BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6754

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625334.1|  PREDICTED: serine/threonine protein phosphat...  68.6    5e-10   Nicotiana tomentosiformis
ref|XP_009762462.1|  PREDICTED: serine/threonine protein phosphat...  63.2    3e-08   Nicotiana sylvestris
ref|XP_009762455.1|  PREDICTED: serine/threonine protein phosphat...  63.2    3e-08   Nicotiana sylvestris
ref|XP_009762457.1|  PREDICTED: serine/threonine protein phosphat...  63.2    3e-08   Nicotiana sylvestris
ref|XP_004231808.1|  PREDICTED: serine/threonine protein phosphat...  59.3    5e-07   Solanum lycopersicum
ref|XP_009772668.1|  PREDICTED: serine/threonine protein phosphat...  58.5    1e-06   Nicotiana sylvestris
ref|XP_009590023.1|  PREDICTED: serine/threonine protein phosphat...  58.2    1e-06   Nicotiana tomentosiformis
ref|XP_006357177.1|  PREDICTED: serine/threonine protein phosphat...  57.8    2e-06   Solanum tuberosum [potatoes]
ref|XP_010317069.1|  PREDICTED: serine/threonine protein phosphat...  56.2    5e-06   Solanum lycopersicum
ref|XP_006338659.1|  PREDICTED: serine/threonine protein phosphat...  55.5    9e-06   Solanum tuberosum [potatoes]
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...  55.5    1e-05   Gossypium arboreum [tree cotton]
gb|KJB40702.1|  hypothetical protein B456_007G074200                  55.5    1e-05   Gossypium raimondii
emb|CDP16651.1|  unnamed protein product                              55.1    2e-05   Coffea canephora [robusta coffee]
ref|XP_011097329.1|  PREDICTED: serine/threonine protein phosphat...  52.4    1e-04   Sesamum indicum [beniseed]



>ref|XP_009625334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSADNRDGG+STF  NAS+SSRS DLS  RSGSL+ATSL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSADNRDGGSSTFQSNASNSSRSVDLSSSRSGSLSATSLSGVTGSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_009762462.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Nicotiana sylvestris]
Length=440

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSADNRDGG STF  NAS+SSRS+DLS  RSGSL+ATSL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSADNRDGGGSTFQSNASNSSRSADLSSSRSGSLSATSLSGVTGSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_009762455.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Nicotiana 
sylvestris]
Length=524

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSADNRDGG STF  NAS+SSRS+DLS  RSGSL+ATSL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSADNRDGGGSTFQSNASNSSRSADLSSSRSGSLSATSLSGVTGSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_009762457.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Nicotiana 
sylvestris]
Length=524

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSADNRDGG STF  NAS+SSRS+DLS  RSGSL+ATSL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSADNRDGGGSTFQSNASNSSRSADLSSSRSGSLSATSLSGVTGSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_004231808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315939.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315940.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315942.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315943.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
Length=523

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSA+NRDGG+S  P NAS+ SRSSDLS  +SG+ +AT+++GV S S
Sbjct  1    MIKQILNRLPRKPSKSAENRDGGSSASPSNASTGSRSSDLSTAQSGNSSATTVSGVTS-S  59

Query  661  TAG  669
            T G
Sbjct  60   TLG  62



>ref|XP_009772668.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772669.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772670.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
Length=524

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQ+LNRLP+KPSKSADNRDGG+S  P NAS+SSRSSDLS  RSG+ +AT+++GV S+S
Sbjct  1    MIKQLLNRLPKKPSKSADNRDGGSSASPSNASTSSRSSDLSSSRSGNSSATTVSGVTSSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_009590023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590024.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590025.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590026.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQ+LNRLP+KPSKSADNRDGG+S  P NAS+SSRSSDLS  R+G+ +AT+++GV S+S
Sbjct  1    MIKQLLNRLPKKPSKSADNRDGGSSASPSNASTSSRSSDLSSSRTGNSSATTVSGVTSSS  60

Query  661  TAG  669
            T G
Sbjct  61   TPG  63



>ref|XP_006357177.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Solanum tuberosum]
Length=524

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKS DNRDGGTS F  NAS+SSRSSDLS    GSL+A SL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSGDNRDGGTSAFQSNASNSSRSSDLSNSLPGSLSALSLSGVTGSS  60

Query  661  TAG  669
              G
Sbjct  61   APG  63



>ref|XP_010317069.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Solanum lycopersicum]
Length=524

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKS DNRDGGTS F  NAS+SSRSSDLS  R G+L+A SL+GV  +S
Sbjct  1    MIKQILNRLPRKPSKSGDNRDGGTSAFQSNASNSSRSSDLSNSRPGNLSAPSLSGVTGSS  60

Query  661  TAG  669
              G
Sbjct  61   APG  63



>ref|XP_006338659.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Solanum tuberosum]
 ref|XP_006338660.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Solanum tuberosum]
 ref|XP_006338661.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Solanum tuberosum]
Length=520

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIKQILNRLPRKPSKSA+NRDGG+S  P NAS+SSRSSDLS  +SG+ +AT+++GV S S
Sbjct  1    MIKQILNRLPRKPSKSAENRDGGSSASPSNASTSSRSSDLSTAQSGNSSATTVSGVTS-S  59

Query  661  TAG  669
            T G
Sbjct  60   TLG  62



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNA  573
            MIKQILNRLPRKPSKS+DNR+GGTST   NA
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNA  31



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNA  573
            MIKQILNRLPRKPSKS+DNR+GGTST   NA
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNA  31



>emb|CDP16651.1| unnamed protein product [Coffea canephora]
Length=521

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLA  642
            MIKQILNRLPRKPSKSA+ RDGG  TF  NAS+SSR++DLS  RSG+ NATSLA
Sbjct  1    MIKQILNRLPRKPSKSAEGRDGGPPTFSSNASTSSRNNDLSNSRSGNSNATSLA  54



>ref|XP_011097329.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=524

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  481  MIKQILNRLPRKPSKSADNRDGGTSTFPPNAssssrssdlsglrsgslNATSLAGVNSNS  660
            MIK ILN+LPRK +K  D+RDGG+ST+P NAS++SRSS   G RSG+ N T   G+NS S
Sbjct  1    MIKNILNKLPRKQTKLVDHRDGGSSTYPSNASTTSRSSYAVGSRSGNSNTTIGPGINSTS  60

Query  661  TAG  669
             +G
Sbjct  61   NSG  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1105426564043