BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6701

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10040.1|  unnamed protein product                              65.5    7e-09   Coffea canephora [robusta coffee]
ref|XP_008237585.1|  PREDICTED: uncharacterized protein LOC103336322  65.1    9e-09   Prunus mume [ume]
ref|XP_007200864.1|  hypothetical protein PRUPE_ppa1027145mg          64.7    1e-08   Prunus persica
gb|KJB28996.1|  hypothetical protein B456_005G079200                  63.2    3e-08   Gossypium raimondii
ref|XP_012066019.1|  PREDICTED: uncharacterized protein LOC105629112  55.5    1e-05   Jatropha curcas
ref|XP_008441519.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.1    2e-05   
gb|KDP42996.1|  hypothetical protein JCGZ_25182                       55.1    2e-05   Jatropha curcas
ref|XP_003536428.1|  PREDICTED: uncharacterized protein LOC100812134  54.3    3e-05   Glycine max [soybeans]
ref|XP_002532431.1|  transcription factor, putative                   53.9    5e-05   Ricinus communis
ref|XP_010241711.1|  PREDICTED: uncharacterized protein LOC104586241  53.9    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004140967.1|  PREDICTED: uncharacterized protein LOC101203313  53.5    6e-05   Cucumis sativus [cucumbers]
ref|XP_006434454.1|  hypothetical protein CICLE_v10001142mg           53.1    1e-04   Citrus clementina [clementine]
ref|XP_006473052.1|  PREDICTED: uncharacterized protein LOC102612442  53.1    1e-04   Citrus sinensis [apfelsine]
ref|XP_007019480.1|  Sequence-specific DNA binding transcription ...  52.8    1e-04   
ref|XP_009368513.1|  PREDICTED: uncharacterized protein LOC103958014  52.0    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_007143533.1|  hypothetical protein PHAVU_007G079600g           51.6    3e-04   Phaseolus vulgaris [French bean]
ref|XP_011074759.1|  PREDICTED: uncharacterized protein LOC105159405  50.8    4e-04   Sesamum indicum [beniseed]



>emb|CDP10040.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 5/53 (9%)
 Frame = +2

Query  593  MEGNISSGNMIPGS-SYGGLDLQGSMRVHHHQQHPVGLH----PHPRQGSMVH  736
            MEGN++SG+M+PG+ S+GGLDLQGSMR+HH Q +P  LH     H RQGSM H
Sbjct  1    MEGNLASGSMMPGNGSFGGLDLQGSMRIHHQQPNPFSLHQHNQSHSRQGSMAH  53



>ref|XP_008237585.1| PREDICTED: uncharacterized protein LOC103336322 [Prunus mume]
Length=445

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGL---HPHPRQGSMVH  736
            MEG++S G M+PG +SYGGLDL+GSMRV H  QHP  +   HPHPRQGS+ H
Sbjct  1    MEGHLSQGGMVPGGASYGGLDLEGSMRVQHQTQHPHTIHQHHPHPRQGSLAH  52



>ref|XP_007200864.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
 gb|EMJ02063.1| hypothetical protein PRUPE_ppa1027145mg [Prunus persica]
Length=445

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 4/52 (8%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGL---HPHPRQGSMVH  736
            MEG++S G M+PG +SYGGLDL+GSMRV H  QHP  +   HPHPRQGS+ H
Sbjct  1    MEGHLSQGGMVPGGASYGGLDLEGSMRVQHQTQHPHTIHQHHPHPRQGSLAH  52



>gb|KJB28996.1| hypothetical protein B456_005G079200 [Gossypium raimondii]
Length=447

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 5/54 (9%)
 Frame = +2

Query  593  MEGNISSGNMIPGS-SYGGLDLQGSMRVHHHQQHPVGL----HPHPRQGSMVHS  739
            MEGN+S G MIPG  S+GGLDLQGSMRVH+H Q+P  +    HP+PRQG+ +H+
Sbjct  1    MEGNLSQGGMIPGGGSFGGLDLQGSMRVHNHAQNPHSIHQHHHPNPRQGASLHA  54



>ref|XP_012066019.1| PREDICTED: uncharacterized protein LOC105629112 [Jatropha curcas]
Length=460

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 7/61 (11%)
 Frame = +2

Query  575  VVC*Q--EMEGNISSGNMIPGSS-YGGLDLQGSMRVHHHQQHPVGLH----PHPRQGSMV  733
            ++C +  +MEGN+S G M+PG S +GGLDL+G++R+HH  Q+P  +H    P  RQGS V
Sbjct  10   LICSKTDKMEGNLSRGCMLPGGSPFGGLDLEGAVRIHHQTQYPHAIHNQQRPIHRQGSSV  69

Query  734  H  736
            H
Sbjct  70   H  70



>ref|XP_008441519.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103485620 
[Cucumis melo]
Length=449

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGL----HPHPRQGS  727
            MEGN+S G +IPG SSYGGLDLQG  +VH+  QH   L    HPH RQGS
Sbjct  1    MEGNLSQGGLIPGGSSYGGLDLQGPFKVHNQGQHSHALHQQHHPHTRQGS  50



>gb|KDP42996.1| hypothetical protein JCGZ_25182 [Jatropha curcas]
Length=443

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 5/53 (9%)
 Frame = +2

Query  593  MEGNISSGNMIPGSS-YGGLDLQGSMRVHHHQQHPVGLH----PHPRQGSMVH  736
            MEGN+S G M+PG S +GGLDL+G++R+HH  Q+P  +H    P  RQGS VH
Sbjct  1    MEGNLSRGCMLPGGSPFGGLDLEGAVRIHHQTQYPHAIHNQQRPIHRQGSSVH  53



>ref|XP_003536428.1| PREDICTED: uncharacterized protein LOC100812134 [Glycine max]
 gb|KHN17008.1| hypothetical protein glysoja_011482 [Glycine soja]
Length=444

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGLH---PHPRQGSMVHS  739
            MEGN+  G +I G +S+GG DL GS+RV H  QHP  +H    HPRQGS VHS
Sbjct  1    MEGNLPQGGIIQGGTSFGGFDLPGSIRVQHQAQHPHSMHQHQTHPRQGSSVHS  53



>ref|XP_002532431.1| transcription factor, putative [Ricinus communis]
 gb|EEF29946.1| transcription factor, putative [Ricinus communis]
Length=445

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = +2

Query  593  MEGNISSGNMIPGSS-YGGLDLQGSMRVHHHQQHPVGLH-PH--PRQGSMVH  736
            MEGN+S GNM+PG + +GGLDLQGS+ VHH  Q+   +H PH   RQGS +H
Sbjct  1    MEGNLSQGNMLPGGTPFGGLDLQGSLSVHHQTQYQHAVHQPHHVHRQGSAIH  52



>ref|XP_010241711.1| PREDICTED: uncharacterized protein LOC104586241 [Nelumbo nucifera]
Length=452

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 12/58 (21%)
 Frame = +2

Query  593  MEGNISSGNMIPGSSYGGLDLQGSMRVHHHQQHPVGLH----------PHPRQGSMVH  736
            MEGN+S+G+M+PG+SYG LDLQGS  +H H Q+P  LH           HP QGSM+H
Sbjct  1    MEGNLSAGSMMPGASYGVLDLQGS--IHAHHQNPHTLHQQQQQQQQQLSHPHQGSMLH  56



>ref|XP_004140967.1| PREDICTED: uncharacterized protein LOC101203313 [Cucumis sativus]
 gb|KGN46144.1| hypothetical protein Csa_6G057100 [Cucumis sativus]
Length=449

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 36/54 (67%), Gaps = 13/54 (24%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHH--------HQQHPVGLHPHPRQGS  727
            MEGN+S G +IPG SSYGGLDLQG  +VH+        HQQH    HPH RQGS
Sbjct  1    MEGNLSQGGLIPGGSSYGGLDLQGPFKVHNQGQLSHALHQQH----HPHTRQGS  50



>ref|XP_006434454.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|ESR47694.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|KDO83724.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
 gb|KDO83725.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
Length=447

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 6/54 (11%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGLHP-----HPRQGSMVH  736
            MEGN+S G MIPG +S+GG+DLQGSMRVHH  QHP  +HP     +PRQG  VH
Sbjct  1    MEGNLSQGGMIPGGASFGGIDLQGSMRVHHQAQHPHAMHPHHHTINPRQGPSVH  54



>ref|XP_006473052.1| PREDICTED: uncharacterized protein LOC102612442 [Citrus sinensis]
Length=447

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 6/54 (11%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGLHP-----HPRQGSMVH  736
            MEGN+S G MIPG +S+GG+DLQGSMRVHH  QHP  +HP     +PRQG  VH
Sbjct  1    MEGNLSQGGMIPGGASFGGIDLQGSMRVHHQAQHPHAMHPHHHTINPRQGPSVH  54



>ref|XP_007019480.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
 gb|EOY16705.1| Sequence-specific DNA binding transcription factors [Theobroma 
cacao]
Length=446

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +2

Query  593  MEGNISSGNMIPGS-SYGGLDLQGSMRVHHHQQ----HPVGLHPHPRQGSMVH  736
            MEGN+S G MI G  S+GGLD+QGSMRVHHH Q         H +PRQG+ +H
Sbjct  1    MEGNLSQGGMISGGGSFGGLDVQGSMRVHHHAQHPHNIHQHHHSNPRQGASIH  53



>ref|XP_009368513.1| PREDICTED: uncharacterized protein LOC103958014 [Pyrus x bretschneideri]
Length=448

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (67%), Gaps = 6/54 (11%)
 Frame = +2

Query  593  MEGNISSGNMIPG---SSYGGLDLQGSMRVHHHQQHPVGLH---PHPRQGSMVH  736
            MEGN+S G        +S+GGLDLQGSMR HH  QHP  +H   PHP QGS+VH
Sbjct  1    MEGNLSQGGGGMVPGGASFGGLDLQGSMRGHHQTQHPHTIHHHLPHPHQGSLVH  54



>ref|XP_007143533.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 ref|XP_007143534.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15527.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
 gb|ESW15528.1| hypothetical protein PHAVU_007G079600g [Phaseolus vulgaris]
Length=450

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 4/53 (8%)
 Frame = +2

Query  593  MEGNISSGNMIPG-SSYGGLDLQGSMRVHHHQQHPVGLH---PHPRQGSMVHS  739
            MEGN+  G +I G +S+GG +L GS+RV H  QHP  +H    HPRQGS VHS
Sbjct  1    MEGNLPQGGIIQGGTSFGGFNLPGSIRVQHQAQHPHTMHQHQSHPRQGSSVHS  53



>ref|XP_011074759.1| PREDICTED: uncharacterized protein LOC105159405 [Sesamum indicum]
Length=437

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +2

Query  593  MEGNISSGNMIPGS-SYGGLDLQGSMRVHHHQQHPVGLHPHPRQGS  727
            MEGN+SS N + G  S+GG DLQG + VHHHQQ    L+ HPRQGS
Sbjct  1    MEGNLSSRNTMQGDGSFGGFDLQGPILVHHHQQ----LNSHPRQGS  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1386214017500