BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6676

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02816.1|  unnamed protein product                              76.6    1e-12   Coffea canephora [robusta coffee]
ref|XP_010649173.1|  PREDICTED: probable protein phosphatase 2C 5...  69.3    3e-10   Vitis vinifera
ref|XP_002268376.2|  PREDICTED: probable protein phosphatase 2C 5...  69.3    4e-10   Vitis vinifera
ref|XP_010099838.1|  putative protein phosphatase 2C 80               63.5    3e-08   Morus notabilis
ref|XP_011099582.1|  PREDICTED: probable protein phosphatase 2C 55    58.9    1e-06   
ref|XP_010070043.1|  PREDICTED: probable protein phosphatase 2C 80    58.9    1e-06   Eucalyptus grandis [rose gum]
ref|XP_007046996.1|  Phosphatase 2C family protein                    58.9    1e-06   
gb|KDO79494.1|  hypothetical protein CISIN_1g013301mg                 58.2    2e-06   Citrus sinensis [apfelsine]
ref|XP_006425719.1|  hypothetical protein CICLE_v10025600mg           58.5    2e-06   Citrus clementina [clementine]
gb|EYU44672.1|  hypothetical protein MIMGU_mgv1a007071mg              52.4    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_012079067.1|  PREDICTED: probable protein phosphatase 2C 80    52.0    2e-04   Jatropha curcas
gb|KDP31794.1|  hypothetical protein JCGZ_12255                       51.6    3e-04   Jatropha curcas
gb|KHN36141.1|  Hypothetical protein glysoja_003264                   50.4    8e-04   Glycine soja [wild soybean]
ref|XP_011025730.1|  PREDICTED: probable protein phosphatase 2C 80    50.1    0.001   Populus euphratica



>emb|CDP02816.1| unnamed protein product [Coffea canephora]
Length=467

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 15/143 (10%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPI-RSNYLGSC----RSKSFAIGVL  434
            M S LL   NS+F FGVQ+ +  K    +KL ++L + RS   G+C    R+K  A+   
Sbjct  1    MSSGLLPKPNSAFCFGVQRGLRVKLAPTHKLIESLTVKRSQKFGACYTYSRTKHSAVEAF  60

Query  435  QHSSA----ILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFAN  602
              +      +   S+  F  +S        MA S STAAPGD  +   IS  GNVSSFA 
Sbjct  61   SQTPGGGVVVSRPSSQAFGKFSG------AMAVSSSTAAPGDLVMDTFISGCGNVSSFAK  114

Query  603  PASIHFGDRSCRNCWKTCVSVQH  671
            P  ++FG+R   NC K  +S+++
Sbjct  115  PVVMYFGNRGLDNCQKASLSLRN  137



>ref|XP_010649173.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649174.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649176.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
Length=501

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 92/197 (47%), Gaps = 45/197 (23%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAK----------QIGRYKL--------------TQALP  377
            MPS +  +LN +F+ G+++A++A+          Q+G  KL              T  L 
Sbjct  1    MPSGVFPNLNIAFSSGIRRAITAQRGGLHSSIELQLGWSKLLTGNTGLCLSSPFSTTVLS  60

Query  378  IRSNYLGSCRSKSFAIGV------------------LQHSSAILGDSTSRFSGYSTYLCN  503
             R +     + +  A+GV                   ++    L     RFS  + YL  
Sbjct  61   SRPDCYFVNQKRGLAVGVPVSRSLSLHSMPSPSSQLFEYQINSLISDIGRFSKSNLYL--  118

Query  504  PRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVK  683
             + MAASGS A  GD  +   I+++GN+S+FA P  + F DRS  +C K  +S++++E  
Sbjct  119  KKSMAASGSKAVSGDIYIDE-ITATGNLSNFAKPTGVFFNDRSLSSCRKASMSLRNQEPP  177

Query  684  MAPIVHGYFIFDITGRS  734
               +V GY IFD+T R+
Sbjct  178  NRSLVCGYLIFDVTRRN  194



>ref|XP_002268376.2| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Vitis 
vinifera]
Length=500

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 92/197 (47%), Gaps = 45/197 (23%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAK----------QIGRYKL--------------TQALP  377
            MPS +  +LN +F+ G+++A++A+          Q+G  KL              T  L 
Sbjct  1    MPSGVFPNLNIAFSSGIRRAITAQRGGLHSSIELQLGWSKLLTGNTGLCLSSPFSTTVLS  60

Query  378  IRSNYLGSCRSKSFAIGV------------------LQHSSAILGDSTSRFSGYSTYLCN  503
             R +     + +  A+GV                   ++    L     RFS  + YL  
Sbjct  61   SRPDCYFVNQKRGLAVGVPVSRSLSLHSMPSPSSQLFEYQINSLISDIGRFSKSNLYL--  118

Query  504  PRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVK  683
             + MAASGS A  GD  +   I+++GN+S+FA P  + F DRS  +C K  +S++++E  
Sbjct  119  KKSMAASGSKAVSGDIYIDE-ITATGNLSNFAKPTGVFFNDRSLSSCRKASMSLRNQEPP  177

Query  684  MAPIVHGYFIFDITGRS  734
               +V GY IFD+T R+
Sbjct  178  NRSLVCGYLIFDVTRRN  194



>ref|XP_010099838.1| putative protein phosphatase 2C 80 [Morus notabilis]
 gb|EXB80598.1| putative protein phosphatase 2C 80 [Morus notabilis]
Length=426

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  435  QHS-SAILGDSTSRFSG--YSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANP  605
            +HS S +L    SR +G  YSTY   P  MAAS S    GD  +  LI+  GN   FA P
Sbjct  25   RHSISLLLRQGFSRKTGLPYSTYPL-PYPMAASNSKPVFGDVYVDDLITGCGNALDFAKP  83

Query  606  ASIHFGDRSCRNCWKTCVSVQHKEVKMAPIVHGYFIFDITGRSSNSSL  749
              + F D+S  +C K  VS++ +E+  + I  GYF  D+T ++ NS++
Sbjct  84   TGVFFNDKSLISCRKAVVSLRRREISNSQISCGYFFADVTRKNCNSNI  131



>ref|XP_011099582.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=382

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = +3

Query  513  MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAP  692
            MAASGS  A GD  +  L+SS GNVS F  P  + F DRS + C +  VS++   ++   
Sbjct  1    MAASGSMVASGDLVVDALVSSCGNVSGFVKPGGVFFSDRSYKICRRARVSMRSGAMESHH  60

Query  693  IVHGYFIFDITGRSSNS  743
              HG  +FD   R +NS
Sbjct  61   GPHGCLVFDFEPRYNNS  77



>ref|XP_010070043.1| PREDICTED: probable protein phosphatase 2C 80 [Eucalyptus grandis]
 gb|KCW58599.1| hypothetical protein EUGRSUZ_H01259 [Eucalyptus grandis]
Length=437

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 27/138 (20%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSC-RSKSFAIGVLQHSS  446
            MPS+ LS LN++   G ++A++ +Q+  +    +LP++      C RS   + GV+    
Sbjct  1    MPSSALSRLNTTAFCGFRRALAEQQVHNFG---SLPLQ------CPRSTVLSTGVV----  47

Query  447  AILGDSTSRFSGYSTYLCNPRI-MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFG  623
                        YS      RI MAASGS A  GD  + GL+SS GN   F  P+ ++F 
Sbjct  48   ------------YSPSRVQRRISMAASGSKAVSGDVYMDGLLSSGGNTVDFTKPSGVYFF  95

Query  624  DRSCRNCWKTCVSVQHKE  677
            DRS ++  +  VS++ +E
Sbjct  96   DRSQKSFQRASVSLRRRE  113



>ref|XP_007046996.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX91153.1| Phosphatase 2C family protein [Theobroma cacao]
Length=452

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 79/157 (50%), Gaps = 8/157 (5%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSCRSKSFAIGVLQHSSA  449
            MP  +LS LN +   G ++A+S +++     T +L +R   L S  S       L +S  
Sbjct  1    MPPVVLSKLNPAIYTGFRRAISGRRVRLCNPTSSL-LRQRKLLSANSG--LTQFLPYSIN  57

Query  450  ILGDSTSRFSGYSTYLC-NPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGD  626
            ++ D+  RF      LC + + MA SGS A  GD  +  L++S GN   F  P  ++F D
Sbjct  58   LISDN--RF--VLNQLCTSAKTMAVSGSKAVFGDVYVDELVASCGNGLDFLKPTGVYFPD  113

Query  627  RSCRNCWKTCVSVQHKEVKMAPIVHGYFIFDITGRSS  737
             S  +C K  ++++ +E      V+GY++ D   R++
Sbjct  114  GSRTSCQKVSMTLRKREQTNNRFVYGYYVCDAMQRNT  150



>gb|KDO79494.1| hypothetical protein CISIN_1g013301mg [Citrus sinensis]
 gb|KDO79495.1| hypothetical protein CISIN_1g013301mg [Citrus sinensis]
Length=353

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +3

Query  513  MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAP  692
            + +SG+ A  GD  +  L+S+ GN   FA  + ++F DRS   C K  +S + +E     
Sbjct  68   IPSSGTKAVGGDVLIDDLVSNCGNGLEFAKSSGVYFNDRSQSRCHKARMSSRKRESPSGG  127

Query  693  IVHGYFIFDITGRSSNSSLV  752
            +V GYFIFD  GRSS S+++
Sbjct  128  LVSGYFIFDSVGRSSKSNVL  147



>ref|XP_006425719.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 ref|XP_006466757.1| PREDICTED: probable protein phosphatase 2C 80-like [Citrus sinensis]
 gb|ESR38959.1| hypothetical protein CICLE_v10025600mg [Citrus clementina]
 gb|KDO79493.1| hypothetical protein CISIN_1g013301mg [Citrus sinensis]
Length=446

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +3

Query  513  MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAP  692
            + +SG+ A  GD  +  L+S+ GN   FA  + ++F DRS   C K  +S + +E     
Sbjct  68   IPSSGTKAVGGDVLIDDLVSNCGNGLEFAKSSGVYFNDRSQSRCHKARMSSRKRESPSGG  127

Query  693  IVHGYFIFDITGRSSNSSLV  752
            +V GYFIFD  GRSS S+++
Sbjct  128  LVSGYFIFDSVGRSSKSNVL  147



>gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Erythranthe guttata]
Length=420

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 54/133 (41%), Gaps = 38/133 (29%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSCRSKSFAIGVLQHSSA  449
            MPS LL +LN + +FG  +A    Q     L + L  RS   G  R              
Sbjct  1    MPSWLLPNLNVALSFGFPRAARVNQSQPLHLIETLFTRS---GKNR--------------  43

Query  450  ILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDR  629
                                 MAAS S  A GD  +  L+SS GNVS F  P  + +GDR
Sbjct  44   ---------------------MAASSSMVASGDVVVDTLLSSCGNVSGFLKPGGVFYGDR  82

Query  630  SCRNCWKTCVSVQ  668
            S + C K  VS++
Sbjct  83   SFKVCRKARVSIR  95



>ref|XP_012079067.1| PREDICTED: probable protein phosphatase 2C 80 [Jatropha curcas]
 ref|XP_012079068.1| PREDICTED: probable protein phosphatase 2C 80 [Jatropha curcas]
Length=417

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (54%), Gaps = 8/89 (9%)
 Frame = +3

Query  474  FSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKT  653
             SGYS        MAASGS A  GD  +  +I++ GN   F+ P+ + F DRS  +C K 
Sbjct  38   LSGYS--------MAASGSKAVFGDTYIDDMITTCGNGLDFSKPSGVFFADRSRASCLKA  89

Query  654  CVSVQHKEVKMAPIVHGYFIFDITGRSSN  740
             V +++ E+  + +V GY  FD    SSN
Sbjct  90   SVRMRNGELPNSRLVCGYSSFDAIIGSSN  118



>gb|KDP31794.1| hypothetical protein JCGZ_12255 [Jatropha curcas]
Length=375

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +3

Query  513  MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAP  692
            MAASGS A  GD  +  +I++ GN   F+ P+ + F DRS  +C K  V +++ E+  + 
Sbjct  1    MAASGSKAVFGDTYIDDMITTCGNGLDFSKPSGVFFADRSRASCLKASVRMRNGELPNSR  60

Query  693  IVHGYFIFDITGRSSN  740
            +V GY  FD    SSN
Sbjct  61   LVCGYSSFDAIIGSSN  76



>gb|KHN36141.1| Hypothetical protein glysoja_003264 [Glycine soja]
Length=415

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 73/150 (49%), Gaps = 17/150 (11%)
 Frame = +3

Query  270  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSCRSKSFAIGVLQHSSA  449
            MP  +LS LN++    +++A++ +Q     L              RS + ++G L +S++
Sbjct  1    MP-GILSWLNATIYCRIREAITRQQGAPTSLH-------------RSSALSLGSL-YSTS  45

Query  450  ILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDR  629
            IL  ST  +   S  L    ++ AS S A  GD    G ISS G+V  F  PA ++F DR
Sbjct  46   ILPGST--YCSSSHTLDTKSMVTASHSNAMLGDVYAYGSISSFGSVLDFTKPAVVYFKDR  103

Query  630  SCRNCWKTCVSVQHKEVKMAPIVHGYFIFD  719
            +   CW+  V+++  +    P+  G   FD
Sbjct  104  AHTGCWRDSVNLRRLQPLYGPLSFGCSTFD  133



>ref|XP_011025730.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025731.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
 ref|XP_011025732.1| PREDICTED: probable protein phosphatase 2C 80 [Populus euphratica]
Length=417

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 4/109 (4%)
 Frame = +3

Query  414  SFAIG--VLQHSSAILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNV  587
            SF +G  VL  +S  L  +TS+FS   + +     MAAS S A  GD  +  LI++  N 
Sbjct  10   SFGLGRAVLGRNSVSLASNTSQFSSRRSLVRTS--MAASSSKAVFGDVHIDDLIATCANG  67

Query  588  SSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAPIVHGYFIFDITGRS  734
              F  P+ + F DRS  +C K  V +++ E+  + +V G  + D   R+
Sbjct  68   LEFPKPSGVFFSDRSRSSCLKASVKMRNGELPKSRLVCGNLMLDAVRRN  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497111138900