFFNRSLDSVLVPMLKFLQSTGSPLMLNVYPY  202

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  203  YDYMRSN  209



>ref|XP_003558472.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Brachypodium distachyon]
Length=498

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+   +  LL+++ I+H+RL+DAD  MLSAL+NTGI VIV V N 
Sbjct  22   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHIRLYDADPAMLSALANTGIRVIVSVPNE  81

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++LGIG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PA+ +L  AL
Sbjct  82   QLLGIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAVRFLQNAL  141

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A+L+  +KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T +  MLN YPY
Sbjct  142  VAASLDRFIKVSTPHSSSIILDSFPPSQAFFNRSLDPVLVPLLKFLQSTGAPLMLNVYPY  201

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  202  YDYMRSN  208



>ref|XP_006395867.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
 gb|ESQ33153.1| hypothetical protein EUTSA_v10004013mg [Eutrema salsugineum]
Length=516

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TGI+VI+ V N++
Sbjct  37   SLIGVNIGTEVTNMPSPTQVVTLLKSQNINRVRLYDADRSMLLAFAHTGIQVIISVPNDQ  96

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLT++PNAA VLV A+ Y+  AL+
Sbjct  97   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTTLPNAASVLVSALKYIQSALI  156

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  MLN YPY+
Sbjct  157  TANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLMLNVYPYF  216

Query  686  EYVKSD  703
            +YV+S+
Sbjct  217  DYVQSN  222



>emb|CDP01635.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P    VV LLK +QI++VRL++AD  ML AL+NTGI+V V V N +
Sbjct  21   AFIGVNIGTDLSDMPDPTQVVALLKKQQIRYVRLYNADRGMLLALANTGIKVAVSVPNEQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +L IGQS+S AA WV++NV ++ P+TNIT + VGSEV TS+PNAAP+LV A+ ++  ALV
Sbjct  81   LLAIGQSNSTAANWVSQNVVSHYPATNITTVCVGSEVFTSLPNAAPILVNALRFIQSALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            ++NL+ Q+KVSTP  + +I   FPPS A FN S N  +  +L FLQ+T SY+MLN YPYY
Sbjct  141  ASNLDRQIKVSTPLPSSIILDPFPPSQAFFNHSLNRVLVPMLSFLQSTGSYFMLNVYPYY  200

Query  686  EYVKSD  703
            +Y++S+
Sbjct  201  DYMQSN  206



>ref|XP_002468258.1| hypothetical protein SORBIDRAFT_01g042560 [Sorghum bicolor]
 gb|EER95256.1| hypothetical protein SORBIDRAFT_01g042560 [Sorghum bicolor]
Length=502

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+   +  LL+++ I+HVRL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ PNAAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPNAAPLLMPAMRYLQNAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A L+  +K+STP S+ +I   FPPS A FN S ++ +  +L+FLQ+T S  MLN YPY
Sbjct  143  VAAALDRYIKISTPHSSSIILDSFPPSQAFFNRSLDNVLVPMLKFLQSTGSPLMLNVYPY  202

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  203  YDYMRSN  209



>ref|XP_010916186.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform X1 
[Elaeis guineensis]
Length=497

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G NIGT +S++PS   VV LLK++QI+HVRL+DADA ML+AL+NTGI V V V N+
Sbjct  19   GAYIGANIGTALSDMPSPTQVVALLKSQQIRHVRLYDADAAMLAALANTGIRVTVSVPND  78

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L +GQS++ AA WV +NV A++P+ NITA+AVGSEVLT++PNAAP+LVPA+ Y+H AL
Sbjct  79   QLLAVGQSNATAANWVARNVVAHVPTVNITAVAVGSEVLTALPNAAPLLVPALRYVHSAL  138

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+ANL+ Q+KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T SY MLN YPY
Sbjct  139  VAANLDRQIKVSTPHSSSIILDSFPPSQAFFNRSLDPVISPMLKFLQSTGSYLMLNVYPY  198

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  199  YDYMQSN  205



>emb|CAN82488.1| hypothetical protein VITISV_006804 [Vitis vinifera]
Length=466

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  185  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  364
            +P+   VV LLK++QI+HVRL+DAD  ML AL+NTGI V V V N+++LGIGQS++ AA 
Sbjct  1    MPNPTQVVALLKSQQIRHVRLYDADRAMLLALANTGIRVTVSVPNDQLLGIGQSNATAAN  60

Query  365  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  544
            WV +NV A++P+TNITAIAVGSEVLT++PNAAPVLV A+ ++H ALV+ANL+SQ+KVSTP
Sbjct  61   WVARNVLAHIPATNITAIAVGSEVLTTLPNAAPVLVSALKFIHSALVAANLDSQIKVSTP  120

Query  545  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  703
             S+ ++   FPPS A FN S    +  +L+FLQ+T+SY MLN YPYY+Y++S+
Sbjct  121  HSSSILLDSFPPSQAFFNRSWEPVMVPLLKFLQSTSSYLMLNVYPYYDYMQSN  173



>gb|KHN32747.1| Glucan endo-1,3-beta-glucosidase 3 [Glycine soja]
Length=463

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +2

Query  185  LPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEVLGIGQSSSQAAA  364
            +PS  +VV LLKA+ I+HVRL+DAD  ML AL+NTGI VIV V N+++LGIGQS++ AA 
Sbjct  1    MPSPTEVVALLKAQGIQHVRLYDADRAMLRALANTGIRVIVSVPNDQILGIGQSNATAAN  60

Query  365  WVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVSANLNSQVKVSTP  544
            WV +NV A++P+TNITAIAVGSEVLTS+PNAAPVLV A+ ++  ALV+ANL+ Q+KVSTP
Sbjct  61   WVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALVAANLDQQIKVSTP  120

Query  545  QSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYEYVKSD  703
             S+ +I   FPPS A FN + +  +  +L FLQ+T SY MLN YPYY+Y++S+
Sbjct  121  HSSSVILDSFPPSQAFFNKTWDPVMVPLLNFLQSTGSYLMLNVYPYYDYMQSN  173



>ref|XP_006602009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 2-like isoform X2 
[Glycine max]
Length=438

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 139/185 (75%), Gaps = 0/185 (0%)
 Frame = +2

Query  149  FVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNEV  328
            F+G+NIG D+S++P    VV LLKA+QI+HVRL+DAD  ML AL+NT I+V V V N E+
Sbjct  22   FIGVNIGRDLSDMPHPTQVVALLKAQQIRHVRLYDADQAMLIALANTRIQVAVSVPNQEI  81

Query  329  LGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALVS  508
            L IGQS++ AA WV+ NV A+ P+TNIT I VGS+VLT++P AA VLV A+ ++H ALV+
Sbjct  82   LAIGQSNTTAAKWVSHNVIAHYPATNITTICVGSDVLTTLPYAAKVLVSALKFIHSALVA  141

Query  509  ANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYYE  688
            +NL+ Q+KVSTP S+ +I   FPPS A FN S N  +  +L FLQ T SY MLN YPYY+
Sbjct  142  SNLDHQIKVSTPLSSSMILDSFPPSQAFFNRSLNPVLVPMLDFLQTTGSYLMLNIYPYYD  201

Query  689  YVKSD  703
            Y++S+
Sbjct  202  YMQSN  206



>gb|EMS47617.1| Glucan endo-1,3-beta-glucosidase 3 [Triticum urartu]
Length=529

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = +2

Query  137  FVGAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVT  316
            F  A++G+NIGT +S++P+A  +  LL+++ I+H+RL+DAD  MLSAL+NTGI VI+ V 
Sbjct  50   FDWAYIGVNIGTAMSSVPAATQITTLLRSQNIRHIRLYDADPGMLSALANTGIRVIISVP  109

Query  317  NNEVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHK  496
            N ++L IG S++ AA WV +NVAA+ PS NITAIAVGSEVL+++PNAAP+++PAM YL  
Sbjct  110  NEQLLAIGNSNATAAKWVARNVAAHYPSVNITAIAVGSEVLSTLPNAAPLIMPAMRYLQN  169

Query  497  ALVSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAY  676
            ALV+A L+  +K+STP S+ +I   FPPS A FN S +  +  +L+FLQ+T +  MLN Y
Sbjct  170  ALVAAALDKYIKISTPHSSSIILDSFPPSQAFFNRSLDPVLVPMLKFLQSTGAPLMLNVY  229

Query  677  PYYEYVKSD  703
            PYY+Y++S+
Sbjct  230  PYYDYMRSN  238



>ref|XP_006293165.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
 gb|EOA26063.1| hypothetical protein CARUB_v10019481mg [Capsella rubella]
Length=500

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N++
Sbjct  21   SLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  ALV
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAALV  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YPY+
Sbjct  141  TANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYF  200

Query  686  EYVKSD  703
            +YV+S+
Sbjct  201  DYVQSN  206



>ref|NP_001130376.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF78568.1| unknown [Zea mays]
 gb|ACR36311.1| unknown [Zea mays]
 tpg|DAA44125.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=502

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = +2

Query  143  GAFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNN  322
            GA++G+NIGT +S++P+   +  LL+++ I+HVRL+DAD  ML+ALSNTGI VIV V N 
Sbjct  23   GAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDADPAMLAALSNTGIRVIVSVPNE  82

Query  323  EVLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKAL  502
            ++L IG S++ AA WV +NVAA+ P+ NITAIAVGSEVL++ P+AAP+L+PAM YL  AL
Sbjct  83   QLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEVLSAQPSAAPLLMPAMRYLQNAL  142

Query  503  VSANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPY  682
            V+A L+  +KVSTP S+ +I   FPPS A FN S +  +  +L+FLQ+T S  MLN YPY
Sbjct  143  VAAALDRYIKVSTPHSSSIILDSFPPSQAFFNRSLDGVLVPMLRFLQSTGSPLMLNVYPY  202

Query  683  YEYVKSD  703
            Y+Y++S+
Sbjct  203  YDYMRSN  209



>gb|AIR93909.1| glucanase [Cicer arietinum]
Length=454

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            AF+G+NIGTD+S++P+  + V LLKA+ I+HVRLFDAD  +L AL+NTGI V + V N++
Sbjct  25   AFIGVNIGTDLSDMPTPTETVALLKAQSIQHVRLFDADRALLLALANTGIRVTISVPNDQ  84

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGIGQS++ AA WV++NV A++P+TNIT+IAVGSEVLT++ NAAP+LV AM ++H ALV
Sbjct  85   ILGIGQSNATAANWVSRNVIAHVPATNITSIAVGSEVLTTLSNAAPILVSAMKFIHSALV  144

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + N  +  +L FLQ+T SY M N YPYY
Sbjct  145  AANLDGQIKVSTPHSSSIILDSFPPSQAFFNRTWNPVMVPLLNFLQSTGSYLMFNVYPYY  204

Query  686  EYVKSD  703
            +Y +S+
Sbjct  205  DYQQSN  210



>ref|XP_002876767.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53026.1| hypothetical protein ARALYDRAFT_484077 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  146  AFVGINIGTDVSNLPSAKDVVELLKARQIKHVRLFDADAHMLSALSNTGIEVIVGVTNNE  325
            + +G+NIGT+V+N+PS   VV LLK++ I  VRL+DAD  ML A ++TG++VI+ V N++
Sbjct  21   SLIGVNIGTEVTNMPSPTQVVALLKSQNINRVRLYDADRSMLLAFAHTGVQVIISVPNDQ  80

Query  326  VLGIGQSSSQAAAWVNKNVAAYLPSTNITAIAVGSEVLTSIPNAAPVLVPAMNYLHKALV  505
            +LGI QS++ AA WV +NVAAY P+TNIT IAVGSEVLTS+PNAA VLV A+ Y+  AL+
Sbjct  81   LLGISQSNATAANWVTRNVAAYYPATNITTIAVGSEVLTSLPNAASVLVSALKYIQAALI  140

Query  506  SANLNSQVKVSTPQSTDLIAKIFPPstatfnfssnstVFQILQFLQNTNSYYMLNAYPYY  685
            +ANL+ Q+KVSTP S+ +I   FPPS A FN + +  +  +L+FLQ+T S  +LN YPY+
Sbjct  141  TANLDRQIKVSTPHSSTIILDSFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYF  200

Query  686  EYVKSD  703
            +YV+S+
Sbjct  201  DYVQSN  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394