BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6587

Length=1275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99148.1|  unnamed protein product                                345   1e-113   Coffea canephora [robusta coffee]
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          344   3e-113   Vitis vinifera
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          343   9e-113   Sesamum indicum [beniseed]
emb|CBI26357.3|  unnamed protein product                                332   1e-108   Vitis vinifera
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          332   2e-108   Sesamum indicum [beniseed]
gb|ADJ68049.1|  auxin responsive protein                                324   1e-105   Catharanthus roseus [chatas]
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   323   6e-105   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      320   5e-104   Nicotiana tomentosiformis
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          320   1e-103   Nicotiana tomentosiformis
ref|XP_012069759.1|  PREDICTED: auxin-responsive protein IAA14-like     319   2e-103   Jatropha curcas
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          317   2e-102   Prunus mume [ume]
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    316   3e-102   Populus euphratica
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     315   3e-102   Nicotiana sylvestris
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             315   9e-102   
gb|KJB38278.1|  hypothetical protein B456_006G246000                    316   2e-101   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                314   2e-101   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    313   3e-101   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    312   9e-101   Gossypium arboreum [tree cotton]
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    311   2e-100   Populus euphratica
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     311   2e-100   Nicotiana sylvestris
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             311   3e-100   Medicago truncatula
gb|KHN05057.1|  Auxin-responsive protein IAA14                          311   3e-100   Glycine soja [wild soybean]
ref|XP_011649168.1|  PREDICTED: auxin-responsive protein IAA14          311   3e-100   Cucumis sativus [cucumbers]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             311   3e-100   Phaseolus vulgaris [French bean]
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    311   4e-100   Populus euphratica
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     310   5e-100   Cucumis melo [Oriental melon]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     310   6e-100   Cucumis melo [Oriental melon]
gb|AFK37379.1|  unknown                                                 309   9e-100   Medicago truncatula
ref|XP_002311658.1|  aux/IAA family protein                             310   9e-100   Populus trichocarpa [western balsam poplar]
ref|NP_001240213.1|  auxin-induced protein ali50                        309   1e-99    Glycine max [soybeans]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14          309   1e-99    Cucumis sativus [cucumbers]
gb|AFZ78617.1|  hypothetical protein                                    309   1e-99    Populus tomentosa [Chinese white poplar]
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    308   3e-99    Cicer arietinum [garbanzo]
ref|NP_001266070.1|  IAA14                                              308   4e-99    Solanum lycopersicum
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     311   4e-99    
gb|KJB28413.1|  hypothetical protein B456_005G046500                    308   6e-99    Gossypium raimondii
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    308   6e-99    Gossypium arboreum [tree cotton]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                307   1e-98    Erythranthe guttata [common monkey flower]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    306   2e-98    Arabis alpina [alpine rockcress]
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    306   3e-98    Populus euphratica
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     305   6e-98    Tarenaya hassleriana [spider flower]
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     305   8e-98    Solanum tuberosum [potatoes]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     304   2e-97    Eucalyptus grandis [rose gum]
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     302   6e-97    
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      301   1e-96    Malus prunifolia
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                301   1e-96    Malus domestica [apple tree]
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     301   3e-96    
gb|AFK44393.1|  unknown                                                 300   3e-96    Lotus japonicus
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                300   6e-96    Erythranthe guttata [common monkey flower]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               299   9e-96    Arabis alpina [alpine rockcress]
ref|XP_002315736.1|  aux/IAA family protein                             300   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             300   2e-95    
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           297   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     297   7e-95    Fragaria vesca subsp. vesca
ref|NP_188945.1|  auxin-responsive protein IAA7                         297   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           297   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             296   1e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      295   3e-94    Camelina sativa [gold-of-pleasure]
gb|AFS44507.1|  auxin repressor                                         295   3e-94    Fragaria x ananassa
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      295   7e-94    Camelina sativa [gold-of-pleasure]
ref|NP_001288823.1|  auxin-responsive protein IAA7                      294   1e-93    Brassica rapa
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             292   4e-93    Eutrema salsugineum [saltwater cress]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             293   5e-93    
emb|CAC84710.1|  aux/IAA protein                                        293   6e-93    Populus tremula x Populus tremuloides
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     291   6e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      292   7e-93    Brassica rapa
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             291   7e-93    Citrus clementina [clementine]
ref|NP_193191.2|  auxin-responsive protein IAA14                        291   9e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          291   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          290   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     290   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     291   2e-92    Populus euphratica
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        289   2e-92    
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               291   2e-92    
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             290   3e-92    Capsella rubella
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       290   3e-92    Populus tremula x Populus tremuloides
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           290   4e-92    Ricinus communis
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             290   5e-92    Populus trichocarpa [western balsam poplar]
emb|CDY10349.1|  BnaC05g29300D                                          290   5e-92    Brassica napus [oilseed rape]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     289   1e-91    Populus euphratica
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          288   2e-91    Tarenaya hassleriana [spider flower]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 288   2e-91    Medicago truncatula
gb|KHN30563.1|  Auxin-responsive protein IAA14                          288   2e-91    Glycine soja [wild soybean]
gb|KJB82525.1|  hypothetical protein B456_013G200700                    288   3e-91    Gossypium raimondii
ref|NP_001268036.1|  uncharacterized protein LOC100250231               287   4e-91    Vitis vinifera
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     288   4e-91    Nelumbo nucifera [Indian lotus]
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             287   8e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          286   1e-90    Brassica rapa
gb|AEE25654.1|  auxin-responsive protein                                286   1e-90    Gossypium hirsutum [American cotton]
emb|CDY47148.1|  BnaA08g05350D                                          286   1e-90    Brassica napus [oilseed rape]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             286   1e-90    
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    286   1e-90    
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     286   2e-90    Morus notabilis
gb|EPS64756.1|  hypothetical protein M569_10024                         284   4e-90    Genlisea aurea
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    284   9e-90    Gossypium arboreum [tree cotton]
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      286   1e-89    
emb|CDY62130.1|  BnaC08g47390D                                          283   1e-89    Brassica napus [oilseed rape]
emb|CDY63910.1|  BnaC01g43640D                                          283   2e-89    Brassica napus [oilseed rape]
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     283   3e-89    Vitis vinifera
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     282   5e-89    Nelumbo nucifera [Indian lotus]
ref|NP_001266049.1|  IAA9 protein                                       282   5e-89    Solanum lycopersicum
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       281   8e-89    Solanum tuberosum [potatoes]
gb|ABH01143.1|  auxin-regulated protein                                 281   1e-88    Populus tomentosa [Chinese white poplar]
ref|XP_012089266.1|  PREDICTED: auxin-responsive protein IAA16          280   3e-88    Jatropha curcas
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            278   3e-88    
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                276   3e-87    Solanum tuberosum [potatoes]
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          276   6e-87    Nicotiana tomentosiformis
gb|KJB44873.1|  hypothetical protein B456_007G276900                    277   6e-87    Gossypium raimondii
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      276   1e-86    Nicotiana tabacum [American tobacco]
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          275   2e-86    Tarenaya hassleriana [spider flower]
emb|CAN63268.1|  hypothetical protein VITISV_013635                     275   2e-86    Vitis vinifera
ref|NP_001266039.1|  IAA7 protein                                       274   3e-86    Solanum lycopersicum
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          275   3e-86    Nicotiana sylvestris
ref|NP_001280973.1|  auxin-responsive protein IAA16                     275   3e-86    Malus domestica [apple tree]
gb|KJB11141.1|  hypothetical protein B456_001G242900                    275   4e-86    Gossypium raimondii
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             274   5e-86    Citrus clementina [clementine]
emb|CAB46059.1|  IAA7 like protein                                      273   1e-85    Arabidopsis thaliana [mouse-ear cress]
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   273   1e-85    Citrus sinensis [apfelsine]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     273   1e-85    Elaeis guineensis
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     274   1e-85    
ref|NP_001288939.1|  auxin-responsive protein IAA16                     271   5e-85    Brassica rapa
emb|CAH59413.1|  auxin resistance protein                               271   6e-85    Plantago major [cart-track plant]
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             273   7e-85    
gb|AEE25650.1|  auxin-responsive protein                                272   7e-85    Gossypium hirsutum [American cotton]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        273   7e-85    
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          271   1e-84    Prunus mume [ume]
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             270   1e-84    Eutrema salsugineum [saltwater cress]
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            270   2e-84    Ipomoea nil [qian niu]
emb|CDY50750.1|  BnaAnng10570D                                          272   2e-84    Brassica napus [oilseed rape]
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                270   3e-84    Erythranthe guttata [common monkey flower]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          270   4e-84    Pyrus x bretschneideri [bai li]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        269   8e-84    Sesamum indicum [beniseed]
dbj|BAJ34138.1|  unnamed protein product                                268   1e-83    Eutrema halophilum
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             268   2e-83    Capsella rubella
ref|XP_006383686.1|  auxin-induced protein aux28                        267   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_006838867.1|  PREDICTED: auxin-responsive protein IAA16          267   3e-83    Amborella trichopoda
gb|KJB11145.1|  hypothetical protein B456_001G242900                    268   3e-83    Gossypium raimondii
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     266   4e-83    Brassica rapa
ref|NP_187124.1|  auxin-responsive protein IAA16                        266   4e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    266   5e-83    Arabis alpina [alpine rockcress]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              266   9e-83    Ricinus communis
ref|XP_002302075.1|  auxin-induced protein aux28                        265   1e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          265   1e-82    Camelina sativa [gold-of-pleasure]
gb|KJB42200.1|  hypothetical protein B456_007G141900                    265   2e-82    Gossypium raimondii
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     265   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          265   3e-82    Fragaria vesca subsp. vesca
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     265   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     264   3e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             264   3e-82    Capsella rubella
emb|CDY15493.1|  BnaA08g27770D                                          264   4e-82    Brassica napus [oilseed rape]
gb|ACL81167.1|  auxin-responsive protein IAA1                           265   5e-82    Mirabilis jalapa
ref|NP_001239753.1|  uncharacterized protein LOC100781847               263   6e-82    Glycine max [soybeans]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               263   6e-82    
emb|CAN72026.1|  hypothetical protein VITISV_014421                     265   7e-82    Vitis vinifera
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          263   8e-82    Brassica rapa
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             264   9e-82    Phaseolus vulgaris [French bean]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             263   1e-81    
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        263   1e-81    Fragaria vesca subsp. vesca
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    262   1e-81    Tarenaya hassleriana [spider flower]
gb|ABM53874.1|  IAA6                                                    259   1e-81    Cestrum elegans
gb|KHN18836.1|  Auxin-induced protein AUX28                             263   1e-81    Glycine soja [wild soybean]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                263   2e-81    Erythranthe guttata [common monkey flower]
gb|KHG04941.1|  Auxin-induced AUX28                                     262   2e-81    Gossypium arboreum [tree cotton]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          262   2e-81    Camelina sativa [gold-of-pleasure]
emb|CDY41894.1|  BnaC05g47100D                                          262   2e-81    Brassica napus [oilseed rape]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        262   3e-81    Populus euphratica
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   261   3e-81    Citrus sinensis [apfelsine]
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        262   3e-81    Populus euphratica
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             261   4e-81    Citrus clementina [clementine]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             261   5e-81    Eutrema salsugineum [saltwater cress]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     261   5e-81    Camelina sativa [gold-of-pleasure]
gb|AAC49055.1|  IAA14                                                   259   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    261   5e-81    Elaeis guineensis
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     261   6e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     261   6e-81    Camelina sativa [gold-of-pleasure]
emb|CDY30017.1|  BnaC01g39910D                                          261   7e-81    Brassica napus [oilseed rape]
dbj|BAI94494.1|  Aux/IAA protein                                        261   7e-81    Dianthus caryophyllus [carnation]
gb|KHN22078.1|  Auxin-responsive protein IAA16                          261   7e-81    Glycine soja [wild soybean]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     261   7e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU18407.1|  unknown                                                 261   8e-81    Glycine max [soybeans]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            260   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_171921.1|  auxin-responsive protein IAA17                        259   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241599.1|  uncharacterized protein LOC100803065               260   2e-80    Glycine max [soybeans]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     261   2e-80    Eucalyptus grandis [rose gum]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     259   4e-80    Phoenix dactylifera
gb|AFK36086.1|  unknown                                                 258   1e-79    Lotus japonicus
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     257   1e-79    Sesamum indicum [beniseed]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    258   1e-79    Elaeis guineensis
emb|CDY63072.1|  BnaCnng41350D                                          262   3e-79    Brassica napus [oilseed rape]
gb|AFK44192.1|  unknown                                                 257   4e-79    Medicago truncatula
emb|CDY18214.1|  BnaC05g02370D                                          256   4e-79    Brassica napus [oilseed rape]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             256   4e-79    Eutrema salsugineum [saltwater cress]
emb|CDX89832.1|  BnaA10g02500D                                          256   4e-79    
gb|AAM96891.1|  auxin-responsive protein IAA1                           254   5e-79    Mirabilis jalapa
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    256   5e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     256   5e-79    Cicer arietinum [garbanzo]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     256   5e-79    Phoenix dactylifera
emb|CBI35213.3|  unnamed protein product                                253   8e-79    Vitis vinifera
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        255   1e-78    Cicer arietinum [garbanzo]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     254   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11146.1|  hypothetical protein B456_001G242900                    256   2e-78    Gossypium raimondii
emb|CDY32537.1|  BnaA09g50590D                                          253   4e-78    Brassica napus [oilseed rape]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     253   4e-78    Brassica rapa
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     253   8e-78    Brassica rapa
gb|ACJ83896.1|  unknown                                                 253   1e-77    Medicago truncatula
gb|KJB38279.1|  hypothetical protein B456_006G246000                    251   2e-77    Gossypium raimondii
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 253   2e-77    Medicago truncatula
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    252   2e-77    
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    251   2e-77    Cucumis melo [Oriental melon]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16          251   3e-77    Cucumis sativus [cucumbers]
emb|CDP06818.1|  unnamed protein product                                252   3e-77    Coffea canephora [robusta coffee]
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             251   4e-77    Phaseolus vulgaris [French bean]
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 250   4e-77    Medicago truncatula
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             250   7e-77    
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             250   1e-76    Phaseolus vulgaris [French bean]
gb|ABD98055.1|  auxin-regulated protein                                 251   1e-76    Striga asiatica [witchweed]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   250   1e-76    Cucumis sativus [cucumbers]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    249   2e-76    Arabis alpina [alpine rockcress]
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    249   2e-76    
emb|CDY10068.1|  BnaC08g43830D                                          249   2e-76    Brassica napus [oilseed rape]
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        250   2e-76    Malus domestica [apple tree]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     249   3e-76    Glycine max [soybeans]
gb|AGV54230.1|  auxin-induced protein AUX28                             249   5e-76    Phaseolus vulgaris [French bean]
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        248   5e-76    Cucumis melo [Oriental melon]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             248   5e-76    
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             250   5e-76    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31465.1|  Auxin-responsive protein IAA16                          248   8e-76    Glycine soja [wild soybean]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        248   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     248   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011648754.1|  PREDICTED: auxin-responsive protein IAA16 is...    247   2e-75    Cucumis sativus [cucumbers]
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        248   2e-75    Pyrus x bretschneideri [bai li]
gb|AFK42876.1|  unknown                                                 247   2e-75    Medicago truncatula
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        247   3e-75    
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             246   4e-75    
emb|CDY10694.1|  BnaA05g16680D                                          243   8e-75    Brassica napus [oilseed rape]
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     245   9e-75    Tarenaya hassleriana [spider flower]
ref|NP_001236693.1|  auxin-induced protein AUX28                        245   9e-75    
gb|KHN02537.1|  Auxin-induced protein AUX28                             245   1e-74    Glycine soja [wild soybean]
gb|ADL36587.1|  ARF domain class transcription factor                   243   1e-74    Malus domestica [apple tree]
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     243   2e-74    Solanum tuberosum [potatoes]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     244   2e-74    Nicotiana tabacum [American tobacco]
gb|ACJ84642.1|  unknown                                                 244   3e-74    Medicago truncatula
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    243   3e-74    Cucumis melo [Oriental melon]
gb|ACU19136.1|  unknown                                                 244   4e-74    Glycine max [soybeans]
emb|CAC84711.1|  aux/IAA protein                                        243   4e-74    Populus tremula x Populus tremuloides
gb|ACU21378.1|  unknown                                                 244   4e-74    Glycine max [soybeans]
dbj|BAJ84870.1|  predicted protein                                      243   7e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01326.1|  predicted protein                                      243   8e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        243   1e-73    Glycine max [soybeans]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     242   3e-73    Setaria italica
ref|NP_974355.1|  auxin-responsive protein IAA7                         240   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012092112.1|  PREDICTED: auxin-induced protein AUX28-like        241   5e-73    Jatropha curcas
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        241   7e-73    Prunus mume [ume]
ref|NP_001266055.1|  IAA10 protein                                      238   2e-72    Solanum lycopersicum
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          240   3e-72    Sorghum bicolor [broomcorn]
ref|NP_001237212.1|  uncharacterized protein LOC100499872               238   3e-72    
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     236   5e-72    Nicotiana sylvestris
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             238   8e-72    Prunus persica
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        239   1e-71    Eucalyptus grandis [rose gum]
gb|ACF87179.1|  unknown                                                 238   2e-71    Zea mays [maize]
gb|ACF88333.1|  unknown                                                 235   2e-70    Zea mays [maize]
ref|XP_011648755.1|  PREDICTED: auxin-responsive protein IAA16 is...    234   2e-70    Cucumis sativus [cucumbers]
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                   231   6e-70    Citrus sinensis [apfelsine]
gb|EPS60474.1|  hypothetical protein M569_14329                         231   7e-70    Genlisea aurea
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    233   8e-70    Setaria italica
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     233   9e-70    Brachypodium distachyon [annual false brome]
gb|AFK43673.1|  unknown                                                 233   1e-69    Lotus japonicus
gb|ABM53872.1|  IAA4                                                    228   2e-69    Cestrum elegans
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             231   2e-69    Citrus clementina [clementine]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   230   4e-69    Citrus sinensis [apfelsine]
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    230   6e-69    Cucumis melo [Oriental melon]
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       227   9e-69    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     231   9e-69    Zea mays [maize]
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       227   9e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    229   1e-68    Glycine max [soybeans]
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     230   1e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067209.1|  Os12g0601300                                       231   1e-68    
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    230   1e-68    Setaria italica
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 229   2e-68    Medicago truncatula
dbj|BAJ97201.1|  predicted protein                                      227   1e-67    
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             226   2e-67    
gb|ADB93627.2|  indole-3-acetic acid inducible 14                       224   2e-67    
gb|ABI36493.1|  AUX/IAA16 A                                             223   2e-67    
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       223   3e-67    
gb|EEE53551.1|  hypothetical protein OsJ_36765                          223   3e-67    
gb|ADB93625.2|  indole-3-acetic acid inducible 14                       222   2e-66    
gb|ACU19616.1|  unknown                                                 223   2e-66    
gb|ADB93629.2|  indole-3-acetic acid inducible 14                       222   2e-66    
gb|ABI36487.1|  AUX/IAA7 A                                              220   2e-66    
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     224   2e-66    
gb|AFK42031.1|  unknown                                                 223   2e-66    
gb|ADL70641.1|  indole-3-acetic acid inducible 14                       221   5e-66    
gb|ADB93628.1|  indole-3-acetic acid inducible 14                       220   9e-66    
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       215   2e-64    
gb|KJB44872.1|  hypothetical protein B456_007G276900                    216   5e-64    
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     219   1e-63    
gb|KJB11142.1|  hypothetical protein B456_001G242900                    215   2e-63    
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       211   7e-63    
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       211   7e-63    
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2        215   8e-63    
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       211   8e-63    
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       211   2e-62    
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     216   2e-62    
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 217   2e-62    
gb|ABK24636.1|  unknown                                                 218   2e-62    
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      217   2e-62    
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          214   2e-62    
gb|ABI36490.1|  AUX/IAA7 C                                              209   3e-62    
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg             211   5e-62    
gb|KJB44871.1|  hypothetical protein B456_007G276900                    209   6e-62    
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                   211   9e-62    
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...    211   1e-61    
gb|AAV50046.1|  auxin-induced protein                                   209   1e-61    
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     213   2e-61    
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                   209   3e-61    
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     213   3e-61    
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     213   4e-61    
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          213   6e-61    
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27          211   6e-61    
emb|CBI36106.3|  unnamed protein product                                211   9e-61    
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    211   1e-60    
gb|ABR17764.1|  unknown                                                 211   2e-60    
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...    207   2e-60    
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           210   2e-60    
ref|XP_006833393.1|  PREDICTED: auxin-responsive protein IAA27          211   2e-60    
ref|XP_006850381.1|  PREDICTED: auxin-responsive protein IAA9           213   3e-60    
gb|KJB54240.1|  hypothetical protein B456_009G026700                    210   3e-60    
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...    207   3e-60    
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     209   3e-60    
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    210   3e-60    
gb|KEH27147.1|  auxin response factor                                   207   4e-60    
gb|ABB55368.1|  Aux/IAA protein-like                                    211   4e-60    
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     209   5e-60    
ref|NP_001275473.1|  Aux/IAA protein                                    210   5e-60    
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    207   5e-60    
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         209   6e-60    
gb|KJB18638.1|  hypothetical protein B456_003G064200                    207   6e-60    
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     210   7e-60    
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         209   9e-60    
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      209   9e-60    
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      209   1e-59    
emb|CAI77628.1|  Aux/IAA protein                                        208   2e-59    
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative            205   2e-59    
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     208   2e-59    
ref|NP_001266034.1|  IAA6 protein                                       206   2e-59    
gb|ABR16139.1|  unknown                                                 212   2e-59    
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    209   2e-59    
gb|KJB18635.1|  hypothetical protein B456_003G064200                    208   2e-59    
ref|XP_012068087.1|  PREDICTED: auxin-responsive protein IAA9-like      209   2e-59    
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    210   3e-59    
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 208   3e-59    
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    210   3e-59    
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    210   3e-59    
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          207   3e-59    
emb|CBI19314.3|  unnamed protein product                                207   3e-59    
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      208   5e-59    
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              208   5e-59    
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    206   6e-59    
gb|AAL92850.1|  Aux/IAA protein                                         207   7e-59    
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     205   7e-59    
emb|CBI28036.3|  unnamed protein product                                201   7e-59    
ref|NP_001268170.1|  Aux/IAA protein                                    207   7e-59    
gb|AAP44405.1|  auxin-induced protein 2                                 206   8e-59    
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    205   9e-59    
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 206   1e-58    
gb|ABR16302.1|  unknown                                                 206   1e-58    
gb|AEV89263.1|  IAA9                                                    206   1e-58    
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    206   1e-58    
gb|AFK45766.1|  unknown                                                 204   1e-58    
gb|AEI70506.1|  auxin-responsive protein                                206   1e-58    
gb|KJB56779.1|  hypothetical protein B456_009G135900                    206   1e-58    
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1           202   2e-58    
gb|KJB58777.1|  hypothetical protein B456_009G226000                    207   2e-58    
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             207   2e-58    
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     204   2e-58    
gb|KJB58781.1|  hypothetical protein B456_009G226000                    207   2e-58    
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    204   2e-58    
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             206   2e-58    
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     204   3e-58    
gb|KJB64027.1|  hypothetical protein B456_010G031600                    206   3e-58    
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      206   3e-58    
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          206   3e-58    
gb|ABY48132.1|  GH1 protein                                             205   4e-58    
gb|EAZ27868.1|  hypothetical protein OsJ_11821                          202   4e-58    
gb|AGV54485.1|  auxin-responsive protein                                205   5e-58    
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     205   6e-58    
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          203   6e-58    
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             206   7e-58    
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     202   7e-58    
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   204   7e-58    
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    204   7e-58    
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         204   7e-58    
gb|AEI70507.1|  auxin-responsive protein                                205   7e-58    
emb|CAD10639.1|  IAA9 protein                                           204   8e-58    
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...    201   8e-58    
gb|KHN09036.1|  Auxin-responsive protein IAA8                           205   8e-58    
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           205   8e-58    
gb|EMS64858.1|  Auxin-responsive protein IAA30                          203   9e-58    
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 202   9e-58    
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             202   1e-57    
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             203   1e-57    
ref|XP_002303297.1|  auxin-responsive protein IAA27                     204   1e-57    
ref|XP_002299625.1|  auxin-induced protein IAA4                         200   1e-57    
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      204   1e-57    
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg             205   1e-57    
gb|ADL70676.1|  indole-3-acetic acid inducible 16                       197   1e-57    
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          203   1e-57    
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like      199   1e-57    
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             204   1e-57    
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      204   1e-57    
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      204   2e-57    
ref|XP_002302351.1|  auxin-responsive family protein                    204   2e-57    
emb|CAC84706.1|  aux/IAA protein                                        204   2e-57    
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          203   2e-57    
gb|AFK49596.1|  unknown                                                 202   2e-57    
gb|AFZ78618.1|  hypothetical protein                                    204   2e-57    
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      204   2e-57    
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             201   2e-57    
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     201   2e-57    
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 204   2e-57    
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      203   3e-57    
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14          198   3e-57    
gb|AAM12952.1|  auxin-regulated protein                                 203   3e-57    
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             202   3e-57    
emb|CBW30571.1|  auxin-responsive protein iaa27                         200   3e-57    
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    204   3e-57    
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    202   3e-57    
ref|XP_012073398.1|  PREDICTED: auxin-responsive protein IAA27-li...    202   3e-57    
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           204   3e-57    
gb|KHN46011.1|  Auxin-responsive protein IAA9                           203   3e-57    
gb|ADL36578.1|  ARF domain class transcription factor                   204   3e-57    
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    202   3e-57    
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                201   4e-57    
gb|KJB18637.1|  hypothetical protein B456_003G064200                    202   4e-57    
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     202   4e-57    
ref|XP_012073397.1|  PREDICTED: auxin-responsive protein IAA27-li...    202   4e-57    
ref|NP_179852.1|  auxin-responsive protein IAA8                         202   4e-57    
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     202   4e-57    
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          201   5e-57    
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     202   5e-57    
dbj|BAK05607.1|  predicted protein                                      199   5e-57    
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    203   6e-57    
emb|CAE00638.1|  IAA1 protein                                           198   7e-57    
ref|NP_001189579.1|  auxin-responsive protein IAA8                      202   7e-57    
gb|KHN04889.1|  Auxin-responsive protein IAA8                           200   7e-57    
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                202   7e-57    
ref|XP_002867425.1|  phytochrome-associated protein 2                   201   8e-57    
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...    198   8e-57    
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    202   9e-57    
ref|NP_194637.1|  phytochrome-associated protein 2                      200   1e-56    
gb|KHN16618.1|  Auxin-responsive protein IAA27                          200   1e-56    
gb|ABM53871.1|  IAA3                                                    195   1e-56    
emb|CDP00957.1|  unnamed protein product                                202   1e-56    
emb|CDP02673.1|  unnamed protein product                                202   1e-56    
ref|NP_001280937.1|  auxin-responsive protein IAA27                     201   1e-56    
gb|AAB70005.1|  GH1 protein                                             201   1e-56    
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    202   1e-56    
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     200   1e-56    
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           202   2e-56    
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    201   2e-56    
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     200   2e-56    
ref|NP_001239808.1|  uncharacterized protein LOC100778529               199   2e-56    
ref|NP_001241389.1|  uncharacterized protein LOC100783314               201   2e-56    
gb|KHN41649.1|  Auxin-responsive protein IAA27                          199   2e-56    
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1           197   2e-56    
emb|CDP03299.1|  unnamed protein product                                200   2e-56    
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             201   3e-56    
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          199   3e-56    
gb|AFZ78621.1|  hypothetical protein                                    196   3e-56    
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             199   4e-56    
gb|AFK38170.1|  unknown                                                 200   4e-56    
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      201   4e-56    
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             200   5e-56    
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    198   5e-56    
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     198   5e-56    
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           201   5e-56    
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          199   5e-56    
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           197   5e-56    
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     199   6e-56    
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             201   6e-56    
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like      199   6e-56    
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   200   6e-56    
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                199   6e-56    
gb|ADB93633.2|  indole-3-acetic acid inducible 16                       193   7e-56    
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       193   7e-56    
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     199   8e-56    
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    199   9e-56    
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           199   1e-55    
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             197   1e-55    
emb|CDY25617.1|  BnaA04g13090D                                          196   1e-55    
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      199   2e-55    
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like      198   2e-55    
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          197   2e-55    
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     196   2e-55    
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           199   2e-55    
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           198   2e-55    
gb|KHN08222.1|  Auxin-responsive protein IAA8                           198   2e-55    
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8           197   2e-55    
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    198   3e-55    
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          197   4e-55    



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 216/244 (89%), Gaps = 9/244 (4%)
 Frame = +1

Query  169  MGSMLAE-HGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQSAAD  339
            M +ML E HGGLNLKATELCLGLPGGGG    ++ESLK+TGKRGFSETVDLKLNLQ   +
Sbjct  1    MTTMLGEEHGGLNLKATELCLGLPGGGGCAGADTESLKITGKRGFSETVDLKLNLQPN-E  59

Query  340  SSLDLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksgg  516
              +DLKEKMK+P+KE  KDP+KPP+ KAQVVGWPPVR++RKNIMAQKS+ EEAA EK+G 
Sbjct  60   PVVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKNIMAQKSNTEEAAAEKAGS  119

Query  517  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNE  696
                 FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  GNYG QGMIDFMNE
Sbjct  120  SAA--FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--GNYGPQGMIDFMNE  175

Query  697  RKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKC  876
             KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKC
Sbjct  176  SKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKC  235

Query  877  KNRC  888
            K+RC
Sbjct  236  KSRC  239



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 196/251 (78%), Positives = 210/251 (84%), Gaps = 13/251 (5%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEVGRKM SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS
Sbjct  1    MEVGRKMSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQS  59

Query  331  AADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  495
              +S +DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMAQK+S EE 
Sbjct  60   K-ESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEG  118

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
                SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFTM  GNYGAQG
Sbjct  119  EKGSSGAA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTM--GNYGAQG  172

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            MIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA
Sbjct  173  MIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  232

Query  856  PRAVEKCKNRC  888
            PRA+EKCKNRC
Sbjct  233  PRAMEKCKNRC  243



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   343 bits (879),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 210/248 (85%), Gaps = 9/248 (4%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEVGRKMG +LAE  GLNLK TELCLGLPGGGGG +    K+TGKRGFSETVDLKLNLQ 
Sbjct  1    MEVGRKMGGLLAEEQGLNLKETELCLGLPGGGGGAD----KITGKRGFSETVDLKLNLQP  56

Query  331  AADSSLDLKEK--MKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaage  504
               ++LDLKE   M  P   P KDP+KPP+KAQVVGWPPVR++RKNIMA + S +E A +
Sbjct  57   NESAALDLKETSAMDKPVLPP-KDPVKPPAKAQVVGWPPVRSFRKNIMAHQKSSDEEAEK  115

Query  505  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMID  684
             +     AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  GNYG QGMID
Sbjct  116  AACSSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--GNYGTQGMID  173

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            FMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA
Sbjct  174  FMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRA  233

Query  865  VEKCKNRC  888
            +EKCK+RC
Sbjct  234  MEKCKSRC  241



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 204/245 (83%), Gaps = 13/245 (5%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  348
            M SML    G + K TELCLGLPGGGG  E+E+LK +GKRGFSETVDLKLNLQS  +S +
Sbjct  1    MSSMLGAERGFDFKETELCLGLPGGGG-GEAETLKASGKRGFSETVDLKLNLQSK-ESVV  58

Query  349  DLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            DL E +K P KE N     KDP KPP+KAQVVGWPPVR++RKNIMAQK+S EE     SG
Sbjct  59   DLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRSFRKNIMAQKNSSEEGEKGSSG  118

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
                  FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFTM  GNYGAQGMIDFMN
Sbjct  119  AA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTM--GNYGAQGMIDFMN  172

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  873
            E KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK
Sbjct  173  ESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEK  232

Query  874  CKNRC  888
            CKNRC
Sbjct  233  CKNRC  237



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 192/256 (75%), Positives = 211/256 (82%), Gaps = 15/256 (6%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHG--GLNLKATElclglpgggggNESES---LKVTGKRGFSETVDLK  315
            MEVGR M  MLAE    GLNLK TELCLGLPGGGGG ES +   +K+TGKRGFSETVDLK
Sbjct  1    MEVGRNMAGMLAEEHDDGLNLKETELCLGLPGGGGGGESTATDPIKITGKRGFSETVDLK  60

Query  316  LNL-QSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQks  480
            L L QS   ++LDLKE +K+ S E    P KDPIKPP+KAQVVGWPPVR++RKN M+ + 
Sbjct  61   LKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVRSFRKNAMSHQK  120

Query  481  speeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGN  660
            S +E A    G      FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFS+FTM AGN
Sbjct  121  SDKEEAACSGGAA----FVKVSMDGAPYLRKVDLKMYKSYQELSDALVKMFSAFTM-AGN  175

Query  661  YGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSE  840
            YG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSE
Sbjct  176  YGSQGMIDFMNEGKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSE  235

Query  841  AIGLAPRAVEKCKNRC  888
            AIGLAPRA+EKCK+RC
Sbjct  236  AIGLAPRAMEKCKSRC  251



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 191/243 (79%), Positives = 208/243 (86%), Gaps = 11/243 (5%)
 Frame = +1

Query  187  EHGGLNLKATElclglpgggggNESE----SLKVTGKRGFSETVDLKLNLQSAADSSLDL  354
            E  GLNLK TELCLGLPGGGGG   E    S+++TGKRGFSETVDLKLNLQS   SS+DL
Sbjct  2    EVHGLNLKETELCLGLPGGGGGGTGEITDQSMRITGKRGFSETVDLKLNLQSNDQSSVDL  61

Query  355  KEKMKSP-SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek--sgggg  522
             EK+K+P SKE N KDP+KPP+KAQVVGWPPVR +RKNIMAQK++ E  AGEK  S    
Sbjct  62   NEKVKNPPSKETNSKDPVKPPAKAQVVGWPPVRAFRKNIMAQKNNTEVEAGEKGSSSSSS  121

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNER  699
              AFVKV MDGAPYLRKVDLK+Y+SYQ+L+DALAKMFSSFTM  GNYG Q GMIDFMNE 
Sbjct  122  SVAFVKVSMDGAPYLRKVDLKIYKSYQELADALAKMFSSFTM--GNYGTQQGMIDFMNES  179

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK
Sbjct  180  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCK  239

Query  880  NRC  888
            +RC
Sbjct  240  SRC  242



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 205/257 (80%), Gaps = 16/257 (6%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATE------lclglpgggggNESESLKVTGKRGFSETVDL  312
            MEV RKM +ML     LN K TE         G  GGGGGNE E+ K TGKRGFSETVDL
Sbjct  1    MEVSRKMANMLGAERDLNFKETELCLGLPGGGGGGGGGGGNEVETPKTTGKRGFSETVDL  60

Query  313  KLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQ  474
            KLNLQS  ++ +DL + +++ SKE        KDP KPP+KAQVVGWPPVR+YRKNIMA 
Sbjct  61   KLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVRSYRKNIMAN  119

Query  475  ksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDA  654
            + +  E + +K+  GG A FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  
Sbjct  120  QKNSCEESDKKASSGGAA-FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--  176

Query  655  GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  834
            GNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG
Sbjct  177  GNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  236

Query  835  SEAIGLAPRAVEKCKNR  885
            SEAIGLAPRA+EKCK+R
Sbjct  237  SEAIGLAPRAMEKCKSR  253



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 181/210 (86%), Gaps = 10/210 (5%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSA-ADSSLDLKEKMKSPSKEP----NKDPIKPPSKAQVVGW  435
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +     NKD +KPP+KAQVVGW
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQVVGW  79

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR++RKN+MAQK++ EE     +       FVKVCMDGAPYLRKVDLKMY+SYQQLSD
Sbjct  80   PPVRSFRKNVMAQKNNTEETEKSSATAVA---FVKVCMDGAPYLRKVDLKMYKSYQQLSD  136

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            ALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM
Sbjct  137  ALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  194

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FVDSCKRLRIMKGSEAIGLAPRA+EKCK R
Sbjct  195  FVDSCKRLRIMKGSEAIGLAPRAMEKCKRR  224



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   320 bits (819),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 199/252 (79%), Gaps = 17/252 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclg----lpgggggNESESLKVTGKRGFSETVDLKL  318
            MEV RKM         LNLK TELCLG           +++    +  KRGFSETVDLKL
Sbjct  1    MEVSRKMD--------LNLKETELCLGLPGGEVRAAIADQNNIDSINKKRGFSETVDLKL  52

Query  319  NLQSAADSSLDLK-EKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspee  492
            NLQS   S LDLK +KMK+PSKE  NKD  KPP+KAQVVGWPPVR++RKNIMAQK S   
Sbjct  53   NLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFRKNIMAQKGSSIC  112

Query  493  aageksgg-ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGA  669
               E S G    AAFVKV MDGAPYLRKVDLKMY+SYQQLSDALAKMFSSFTM  GNYGA
Sbjct  113  EESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALAKMFSSFTM--GNYGA  170

Query  670  QGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  849
            QGMIDFMNERKLMDLLNSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIG
Sbjct  171  QGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIG  230

Query  850  LAPRAVEKCKNR  885
            LAPRA+EKCK+R
Sbjct  231  LAPRAMEKCKSR  242



>ref|XP_012069759.1| PREDICTED: auxin-responsive protein IAA14-like [Jatropha curcas]
 gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/241 (74%), Positives = 194/241 (80%), Gaps = 15/241 (6%)
 Frame = +1

Query  184  AEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  363
             E   LN K TELCLGLPGGG   E E+ K TGKRGF+ETVDLKLNLQ A D  +DL E 
Sbjct  8    GERADLNFKETELCLGLPGGGK-TEVETPKATGKRGFAETVDLKLNLQ-AKDGVMDLNEN  65

Query  364  MKSPSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  522
            +K+ SK+ N       KDP KPP+KAQVVGWPPVR+YRKNIMA + +  +   +      
Sbjct  66   IKNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPVRSYRKNIMANQKNNSDEGEKSLSAA-  124

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
               FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE K
Sbjct  125  ---FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--GNYGAQGMIDFMNESK  179

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+
Sbjct  180  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKS  239

Query  883  R  885
            R
Sbjct  240  R  240



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/250 (75%), Positives = 203/250 (81%), Gaps = 15/250 (6%)
 Frame = +1

Query  157  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA  336
            V RKM +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  
Sbjct  6    VSRKMPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKE  65

Query  337  DSSLDLKEKMKS-PSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  495
            D    L +K+K+  SKE N      K P KPP+KAQVVGWPPVR+YRKNIMAQKSS EE+
Sbjct  66   D----LNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEES  121

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
              + SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFSSFTM  G YG QG
Sbjct  122  TEKGSGCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTM--GYYGPQG  177

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            MIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA
Sbjct  178  MIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  237

Query  856  PRAVEKCKNR  885
            PRA+EKCKNR
Sbjct  238  PRAMEKCKNR  247



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 197/242 (81%), Gaps = 13/242 (5%)
 Frame = +1

Query  187  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  363
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  364  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg  519
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++AQK++ EE     +GG 
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGS  128

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
              A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE 
Sbjct  129  SAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMNES  185

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK
Sbjct  186  KLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCK  245

Query  880  NR  885
            +R
Sbjct  246  SR  247



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   315 bits (807),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 178/209 (85%), Gaps = 10/209 (5%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSA-ADSSLDLKEKMKSPSKE---PNKDPIKPPSKAQVVGWP  438
            K+ GKRGFSETVDLKLN Q+  + S++DLKEK+K+P+ +    NKD +KPP+KAQVVGWP
Sbjct  20   KIKGKRGFSETVDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDSVKPPAKAQVVGWP  79

Query  439  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  618
            PVR++RKN+MAQK++ E      +       FVKVCMDGAPYLRKVDLKMY+SYQQLSDA
Sbjct  80   PVRSFRKNVMAQKNNTEAEKSNATAAA----FVKVCMDGAPYLRKVDLKMYKSYQQLSDA  135

Query  619  LAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            LAKMFSSFTM  GNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MF
Sbjct  136  LAKMFSSFTM--GNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWVMF  193

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VDSCKRLRIMKGSEAIGLAPRA+EKCK R
Sbjct  194  VDSCKRLRIMKGSEAIGLAPRAMEKCKRR  222



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 200/245 (82%), Gaps = 13/245 (5%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  348
            M +ML     LNLK TELCLGLPGGG   E E+ + TGKRGFSET+DLKLNLQS  D + 
Sbjct  1    MPNMLGVERDLNLKETELCLGLPGGGTVPEPETPRATGKRGFSETIDLKLNLQSKEDLND  60

Query  349  DLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageks  510
            ++K      SKE N      KDP KPP+KAQVVGWPPVR+YRKNIMAQKSS EE+  + S
Sbjct  61   NVKN---IASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKSSSEESTEKGS  117

Query  511  ggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFM  690
            G      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFSSFTM  G YGAQGMIDFM
Sbjct  118  GCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFSSFTM--GYYGAQGMIDFM  173

Query  691  NERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVE  870
            NE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+E
Sbjct  174  NESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAME  233

Query  871  KCKNR  885
            KCKNR
Sbjct  234  KCKNR  238



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 200/257 (78%), Gaps = 19/257 (7%)
 Frame = +1

Query  148  SMEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETV  306
            SMEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETV
Sbjct  45   SMEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETV  104

Query  307  DLKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQ  474
            DLKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA 
Sbjct  105  DLKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMAN  163

Query  475  ksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDA  654
            + +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  
Sbjct  164  QKNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--  216

Query  655  GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  834
            GNYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKG
Sbjct  217  GNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKG  276

Query  835  SEAIGLAPRAVEKCKNR  885
            SEAIGLAPRA+EKCK+R
Sbjct  277  SEAIGLAPRAMEKCKSR  293



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 199/257 (77%), Gaps = 19/257 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETVD  309
            MEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  310  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  477
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119

Query  478  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAG  657
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  G
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--G  172

Query  658  NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGS  837
            NYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGS
Sbjct  173  NYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGS  232

Query  838  EAIGLAPRAVEKCKNRC  888
            EAIGLAPRA+EKCK+R 
Sbjct  233  EAIGLAPRAMEKCKSRA  249



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 199/257 (77%), Gaps = 19/257 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETVD  309
            MEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  310  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  477
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119

Query  478  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAG  657
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  G
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--G  172

Query  658  NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGS  837
            NYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGS
Sbjct  173  NYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGS  232

Query  838  EAIGLAPRAVEKCKNRC  888
            EAIGLAPRA+EKCK+R 
Sbjct  233  EAIGLAPRAMEKCKSRA  249



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 199/257 (77%), Gaps = 19/257 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETVD  309
            MEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTEHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  310  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  477
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQ+VGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSYRKNIMANQ  119

Query  478  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAG  657
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  G
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--G  172

Query  658  NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGS  837
            NYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGS
Sbjct  173  NYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGS  232

Query  838  EAIGLAPRAVEKCKNRC  888
            EAIGLAPRA+EKCK+R 
Sbjct  233  EAIGLAPRAMEKCKSRA  249



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 197/244 (81%), Gaps = 15/244 (6%)
 Frame = +1

Query  187  EHGGLNLKATElclgl-pgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK  363
            E   LN K TELCLGL    G  NE E+ K TGKRGF+ETVDLKLNLQ A +  +DL E 
Sbjct  10   ERADLNYKETELCLGLPGAVGVKNEVETHKATGKRGFAETVDLKLNLQ-AKEGVMDLNEN  68

Query  364  MKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg  519
            +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN++AQK++ EE     +GG 
Sbjct  69   IKNIASKDKNQLPAATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGEKASTGGS  128

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
              A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE 
Sbjct  129  SAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMNES  185

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--APRAVEK  873
            KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL  APRA+EK
Sbjct  186  KLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLVSAPRAMEK  245

Query  874  CKNR  885
            CK+R
Sbjct  246  CKSR  249



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 175/207 (85%), Gaps = 8/207 (4%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP-NKDPIKPPSKAQVVGWPPVRN  450
            +T KRGFSETVDLKLNLQS  D S   KEK+K+PSKE  NKD  KPP+K QVVGWPPVR+
Sbjct  42   ITKKRGFSETVDLKLNLQSNLDLS---KEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRS  98

Query  451  YRKNIMAQksspeeaageksg--gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  624
            YRKNIMAQK        E S       AAFVKV MDGAPYLRKVDLKMY+SYQQLSDALA
Sbjct  99   YRKNIMAQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALA  158

Query  625  KMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  804
             MFSSFTM  GNYGAQGMIDFMNERKLMDLLNSS+YVPTYEDKDGDWMLVGDVPW+MFVD
Sbjct  159  NMFSSFTM--GNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWQMFVD  216

Query  805  SCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  217  SCKRLRIMKGSEAIGLAPRAMEKCKSR  243



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 187/235 (80%), Gaps = 11/235 (5%)
 Frame = +1

Query  196  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  360
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  540
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  541  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLN  720
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT   GNYGAQGMIDFMNE KLMDLLN
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFT--TGNYGAQGMIDFMNESKLMDLLN  180

Query  721  SSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  181  SSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR  235



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 179/250 (72%), Positives = 198/250 (79%), Gaps = 17/250 (7%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggg-------gNESESLKVTGKRGFSETVDLKLNLQ  327
            M +ML +  GLNLK TELCLGLPGG         G+E E+ + TGKRGFSETVDLKLNL 
Sbjct  1    MATMLTKEHGLNLKETELCLGLPGGELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLH  60

Query  328  SAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA--Qksspeea  495
            S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA  + S+ + A
Sbjct  61   SKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEDVA  116

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
                S      AFVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTM  GNYGAQG
Sbjct  117  EKTTSSTANSGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTM--GNYGAQG  174

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            MIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLA
Sbjct  175  MIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLA  234

Query  856  PRAVEKCKNR  885
            PRA+EKCK+R
Sbjct  235  PRAMEKCKSR  244



>ref|XP_011649168.1| PREDICTED: auxin-responsive protein IAA14 [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 180/221 (81%), Gaps = 16/221 (7%)
 Frame = +1

Query  265  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  402
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKASGKRGFSETVDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPA  96

Query  403  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            KPP+KAQVVGWPPVR+YRKN+MAQK++      EK  GG  AAFVKVCMDGAPYLRKVDL
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMAQKNTSGGEGTEKGNGGSSAAFVKVCMDGAPYLRKVDL  156

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            KMY+SYQ+LSDALAKMFSSFTM  G YG QGMIDFMNERKLMDLLNSSE+VPTYEDKDGD
Sbjct  157  KMYQSYQELSDALAKMFSSFTM--GEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGD  214

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  215  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  255



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 174/249 (70%), Positives = 194/249 (78%), Gaps = 16/249 (6%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATE--------lclglpgggggNESESLKVTGKRGFSETVDLKLNL  324
            M +ML +   LNLK TE           G  GGGGG+E E+ + TGKRGFSETVDLKLNL
Sbjct  1    MATMLGKEHHLNLKETELCLGLPGAGGGGGSGGGGGSEVETPRATGKRGFSETVDLKLNL  60

Query  325  QSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaa  498
            Q+  D    L E +K+  +E    KDP K P+KAQVVGWPPVR+YRKN+M QK S E+ A
Sbjct  61   QAKED----LNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNMMTQKVSTEDGA  116

Query  499  geksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGM  678
             + +      AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTM  GNYGAQGM
Sbjct  117  EKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTM--GNYGAQGM  174

Query  679  IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP  858
            IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAP
Sbjct  175  IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAP  234

Query  859  RAVEKCKNR  885
            RA+EKCK+R
Sbjct  235  RAMEKCKSR  243



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 198/244 (81%), Gaps = 14/244 (6%)
 Frame = +1

Query  184  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  357
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  358  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +G
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTG  126

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
            G   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMN
Sbjct  127  GSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMN  183

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  873
            E KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR+MKGSEAIGLAPRA+EK
Sbjct  184  ESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLAPRAMEK  243

Query  874  CKNR  885
            CK+R
Sbjct  244  CKSR  247



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 174/250 (70%), Positives = 190/250 (76%), Gaps = 19/250 (8%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEV RKM +ML     L L             GG E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPG-----------GGAEPETPKANGKRGFSETVDLKLNIQS  49

Query  331  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  495
                ++DL  K    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+QKS     
Sbjct  50   KTGVTVDLTPKNSDTSTDEENLITSKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSPDSGE  109

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
             G  SGG     FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM AG+YGAQG
Sbjct  110  KGGSSGGSAM--FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTM-AGDYGAQG  166

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            MIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA
Sbjct  167  MIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  226

Query  856  PRAVEKCKNR  885
            PRA+EKCK+R
Sbjct  227  PRAMEKCKSR  236



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   310 bits (795),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/221 (74%), Positives = 179/221 (81%), Gaps = 16/221 (7%)
 Frame = +1

Query  265  SLKVTGKRGFSETVDLKLNLQS-------AADSSLDLKEKMKSPSKEPN-------KDPI  402
            SLK +GKRGFSETVDLKLNLQS            +DL E +K+ S   +       KDP 
Sbjct  37   SLKSSGKRGFSETVDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSKDPA  96

Query  403  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            KPP+KAQVVGWPPVR+YRKN+MAQK++      EK   G  AAFVKVCMDGAPYLRKVDL
Sbjct  97   KPPAKAQVVGWPPVRSYRKNVMAQKNTSGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDL  156

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            KMY+SYQ+LSDALAKMFSSFTM  G YG QGMIDFMNERKLMDLLNSSE+VPTYEDKDGD
Sbjct  157  KMYQSYQELSDALAKMFSSFTM--GEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGD  214

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  215  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  255



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 187/235 (80%), Gaps = 11/235 (5%)
 Frame = +1

Query  196  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  360
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  540
            K  S  K   KDP KPP+KAQVVGWPPVR+Y+KN+MAQK +  E   + +     A FVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMAQKVNNTEDTEKTTSNTTAAVFVK  122

Query  541  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLN  720
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT+  GNYGAQGMIDFMNE KLMDLLN
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFTI--GNYGAQGMIDFMNESKLMDLLN  180

Query  721  SSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  181  SSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNR  235



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 185/220 (84%), Gaps = 13/220 (6%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIK  405
            NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E +K+  SK+ N       KDP K
Sbjct  32   NEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNENIKNITSKDKNHLPAVTIKDPAK  90

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+KAQVVGWPPVR+YRKN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLK
Sbjct  91   PPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLK  149

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDW
Sbjct  150  MYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDW  207

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  208  MLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 190/244 (78%), Gaps = 11/244 (5%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  348
            M +ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D   
Sbjct  1    MTTMLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED---  57

Query  349  DLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  522
             L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +    E   EK+    
Sbjct  58   -LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSNEEVAEKTTSST  116

Query  523  pa---aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
             A   AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTM  GNYGAQGMIDFMN
Sbjct  117  IANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTM--GNYGAQGMIDFMN  174

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  873
            E KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EK
Sbjct  175  ESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEK  234

Query  874  CKNR  885
            CK+R
Sbjct  235  CKSR  238



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14 [Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 172/250 (69%), Positives = 189/250 (76%), Gaps = 19/250 (8%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEV RKM +ML     L L                E E+ K  GKRGFSETVDLKLN+QS
Sbjct  1    MEVSRKMVNMLETDLCLGLPGGGA-----------EPETPKANGKRGFSETVDLKLNIQS  49

Query  331  AADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea  495
                ++DL  +    S +      +KDP KPP+KAQVVGWPPVR+YRKN M+QKSS    
Sbjct  50   KPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVRSYRKNAMSQKSSEAGE  109

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
             G  SGG     FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM AG+YGAQG
Sbjct  110  KGGSSGGSAM--FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTM-AGDYGAQG  166

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            MIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA
Sbjct  167  MIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  226

Query  856  PRAVEKCKNR  885
            PRA+EKCK+R
Sbjct  227  PRAMEKCKSR  236



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 185/220 (84%), Gaps = 13/220 (6%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIK  405
            NE E+  K TGKRGF+ETVDLKLNLQ A D  +DL + +K+  SK+ N       KDP K
Sbjct  32   NEVETPNKATGKRGFAETVDLKLNLQ-AKDGVMDLNDNIKNITSKDKNHLPAAAIKDPAK  90

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+KAQVVGWPPVR+YRKN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLK
Sbjct  91   PPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKTSTGGSSAA-FVKVCMDGAPYLRKVDLK  149

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDW
Sbjct  150  MYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDW  207

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  208  MLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/244 (68%), Positives = 189/244 (77%), Gaps = 10/244 (4%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATEl-clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  345
            M +++ +  GLNLK TEL      GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  346  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea--ageksg  513
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  +     + + 
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNSDQDGNEKTTS  117

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
                  FVKV MDGAPYLRKVDL MY +Y+ LSDALAKMFSSFT   G YGAQGMIDFMN
Sbjct  118  STTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFT--TGKYGAQGMIDFMN  175

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  873
            E KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK
Sbjct  176  ESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEK  235

Query  874  CKNR  885
            CKNR
Sbjct  236  CKNR  239



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 177/212 (83%), Gaps = 15/212 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMKS---PSKE--PNKDPIKPPSKAQVV  429
            KV GKRGFSETVDLKLN   A+D  S      KMKS    +KE   NKDPIKPP+KAQVV
Sbjct  32   KVNGKRGFSETVDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVV  91

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN+MAQKS+ EE+    +       FVKVCMDGAPYLRKVDLKMY+SYQ+L
Sbjct  92   GWPPVRSFRKNVMAQKSNTEESEKTTAA------FVKVCMDGAPYLRKVDLKMYKSYQEL  145

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT   GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW
Sbjct  146  SDALAKMFSSFT--NGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  203

Query  790  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  204  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  235



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/253 (70%), Positives = 196/253 (77%), Gaps = 19/253 (8%)
 Frame = +1

Query  166  KMGSMLAEHGGLNLKATE---------lclglpgggggNESESLKVTGKRGFSETVDLKL  318
            +M +ML +  GLNLK TE            G  GGGGG E E+ + TGKRGFSETVDLKL
Sbjct  84   EMATMLTKEHGLNLKETELCLGLPGGGGGGGGGGGGGGGEVETPRATGKRGFSETVDLKL  143

Query  319  NLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMA--Qkssp  486
            NL S  D    L E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA  + S+ 
Sbjct  144  NLHSKED----LNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTE  199

Query  487  eeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYG  666
            + A    S    P AFVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTM  GNYG
Sbjct  200  DVAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTM--GNYG  257

Query  667  AQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI  846
            AQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAI
Sbjct  258  AQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAI  317

Query  847  GLAPRAVEKCKNR  885
            GLAPRA+EKCK+R
Sbjct  318  GLAPRAMEKCKSR  330



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  429
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHLPAKPPAKAQVL  96

Query  430  GWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            GWPPVR+YRKNIMA QK++ +E +   S G G AAFVKVCMDGAPYLRKVDLKMY SYQ+
Sbjct  97   GWPPVRSYRKNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQK  156

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  786
            LSDALAKMFSSFTM  G+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVP
Sbjct  157  LSDALAKMFSSFTM--GSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVP  214

Query  787  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  215  WEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVV  429
            NE ES  K TGKRG+SETVDLKLNLQS  +  +DL + +++ SKE N  P KPP+KAQV+
Sbjct  38   NEVESSPKTTGKRGYSETVDLKLNLQSK-EGCMDLNQNLENGSKEKNHHPAKPPAKAQVL  96

Query  430  GWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            GWPPVR+YRKNIMA QK++ +E +   S G G AAFVKVCMDGAPYLRKVDLKMY SYQ+
Sbjct  97   GWPPVRSYRKNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQK  156

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  786
            LSDALAKMFSSFTM  G+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVP
Sbjct  157  LSDALAKMFSSFTM--GSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVP  214

Query  787  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  215  WEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 201/253 (79%), Gaps = 18/253 (7%)
 Frame = +1

Query  157  VGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS-A  333
            VGRKM  +     GLN   TELCLGLPGGGGG  ++ +K TGKRGFSETVDLKLNLQS  
Sbjct  4    VGRKMAGL----HGLNFMETELCLGLPGGGGGESTDPIKTTGKRGFSETVDLKLNLQSNE  59

Query  334  ADSSLDLKEKMKSPSKE-----PNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspe---  489
              SS DL   +   S E     P KDPIKPP+KAQVVGWPPVR++RKNI++ + S     
Sbjct  60   PPSSSDL---INISSTEINAMLPPKDPIKPPAKAQVVGWPPVRSFRKNIISHQKSSSPAD  116

Query  490  eaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGA  669
            +   +K+     AAFVKV MDGAPYLRKVDLKMY +YQ+LSDALAKMFSSFTM  GNYG+
Sbjct  117  QQDSDKAAAACSAAFVKVSMDGAPYLRKVDLKMYGAYQELSDALAKMFSSFTM--GNYGS  174

Query  670  QGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  849
            +GMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIG
Sbjct  175  EGMIDFMNEGKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIG  234

Query  850  LAPRAVEKCKNRC  888
            LAPRA+EKCK+RC
Sbjct  235  LAPRAMEKCKSRC  247



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 184/231 (80%), Gaps = 4/231 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATELCLGLPGGTEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEEAVDLNNIAAAP  65

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  555
             +   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +           G  AA VKV MDG
Sbjct  66   KESLLKDPTKPPAKAQVVGWPPVRNYRKNMMTQQKTTGSEEASSDKAGTGAALVKVSMDG  125

Query  556  APYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYV  735
            APYLRKVDL MY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYV
Sbjct  126  APYLRKVDLNMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYV  183

Query  736  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            P+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  184  PSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  234



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 198/246 (80%), Gaps = 16/246 (7%)
 Frame = +1

Query  184  AEHGGLNLKATElclgl-pgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLK  357
            AE   LN K TELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL 
Sbjct  8    AERTDLNYKETELCLGLPGAVGAKNEVETPSKATGKRGFAETVDLKLNLQ-AKEGVMDLN  66

Query  358  EKMKS-PSKEPN-------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            E +K+  SK+ N       KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE     +G
Sbjct  67   ENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPPVRSYRKNVMAQKNASEEGEKASTG  126

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
            G   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMN
Sbjct  127  GSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFSSFTM--GNYGAQGMIDFMN  183

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--APRAV  867
            E KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR+MKGSEAIGL  APRA+
Sbjct  184  ESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRLMKGSEAIGLVSAPRAM  243

Query  868  EKCKNR  885
            EKCK+R
Sbjct  244  EKCKSR  249



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 169/210 (80%), Gaps = 7/210 (3%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  435
            ES +     KRGFSETVDLKLNLQ+  +  +DL    K  S   +KD  KPP+KAQVVGW
Sbjct  32   ESPAKAAGNKRGFSETVDLKLNLQTNKEGVVDLNNVAKDKSLLVSKDHAKPPAKAQVVGW  91

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVRNYRKN+MA + S      + +       FVKV MDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  92   PPVRNYRKNMMAHQKSSAVEEEKAAAA-----FVKVSMDGAPYLRKVDLKMYKSYQELSD  146

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            ALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW+M
Sbjct  147  ALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQM  204

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  234



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 175/212 (83%), Gaps = 15/212 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAAD--SSLDLKEKMK---SPSKE--PNKDPIKPPSKAQVV  429
            K+ GKRGFSETVDLKLN   A D  S      KMK   + +KE   NKDPIKPP+KAQVV
Sbjct  34   KINGKRGFSETVDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVV  93

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN+MAQKS+ EE+            FVKVCMDGAPYLRKVDLKMY+SYQ+L
Sbjct  94   GWPPVRSFRKNVMAQKSNTEESEKTTVA------FVKVCMDGAPYLRKVDLKMYKSYQEL  147

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT   GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW
Sbjct  148  SDALAKMFSSFT--NGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  205

Query  790  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  206  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  237



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/237 (75%), Positives = 191/237 (81%), Gaps = 12/237 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSET-VDLKLNLQSA-ADSSLDLKEKMKS  372
            LN K TELCLGLPGGGGG E E+ + TGKRGFSET VDLKLNLQ+  A S +DLKE MKS
Sbjct  10   LNFKETELCLGLPGGGGGAEVEAPRATGKRGFSETEVDLKLNLQAKDASSVVDLKEAMKS  69

Query  373  PSK------EPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaF  534
              K       P KDP KPP+KAQVVGWPPVR+YRKN+M   +       E+      AAF
Sbjct  70   NEKTLLAGASPAKDPAKPPAKAQVVGWPPVRSYRKNMMV--AQKSTDPEEEKEKAAAAAF  127

Query  535  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDL  714
            VKV MDGAPYLRKVDLK Y SY+QLSDAL KMFSSFTM  G+YGAQGMIDFMNE KLMDL
Sbjct  128  VKVSMDGAPYLRKVDLKNYSSYKQLSDALGKMFSSFTM--GSYGAQGMIDFMNESKLMDL  185

Query  715  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LNSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  186  LNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  242



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 199/245 (81%), Gaps = 8/245 (3%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggN--ESESLKVTGKRGFSETVDLKLNLQSAADS  342
            M SML     LNL+ TELCLGLPGGG     E E+ K TGKRGFSETVDLKLNLQS  D 
Sbjct  1    MTSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETVDLKLNLQSKEDL  60

Query  343  SLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIM+QK++ EE   + SG
Sbjct  61   NDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMSQKNTSEEKTEKASG  120

Query  514  ggg-paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFM  690
            GGG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+AL+KMFSSFT   G YG QGMIDFM
Sbjct  121  GGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALSKMFSSFT--TGYYGTQGMIDFM  178

Query  691  NERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVE  870
            NE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAP+A+E
Sbjct  179  NESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPKAME  238

Query  871  KCKNR  885
            KCK R
Sbjct  239  KCKGR  243



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/244 (71%), Positives = 191/244 (78%), Gaps = 7/244 (3%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  342
            M SML     LNL+  ELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLREAELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  343  SLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKN+MAQK++ EE   + S 
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNVMAQKNTSEEKTKKASA  120

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
            GG  AAFVKVCMDGAPYLRKVDLKMY SYQ+LS+ALAKMFSSFT   G YG QGMIDFMN
Sbjct  121  GGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNALAKMFSSFT--TGYYGDQGMIDFMN  178

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  873
            E KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW M VDSCKRLRIMKGSEAIG+AP+A+EK
Sbjct  179  ESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGIAPKAMEK  238

Query  874  CKNR  885
            CK R
Sbjct  239  CKGR  242



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/245 (72%), Positives = 194/245 (79%), Gaps = 8/245 (3%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclgl--pgggggNESESLKVTGKRGFSETVDLKLNLQSAADS  342
            M SML     LNL+ TELCLGL   G     E E+ K TGKRGFSET+DLKLNLQS  D 
Sbjct  1    MMSMLGVERDLNLRETELCLGLPGGGTTTVAEPETAKTTGKRGFSETIDLKLNLQSKEDL  60

Query  343  SLDLKE---KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg  513
            + ++K    K K+      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE   + SG
Sbjct  61   NDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEKTKKASG  120

Query  514  gg-gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFM  690
            GG   AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFT   G YG QGMIDFM
Sbjct  121  GGGCTAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFT--TGYYGTQGMIDFM  178

Query  691  NERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVE  870
            NE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW M VDSCKRLRIMKGSEAIGLAP+A+E
Sbjct  179  NESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSCKRLRIMKGSEAIGLAPKAME  238

Query  871  KCKNR  885
            KCK R
Sbjct  239  KCKGR  243



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 196/248 (79%), Gaps = 14/248 (6%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESE-SLKVTGKRGFSETVDLKLNLQSAADSS  345
            M SML     LNL+ TELCLGLPGGG    +E   K TGKRGFSETVDLKL LQS  D +
Sbjct  1    MTSMLGVECDLNLRETELCLGLPGGGTSTVAEPETKATGKRGFSETVDLKLKLQSKDDLN  60

Query  346  LDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek  507
             ++K      S+E N      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE   + 
Sbjct  61   DNVKN---IASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEENTEKA  117

Query  508  sggg--gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMI  681
            + GG    AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFT   G YGAQGMI
Sbjct  118  TVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFT--TGYYGAQGMI  175

Query  682  DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPR  861
            DFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAP+
Sbjct  176  DFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPK  235

Query  862  AVEKCKNR  885
            A EKCK R
Sbjct  236  AXEKCKGR  243



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 194/247 (79%), Gaps = 14/247 (6%)
 Frame = +1

Query  169  MGSMLAE-HGGLNLKATElc----lglpgggggNESESLKVTGKRGFSETVDLKLNLQSA  333
            M ++L +    LNLK TELC     G  GGGG ++ E+ +  GKRGFSETVDLKLNLQS 
Sbjct  1    MATLLGKVQNDLNLKETELCLGLPGGGGGGGGSDQVETPRSNGKRGFSETVDLKLNLQSK  60

Query  334  ADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaagek  507
             D    L + +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+M QK + E+   EK
Sbjct  61   ED----LNDDVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMVQKVNNEDQGTEK  116

Query  508  sggggpa-aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMID  684
            +       AF KV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTM  GNYGAQGMID
Sbjct  117  TTSSTAGGAFAKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTM--GNYGAQGMID  174

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            FMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA
Sbjct  175  FMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRA  234

Query  865  VEKCKNR  885
            +EKCKNR
Sbjct  235  MEKCKNR  241



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 197/259 (76%), Gaps = 18/259 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEV RKM   +AE  GLN K TELCLGLPGGGGG E +++K+ GKRGFSETVDLKLNLQS
Sbjct  1    MEVCRKM---VAEERGLNFKETELCLGLPGGGGGGEPDAVKINGKRGFSETVDLKLNLQS  57

Query  331  AADSSLDLKEKMKSPSKEPNKDPIKPPS-------------KAQVVGWPPVRNYRKNIMA  471
               +S DL       + + N    K  +             KAQVVGWPPVR++RKNI+ 
Sbjct  58   NDSASTDLNNGGGGGAMKNNNSAEKTAANMVPPKDPVKPPAKAQVVGWPPVRSFRKNIVM  117

Query  472  QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMD  651
                   +  E  GGG  AAFVKV MDGAPYLRKVDLKMY+SYQ+ SDALAKMFSSFTM 
Sbjct  118  SHQKNSSSDEEAGGGGAAAAFVKVSMDGAPYLRKVDLKMYKSYQEFSDALAKMFSSFTM-  176

Query  652  AGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMK  831
             G YG++GMIDFMNERKLMD+LNS+EYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK
Sbjct  177  -GKYGSEGMIDFMNERKLMDVLNSTEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMK  235

Query  832  GSEAIGLAPRAVEKCKNRC  888
            GSEAIGLAPRA+EKCK+RC
Sbjct  236  GSEAIGLAPRAMEKCKSRC  254



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 187/231 (81%), Gaps = 4/231 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS   + +DL     S 
Sbjct  1    MNLKETELCLGLPGGLETVESPAKSGVGNKRGFSETVDLKLNLQSNKQAPIDLNVAGTSR  60

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMD  552
             K   KDP KPP+KAQVVGWPPVRNYRKNIMA QKSS E       GGGG  AFVKV MD
Sbjct  61   EKTLLKDPSKPPAKAQVVGWPPVRNYRKNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMD  120

Query  553  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEY  732
            GAPYLRKVDLKMY SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEY
Sbjct  121  GAPYLRKVDLKMYNSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNETKVMDLLNSSEY  178

Query  733  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  179  VPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  229



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 187/247 (76%), Gaps = 39/247 (16%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN-------KDPIK  405
            NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E +K+  SK+ N       KDP K
Sbjct  33   NEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNENIKNIASKDKNHLPADTIKDPAK  91

Query  406  PPSKAQVVGWPPVRNYRKNIMAQkss---------------------------peeaage  504
            PP+KAQVVGWPPVR+YRKN++AQK++                             E   +
Sbjct  92   PPAKAQVVGWPPVRSYRKNVLAQKNASEEGFRAQVVGWPPLRSYRKNVLTQKNASEEGDK  151

Query  505  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMID  684
             S GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  GNYGAQGMID
Sbjct  152  ASTGGSSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--GNYGAQGMID  209

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            FMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA
Sbjct  210  FMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  269

Query  865  VEKCKNR  885
            +EKCK+R
Sbjct  270  MEKCKSR  276



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 167/207 (81%), Gaps = 8/207 (4%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVR  447
            V  KRGFSETVDL LNLQS  + S+DL     SP KE N  KDP KPP+KAQVVGWPPVR
Sbjct  83   VGSKRGFSETVDLMLNLQSNKEGSVDLNNVAASP-KEKNLIKDPAKPPAKAQVVGWPPVR  141

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            NYRKNIM Q+ +           G     VKV MDGAPYLRKVDLKMY+SYQ LSDALAK
Sbjct  142  NYRKNIMTQQKTSGTEEASSEKAGAG--LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAK  199

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MFSSFTM  GNYGAQGMIDFMNE KLM+LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+S
Sbjct  200  MFSSFTM--GNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVES  257

Query  808  CKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            CKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  258  CKRLRIMKGSEAIGLAPRAMEKYCKNR  284



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 186/239 (78%), Gaps = 12/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  1    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  60

Query  376  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa-------  531
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +   A    S   G          
Sbjct  61   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  120

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+
Sbjct  121  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMN  178

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  179  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  237



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 176/210 (84%), Gaps = 14/210 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  435
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  37   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  93

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR++RKN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSD
Sbjct  94   PPVRSFRKNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSD  149

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            AL+KMFSSFT   G YGAQGMIDFMNE KLMDLLNS+EYVPTYEDKDGDWMLVGDVPWEM
Sbjct  150  ALSKMFSSFT--TGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDKDGDWMLVGDVPWEM  207

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  208  FVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  237



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   297 bits (760),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 186/239 (78%), Gaps = 12/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DLK     P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVP  65

Query  376  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa-------  531
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +   A    S   G          
Sbjct  66   KEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAG  125

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMN  183

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEA+GLAPRA+EK CKNR
Sbjct  184  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNR  242



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 186/239 (78%), Gaps = 13/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  376  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  531
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMN  182

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  183  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 184/238 (77%), Gaps = 11/238 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL     +P
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNNVAAAP  65

Query  376  SKEPN-KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------F  534
             ++   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +           G           
Sbjct  66   KEKTTLKDPSKPPTKAQVVGWPPVRNYRKNMMTQQKTSGVEEASSEKAGSGGGGAAGAGL  125

Query  535  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDL  714
            VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+L
Sbjct  126  VKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMNL  183

Query  715  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  184  LNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 186/239 (78%), Gaps = 13/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NL+ATELCLGLPGG    ES +    G KRGFSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLRATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  376  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  531
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMN  182

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  183  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 175/210 (83%), Gaps = 14/210 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS-PSKEPN----KDPIKPPSKAQVVGW  435
            K TGKRGFSETVDLKLNL   A+  L + E +K+  S+E N    KDP KPP+KAQVVGW
Sbjct  30   KATGKRGFSETVDLKLNLH--ANEGL-MNESVKNVSSREKNLPCIKDPAKPPAKAQVVGW  86

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR+YRKN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSD
Sbjct  87   PPVRSYRKNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSD  142

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            AL+KMFSSFT   G YG QGMIDFMNE KLMDLLNS++YVPTYEDKDGDWMLVGDVPWEM
Sbjct  143  ALSKMFSSFT--TGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDKDGDWMLVGDVPWEM  200

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  201  FVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  230



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 185/239 (77%), Gaps = 13/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG    ES +    G KR FSETVDL LNLQS  + S+DL   + + 
Sbjct  6    MNLKATELCLGLPGGAEAVESPAKSAVGSKRSFSETVDLMLNLQSNKEGSVDLNN-VAAS  64

Query  376  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  531
            +KE    KDP KPP+KAQVVGWPPVRNYRKNIM Q+ +           G  +       
Sbjct  65   TKEKTLLKDPAKPPAKAQVVGWPPVRNYRKNIMTQQKASGTEEASSEKAGSGSGGAAGAG  124

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMN  182

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  183  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 185/239 (77%), Gaps = 13/239 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNES-ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCLGLPGG   NE+ E   V  KRGFSETVDL LNLQS  + ++DL   + S 
Sbjct  6    INLKATELCLGLPGGAEANENLEKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASA  64

Query  376  SKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------  531
            SK+    KDP KPP+KAQVVGWPPVRNYRKNI+ Q+ +  +        G          
Sbjct  65   SKDKTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAA  124

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
             VKV MDGAPYLRKVDLKMY+SY+  SDALAKMFSSFTM  G YGAQGMIDFMNE KLMD
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYKDFSDALAKMFSSFTM--GKYGAQGMIDFMNESKLMD  182

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            LLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  183  LLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 190/235 (81%), Gaps = 8/235 (3%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKAT+LCLGLPGG    ES +    G KRGFSETVDL LNLQS  + ++DL     +P
Sbjct  6    MNLKATDLCLGLPGGAEAVESPAKSAVGNKRGFSETVDLMLNLQSNKEGTVDLNNVSAAP  65

Query  376  -SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQkssp---eeaageksggggpaaFVKV  543
              K   KD  KPP+KAQVVGWPPVRNYRKNIM Q+ +    E ++ +   GGG AA VKV
Sbjct  66   KEKTLLKDHSKPPAKAQVVGWPPVRNYRKNIMTQQKTSGVEEASSEKAGSGGGAAALVKV  125

Query  544  CMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNS  723
             MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+LLNS
Sbjct  126  SMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMNLLNS  183

Query  724  SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            SEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  184  SEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  238



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 167/206 (81%), Gaps = 6/206 (3%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            V  KRGFSETVD KLNLQS     +DL   +    KE  KDP KPP+KAQVVGWPPVRNY
Sbjct  55   VGNKRGFSETVDFKLNLQSNKQGHVDLN--VTVAHKEKTKDPAKPPAKAQVVGWPPVRNY  112

Query  454  RKNIMAQksspeeaagek--sggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            RK++MA + S E         G GG  AFVKV MDGAPYLRKVDLKMY+SY+ LSDALAK
Sbjct  113  RKSVMAHQKSSEVEEASSCGGGRGGTVAFVKVSMDGAPYLRKVDLKMYKSYKDLSDALAK  172

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDGDWMLVGDVPW MFV+S
Sbjct  173  MFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVES  230

Query  808  CKRLRIMKGSEAIGLAPRAVEKCKNR  885
            CKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  231  CKRLRIMKGSEAIGLAPRAMEKCKNR  256



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 175/270 (65%), Positives = 195/270 (72%), Gaps = 40/270 (15%)
 Frame = +1

Query  187  EHGGLNLKATElclgl-pgggggNESESL-KVTGKRGFSETVDLKLNLQSAADSSLDLKE  360
            E   LN KATELCLGL    G  NE E+  K TGKRGF+ETVDLKLNLQ A +  +DL E
Sbjct  10   ERADLNYKATELCLGLPGAVGVKNEVETPNKATGKRGFAETVDLKLNLQ-AKEGVMDLNE  68

Query  361  KMKSPSKEPN--------KDPIKPPSKAQVVGWPPVRNYRKNIMAQkss-----------  483
             + + + E          KDP KPP+KAQVVGWPPVR+YRKN++AQK++           
Sbjct  69   NINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPPVRSYRKNVLAQKNASEEGFGAQVEG  128

Query  484  ----------------peeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
                              E   + S GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSD
Sbjct  129  WPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  188

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            ALAKMFSS TM  GNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEM
Sbjct  189  ALAKMFSSLTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEM  246

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FVDSCKR RIMKGSEA+GLAPRA+EKCK+R
Sbjct  247  FVDSCKRPRIMKGSEAVGLAPRAMEKCKSR  276



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 164/204 (80%), Gaps = 3/204 (1%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  83

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN+MA + + E      S GG  A FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  84   RKNVMANQKNGETDEAMSSAGGTVA-FVKVSMDGAPYLRKVDLKMYNSYKNLSDALAKMF  142

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDGDWMLVGDVPW MFV+SCK
Sbjct  143  SSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCK  200

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKGSE+IGLAPRA+EKCKNR
Sbjct  201  RLRIMKGSESIGLAPRAMEKCKNR  224



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 181/233 (78%), Gaps = 6/233 (3%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESES-LKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NL ATELCLGLPGG    ES +   V  KRGFSET+DL LNLQ   + ++DL     S 
Sbjct  6    MNLNATELCLGLPGGTKAVESPAKSSVRNKRGFSETMDLMLNLQCNKEETVDLNNATASK  65

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggp--aaFVKVCM  549
             K   KDP KPP+KAQVVGWPPVRNYRKN+M Q+ +  E        G    AA VKV M
Sbjct  66   EKTLLKDPAKPPAKAQVVGWPPVRNYRKNMMTQQKTSGEEEASSEKAGNGGGAALVKVSM  125

Query  550  DGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSE  729
            DGAPYLRKVDL MY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLM+LLNSSE
Sbjct  126  DGAPYLRKVDLTMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMNLLNSSE  183

Query  730  YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            YVP+YEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  184  YVPSYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAMEKYCKNR  236



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 171/211 (81%), Gaps = 25/211 (12%)
 Frame = +1

Query  271  KVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKSP---SKEPNKDPIKPPS-KAQVVG  432
            K + KRGF ET  +DLKLNLQS  +SS+DL E  K+P   +K  +KDP KP + KAQVVG
Sbjct  40   KASNKRGFCETAVIDLKLNLQSK-ESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVG  98

Query  433  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  612
            WPPVR+YRKN MA+ ++                FVKVCMDGAPYLRKVDLK Y+SYQ+LS
Sbjct  99   WPPVRSYRKNAMAETAA----------------FVKVCMDGAPYLRKVDLKTYKSYQELS  142

Query  613  DALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            DALAKMFSSFTM  GNYG+QGMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVPWE
Sbjct  143  DALAKMFSSFTM--GNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWE  200

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFVDSCKR+RIMKGSEAIGLAPRA+EKCK+R
Sbjct  201  MFVDSCKRMRIMKGSEAIGLAPRAMEKCKSR  231



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 182/230 (79%), Gaps = 4/230 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  555
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDG  119

Query  556  APYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYV  735
            APYLRKVDLKMY SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYV
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYV  177

Query  736  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            P+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR
Sbjct  178  PSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNR  227



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  27   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPAKPPAKAQVVGWPPVRNY  86

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN+MA   + E      S GG  A FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  87   RKNVMANHKNGEPDEAMSSAGGTVA-FVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  145

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDGDWMLVGDVPW MFV+SCK
Sbjct  146  SSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCK  203

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKGSEA+GLAPRA+EKCKNR
Sbjct  204  RLRIMKGSEAVGLAPRAMEKCKNR  227



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 168/209 (80%), Gaps = 13/209 (6%)
 Frame = +1

Query  265  SLKVTG-KRGFSETVDLKLNLQS-AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWP  438
            S K  G KRGFSETVDLKLNLQ+   +  +DL    K      +KDP KPPSKAQVVGWP
Sbjct  31   SAKAAGNKRGFSETVDLKLNLQTNKQEGVMDLTNASKV-----SKDPAKPPSKAQVVGWP  85

Query  439  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  618
            PVRNYRKN+MA + +      EK+       FVKV MDGAPYLRKVDLKM++SYQ LSDA
Sbjct  86   PVRNYRKNVMANQKNSAMEEEEKAAAA----FVKVSMDGAPYLRKVDLKMHKSYQDLSDA  141

Query  619  LAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            LAKMFSSFTM  G+YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MF
Sbjct  142  LAKMFSSFTM--GSYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWLMF  199

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            V+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  200  VESCKRLRIMKGSEAIGLAPRAMEKCKNR  228



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 164/204 (80%), Gaps = 3/204 (1%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            V  KRGFSETVDLKLNLQS      DL        K   KDP KPP+KAQVVGWPPVRNY
Sbjct  24   VGNKRGFSETVDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDPSKPPAKAQVVGWPPVRNY  83

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN+MA + + E      S GG  A FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  84   RKNVMANQKNGETDEAMSSAGGTVA-FVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  142

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFTM++  YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDGDWMLVGDVPW MFV+SCK
Sbjct  143  SSFTMES--YGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCK  200

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  201  RLRIMKGSEAIGLAPRAMEKCKNR  224



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK-MKSPSKEP--NKDPIKPPSKAQ  423
            N+ E  K  GKRGFSETVDLKLNL +       ++EK MK  +  P  + DP KPP+KAQ
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQ  93

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPP+R++RKN+MA + +  +   +   GG   AFVKV MDGAPYLRKVDLK+Y+SYQ
Sbjct  94   VVGWPPIRSFRKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQ  153

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            +LSDAL KMFSSFT+  GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWMLVGDV
Sbjct  154  ELSDALGKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDV  211

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  212  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 173/205 (84%), Gaps = 10/205 (5%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPS  414
            NE E+ K TGKRGFSETVDLKLNLQS  ++ +DL + +++ SKE        KDP KPP+
Sbjct  4    NEVETPKTTGKRGFSETVDLKLNLQSK-ETGMDLNKNIENGSKEKTLLPACTKDPAKPPA  62

Query  415  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            KAQVVGWPPVR+YRKNIMA + +  E + +K+  GG A FVKV MDGAPYLRKVDLKMY+
Sbjct  63   KAQVVGWPPVRSYRKNIMANQKNSCEESDKKASSGGAA-FVKVSMDGAPYLRKVDLKMYK  121

Query  595  SYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  774
            SYQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLV
Sbjct  122  SYQELSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLV  179

Query  775  GDVPWEMFVDSCKRLRIMKGSEAIG  849
            GDVPWEMFVDSCKRLRIMKGSEAIG
Sbjct  180  GDVPWEMFVDSCKRLRIMKGSEAIG  204



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 171/219 (78%), Gaps = 10/219 (5%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP--NKDPIKPPSKAQV  426
            N+ E  K  GKRGFSETVDLKLNL +A ++  D  EK+K  S     + DP KPP+KAQV
Sbjct  32   NDGEMTKNNGKRGFSETVDLKLNLSTAKEAVADEAEKVKKKSTVAPRSADPAKPPAKAQV  91

Query  427  VGWPPVRNYRKNIMAQksspe------eaageksggggpaaFVKVCMDGAPYLRKVDLKM  588
            VGWPPVR++RKNIMA + +          +   +     AAFVKV MDGAPYLRKVDLK+
Sbjct  92   VGWPPVRSFRKNIMAVQKNSSDVEGEKAGSSNTTTATVAAAFVKVSMDGAPYLRKVDLKL  151

Query  589  YESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWM  768
            Y+SYQ+LSDAL KMFSSFT+  GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWM
Sbjct  152  YKSYQELSDALGKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWM  209

Query  769  LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  210  LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 179/230 (78%), Gaps = 4/230 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS      DL       
Sbjct  1    MNLKETELCLGLPGGAETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHGDLNVSGSIK  60

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  555
             K   +DP KPP+KAQVVGWPPVRNYRK +MA      E     S GGG  AFVKV MDG
Sbjct  61   EKTLLQDPTKPPTKAQVVGWPPVRNYRKTVMA-TQKNGETEETMSSGGGTIAFVKVSMDG  119

Query  556  APYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYV  735
            APYLRKVDL+MY SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYV
Sbjct  120  APYLRKVDLRMYNSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYV  177

Query  736  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            P+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  178  PSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  227



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 178/219 (81%), Gaps = 13/219 (6%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  411
            N+SE+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  412  SKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  588
            SKAQVVGWPP+R++RKN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK+
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKL  151

Query  589  YESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWM  768
            Y+SY++LSDAL KMFSSFT+  GN G+QG  DFMNE KL+DLLNSSEYVPTYEDKDGDWM
Sbjct  152  YKSYRELSDALGKMFSSFTI--GNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWM  209

Query  769  LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  210  LVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 186/246 (76%), Gaps = 21/246 (9%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLD-------LK  357
            +N + TEL LGLPGG   N+SE  KV GKRGFSETVDLKLNL +   S  D       +K
Sbjct  15   INFEETELRLGLPGGSNVNDSEFAKVNGKRGFSETVDLKLNLSTKEPSGKDVIVGEETMK  74

Query  358  EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA----------Qksspeeaagek  507
            EK   PS   + DP KPP+KAQVVGWPP+R++RKN+MA          + ++    A   
Sbjct  75   EKATVPSS--SNDPAKPPAKAQVVGWPPIRSFRKNVMAVQKNSTDEGEKGTATSAPAAAA  132

Query  508  sggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDF  687
            + G   AAFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+  GN G+QGM DF
Sbjct  133  TSGSTSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTI--GNCGSQGMKDF  190

Query  688  MNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAV  867
            MNE KL+DLLN SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAV
Sbjct  191  MNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAV  250

Query  868  EKCKNR  885
            EKCKNR
Sbjct  251  EKCKNR  256



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 169/216 (78%), Gaps = 9/216 (4%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQS-----AADSSLDLKEKMKSPSKEPNKDPIKPPSK  417
            N+ E  K  GKRGFSETVDLKLNL +       D    +KEK  +P    + DP KPP+K
Sbjct  34   NDGEVAKSNGKRGFSETVDLKLNLSTKESGKGGDEEKVMKEKTVAPPA--STDPAKPPAK  91

Query  418  AQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYES  597
            AQVVGWPP+R++RKN+MA + +  +   +    G   AFVKV MDGAPYLRKVDLK+Y+S
Sbjct  92   AQVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKS  151

Query  598  YQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            YQ+LSDAL KMFSSFT+  GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVG
Sbjct  152  YQELSDALGKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  209

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  210  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 167/237 (70%), Positives = 183/237 (77%), Gaps = 13/237 (5%)
 Frame = +1

Query  205  LKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK  381
            L ATELCLGLPGG   NE+ +    G KRGFSETVDL LNLQS  + ++DL   + S SK
Sbjct  12   LYATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNN-VASASK  70

Query  382  EPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------FV  537
            E    KDP KPP+KAQVVGWPPVRNYRKNI+ Q+ +  +        G           V
Sbjct  71   ETTLLKDPAKPPAKAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALV  130

Query  538  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLL  717
            KV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLL
Sbjct  131  KVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLL  188

Query  718  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            NSS+YVP+YEDKD DWMLVGDVPWEMFVDSCKRLRIMKG+EAIGLAPRA+EK CKNR
Sbjct  189  NSSDYVPSYEDKDSDWMLVGDVPWEMFVDSCKRLRIMKGAEAIGLAPRAMEKYCKNR  245



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 177/219 (81%), Gaps = 13/219 (6%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  411
            N++E+ K  GKRGFSETVDLKLNL   ++  D S    +  KEK  +P   PN DP KPP
Sbjct  35   NDAEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKVATKEKTVAP--RPN-DPAKPP  91

Query  412  SKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  588
            SKAQVVGWPP+R++RKN+MA QK++ +E     S G   AAFVKV MDGAPYLRKVDLK+
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKL  151

Query  589  YESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWM  768
            Y+SY++LSDAL KMFSSFT+  GN G+QG  DFMNE KL+DLLNSSEYVPTYEDKDGDWM
Sbjct  152  YKSYRELSDALGKMFSSFTI--GNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWM  209

Query  769  LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  210  LVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 167/210 (80%), Gaps = 10/210 (5%)
 Frame = +1

Query  259  SESLKVTGKRGFSETVDLKLNLQSAADSSL-DLKEKMKSPSKEPNKDPIKPPSKAQVVGW  435
            +++  V  KRGFSETVDLKLNLQ+  +  + DL            KD  KPP+KAQVVGW
Sbjct  33   AKAATVGNKRGFSETVDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGW  92

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVRNYRKN+MAQ+ S      EK+       FVKV MDGAPYLRKVDLK+Y+ YQ LSD
Sbjct  93   PPVRNYRKNMMAQQKSSSAVEEEKA-------FVKVSMDGAPYLRKVDLKIYQCYQDLSD  145

Query  616  ALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  795
            ALAKMFSSFTM  GNYG+QGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPW+M
Sbjct  146  ALAKMFSSFTM--GNYGSQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWQM  203

Query  796  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            FV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  204  FVESCKRLRIMKGSEAIGLAPRAMEKCKNR  233



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 176/225 (78%), Gaps = 11/225 (5%)
 Frame = +1

Query  196  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  360
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  540
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  541  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLN  720
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT   GNYGAQGMIDFMNE KLMDLLN
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFT--TGNYGAQGMIDFMNESKLMDLLN  180

Query  721  SSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            SSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGL 
Sbjct  181  SSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 177/231 (77%), Gaps = 11/231 (5%)
 Frame = +1

Query  178  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLK  357
            ML    GL+L   E  L L   GGG+E E+ + TGKRGFSETVDLKLNLQ+  D    L 
Sbjct  1    MLTNEHGLSLNLKETELCLGLPGGGSEVETPRATGKRGFSETVDLKLNLQTKED----LN  56

Query  358  EKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa-  528
            E +K+ SKE    KDP KPP+KAQVVGWPPVR+YRKN+MA +    E   EK+     A 
Sbjct  57   ENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAVQKVSTEEVAEKTTSSTTAN  116

Query  529  --aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
              AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTM  GNYGAQGMIDFMNE K
Sbjct  117  SGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTM--GNYGAQGMIDFMNESK  174

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGL 
Sbjct  175  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 171/220 (78%), Gaps = 15/220 (7%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            N+ E+ K  GKRGFSETV+LKLNL S    + D  EKMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SEKMKEKS---STDPAKPPAKAQVVG  87

Query  433  WPPVRNYRKNIMAQksspeeaageksggggpaa---------FVKVCMDGAPYLRKVDLK  585
            WPPVR++RKNIMA + +  E  G     G  AA         FVKV MDGAPYLRKVDLK
Sbjct  88   WPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKVDLK  147

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            +Y+SYQQLSDAL+KMFSSFT+  GN G+ GM DFMNE KL+DLLN SEYVPTYEDKDGDW
Sbjct  148  LYKSYQQLSDALSKMFSSFTI--GNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKDGDW  205

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  206  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 169/206 (82%), Gaps = 8/206 (4%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  447
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KTSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            ++RKNI+      ++ + E+      AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL K
Sbjct  98   SFRKNILT----VQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGK  153

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MFSSFT+  GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  154  MFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVES  211

Query  808  CKRLRIMKGSEAIGLAPRAVEKCKNR  885
            CKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  212  CKRLRIMKGSEAIGLAPRAVEKCKNR  237



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 188/258 (73%), Gaps = 20/258 (8%)
 Frame = +1

Query  151  MEVGRKMGSMLA---EHGGLNLKATE----lclglpgggggNESESLKVTG-KRGFSETV  306
            MEV RKM S L    +   LN + TE    L  G  GG G     + K+ G KRGF+ETV
Sbjct  1    MEVCRKMASRLGGGPDEYSLNFEETELRLGLPGGGGGGDGDTTPSATKINGAKRGFAETV  60

Query  307  DLKLNLQSAADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMA  471
            DLKLNL +  +S LD  EK  SP KE N      DP KPP+KAQVVGWPPVR++RKNI++
Sbjct  61   DLKLNLPTK-ESVLDPAEKKNSP-KEKNLLPCSNDPAKPPAKAQVVGWPPVRSFRKNILS  118

Query  472  QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMD  651
                 + +  E       AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+ 
Sbjct  119  ---VHKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTI-  174

Query  652  AGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMK  831
             GN G QGM DFMNE KLMDLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMK
Sbjct  175  -GNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMK  233

Query  832  GSEAIGLAPRAVEKCKNR  885
            GSEAIGLAPRAVEKCKNR
Sbjct  234  GSEAIGLAPRAVEKCKNR  251



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 176/220 (80%), Gaps = 14/220 (6%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNL---QSAADSS----LDLKEKMKSPSKEPNKDPIKPP  411
            N+ E+ K  GKRGFSETVDLKLNL   ++  D S    + +KEK  +P   PN DP KPP
Sbjct  35   NDGEAAKGNGKRGFSETVDLKLNLSTKETGKDGSDQEKVVMKEKTVAP--RPN-DPAKPP  91

Query  412  SKAQVVGWPPVRNYRKNIMA--QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            SKAQVVGWPP+R++RKN+MA  + S+ E      SG  G AAFVKV MDGAPYLRKVDLK
Sbjct  92   SKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYLRKVDLK  151

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            +Y+SY++LSDAL KMFSSFT+  GN G+QG  DFMNE KL+DLLNSSEYVPTYEDKDGDW
Sbjct  152  LYKSYRELSDALGKMFSSFTI--GNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDW  209

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  210  MLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  249



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY+SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYKSYKELSDALAKMFSSF  153

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            TM  G+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDKDGDWMLVGDVPW MF++SCKRLR
Sbjct  154  TM--GSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLR  211

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKGSEAIGLAPRA++KCKNR
Sbjct  212  IMKGSEAIGLAPRAMQKCKNR  232



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 171/220 (78%), Gaps = 15/220 (7%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            N+ E+ K  GKRGFSETV+LKLNL S    + D  +KMK  S   + DP KPP+KAQVVG
Sbjct  32   NDGETTKNNGKRGFSETVNLKLNLSSKETVAED-SDKMKEKS---STDPAKPPAKAQVVG  87

Query  433  WPPVRNYRKNIMAQksspeeaageksggggpaa---------FVKVCMDGAPYLRKVDLK  585
            WPPVR++RKNIMA + +  E  G     G  AA         FVKV MDGAPYLRKVDLK
Sbjct  88   WPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAAITTTTAAAFVKVSMDGAPYLRKVDLK  147

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            +Y+SYQQLSDAL+KMFSSFT+  GN G+ GM DFMNE KL+DLLN SEYVPTYEDKDGDW
Sbjct  148  LYKSYQQLSDALSKMFSSFTI--GNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKDGDW  205

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  206  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSE V+LKL L S  + S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKEGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSF  153

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            TM  G+YGAQGMIDFMNE K+MDL+NSS+YVP+YEDKDGDWMLVGDVPW MF++SCKRLR
Sbjct  154  TM--GSYGAQGMIDFMNESKVMDLVNSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLR  211

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKGSEAIGLAPRA++KCKNR
Sbjct  212  IMKGSEAIGLAPRAMQKCKNR  232



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 181/230 (79%), Gaps = 4/230 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLK TELCLGLPGG    E  S    G KRGFSETV LKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGAETVECPSKSGVGNKRGFSETVGLKLNLQSNKQGPVDLNVNGAPK  60

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  555
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDG  119

Query  556  APYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYV  735
            APYLRKVDLKMY+SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYV
Sbjct  120  APYLRKVDLKMYKSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYV  177

Query  736  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            P+YEDKDGDWMLVGDVPW MFV+SCKR+RIMKGSEAIGLAPRA+EK KNR
Sbjct  178  PSYEDKDGDWMLVGDVPWPMFVESCKRMRIMKGSEAIGLAPRAMEKFKNR  227



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 178/234 (76%), Gaps = 10/234 (4%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATEl-clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSS  345
            M +++ +  GLNLK TEL      GGG G+E E+ +  GKRGFSETVDLKLNLQS  +  
Sbjct  1    MATLIGKESGLNLKETELCLGLPGGGGSGSEVETQRAAGKRGFSETVDLKLNLQSNKE--  58

Query  346  LDLKEKMKSPSKEPN--KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea--ageksg  513
             DL +  K+ SK+    KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  +     + + 
Sbjct  59   -DLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNSDQDGNEKTTS  117

Query  514  gggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMN  693
                  FVKV MDGAPYLRKVDL MY +Y+ LSDALAKMFSSFT   G YGAQGMIDFMN
Sbjct  118  STTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKMFSSFT--TGKYGAQGMIDFMN  175

Query  694  ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            E KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGL 
Sbjct  176  ESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLG  229



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 174/215 (81%), Gaps = 9/215 (4%)
 Frame = +1

Query  262  ESLKVTGKRGFSETVDLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGW  435
            E+ K  GKRGF ETVDLKLNL S    SLD   K+++K+    P+ D +KPP+KAQVVGW
Sbjct  44   EATKNNGKRGFPETVDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGW  103

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaa-----FVKVCMDGAPYLRKVDLKMYESY  600
            PPVR++RKNI++ + +  +    K+GGGG  +     FVKV MDGAPYLRKVDLK+Y+SY
Sbjct  104  PPVRSFRKNIVSAQKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLKLYKSY  163

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
            Q+LSDAL KMFSSFT+  GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWMLVGD
Sbjct  164  QELSDALGKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGD  221

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  222  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  256



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 164/209 (78%), Gaps = 13/209 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  438
            KVTGKRGF +TVDLKL LQS  D S   +E + +PS +    P K   KPPSKAQVVGWP
Sbjct  14   KVTGKRGFFQTVDLKLKLQS--DQSDLEEENLTTPSSDKPHLPPKHLSKPPSKAQVVGWP  71

Query  439  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  618
            PVR++RKN++  + S        S       +VKV MDGAPYLRKVDLK Y SYQQLSDA
Sbjct  72   PVRSFRKNVICNRKSSSVEESTGS-------YVKVSMDGAPYLRKVDLKTYGSYQQLSDA  124

Query  619  LAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            LAKMFSSFTM+ GNYG +GMIDFMNE K+M LLNSSEYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  125  LAKMFSSFTMNEGNYGVEGMIDFMNESKVMHLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  184

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            V SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  185  VCSCKRLRIMKGSEAIGLAPRAMEKCKSR  213



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   284 bits (727),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 171/223 (77%), Gaps = 21/223 (9%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQS---AADSSLDLKEKMKSPSKEPNKDPIKPPSKAQ  423
            NE E+ K  GKRGFSETV+LKLNL S    A+ S ++KEK  +       D  KPP+KAQ
Sbjct  32   NEGETTKNNGKRGFSETVNLKLNLSSKETVAEDSDEMKEKSST-------DTAKPPAKAQ  84

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaa---------FVKVCMDGAPYLRKV  576
            VVGWPPVR++RKNIMA + +  E  G     G  AA         FVKV MDGAPYLRKV
Sbjct  85   VVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKV  144

Query  577  DLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  756
            DLK+Y+SYQQLSDAL+KMFSSFT+  GN G+ GM DFMNE KL+DLLN SEYVPTYED+D
Sbjct  145  DLKLYKSYQQLSDALSKMFSSFTI--GNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDRD  202

Query  757  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            GDWMLVGDVPWEMFVD+CKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  203  GDWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 165/208 (79%), Gaps = 14/208 (7%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNL--QSAADSSLDLKEKMKS-PSKEPN-----KDPIKPPSKAQVV  429
             TGKRG+SETVDLKLNL  QS  +   ++  K  S P KE N     KDP KPP+KAQVV
Sbjct  41   TTGKRGYSETVDLKLNLHRQSVKEDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVV  100

Query  430  GWPPVRNYRKNIMAQksspeeaag----eksggggpaaFVKVCMDGAPYLRKVDLKMYES  597
            GWPPVR+YRKNIMAQK S  E +       S      AFVKVCMDGAPYLRKVDLKMY+S
Sbjct  101  GWPPVRSYRKNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKS  160

Query  598  YQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            YQ+LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVG
Sbjct  161  YQELSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVG  218

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPR  861
            DVPWEMFVDSCKRLRIMKGSEAIGL  R
Sbjct  219  DVPWEMFVDSCKRLRIMKGSEAIGLGLR  246



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSE V+LKL L S    S+DL        K  +KDP KPP+KAQVVGWPPVRNYRK+
Sbjct  34   KRGFSEIVELKLGLHSTKQGSVDLNVAGAPKEKTLHKDPSKPPAKAQVVGWPPVRNYRKS  93

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            +M  +   E        GGG  AFVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSF
Sbjct  94   VMTHQKCSEVEEASSDRGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSF  153

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            TM  G+YGAQGMIDFMNE K+MDL+NSSEYVP+YEDKDGDWMLVGDVPW MF++SCKRLR
Sbjct  154  TM--GSYGAQGMIDFMNESKVMDLVNSSEYVPSYEDKDGDWMLVGDVPWPMFIESCKRLR  211

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKGSEAIGLAPRA+EK KNR
Sbjct  212  IMKGSEAIGLAPRAMEKYKNR  232



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 162/237 (68%), Positives = 177/237 (75%), Gaps = 11/237 (5%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLKATELCL LPGG    ++ +    G KRGFSETVDL LNLQS  + ++DL     S 
Sbjct  6    MNLKATELCLSLPGGAETLDTPAKSAVGNKRGFSETVDLMLNLQSNKERAIDLNNATASK  65

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------FV  537
             K   KDP+KPP+KAQVVGWPPVRNYRKNIM  + +           G           V
Sbjct  66   QKTLLKDPVKPPAKAQVVGWPPVRNYRKNIMTNQKTSGADEASSEKAGNGGGGATGATLV  125

Query  538  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLL  717
            KV MDGAPYLRKV LKMY+SYQ LSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDL 
Sbjct  126  KVSMDGAPYLRKVHLKMYKSYQDLSDALAKMFSSFTM--GNYGAQGMIDFMNETKLMDL-  182

Query  718  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            NSSEYVP+YEDKDGDWM VGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK  KNR
Sbjct  183  NSSEYVPSYEDKDGDWMPVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYSKNR  239



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 191/255 (75%), Gaps = 22/255 (9%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHG---GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLN  321
            MEV RKM +M  E      LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLN
Sbjct  1    MEVARKMATMHGEEREKPDLNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLN  55

Query  322  LQSAADSSLDLKEKMKSPSKEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMAQks  480
            L S  ++ +D   K+KS  KE +K       DP +PP+KAQVVGWPPVR++RKN++A   
Sbjct  56   L-SGKEAGVD-DNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA---  110

Query  481  speeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGN  660
              +  + E       AAFVKV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+  GN
Sbjct  111  GQKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTI--GN  168

Query  661  YGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSE  840
            YG+QGM DFMNE KLMDLLN  ++VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG E
Sbjct  169  YGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKE  228

Query  841  AIGLAPRAVEKCKNR  885
            AIGLAPRA+EKCKNR
Sbjct  229  AIGLAPRAMEKCKNR  243



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 193/257 (75%), Gaps = 19/257 (7%)
 Frame = +1

Query  151  MEVGRKMGSMLA---EHGGLNLKATElclglpgggggNESESL----KVTGKRGFSETVD  309
            MEV RKM +ML    +   LN + TEL LGLPGGGGG+E ES     K  GKRGF ETVD
Sbjct  1    MEVCRKMANMLGAERDEYSLNFEETELRLGLPGGGGGSEGESTPSPTKNGGKRGFCETVD  60

Query  310  LKLNLQSAADSSLDLKEKMKSPSKEPN-----KDPIKPPSKAQVVGWPPVRNYRKNIMAQ  474
            LKLNL S  +S +D  EK  SP KE N      D  KPP+KAQVVGWPPVR++RKNI++ 
Sbjct  61   LKLNLPSK-ESVMDPSEKKNSP-KEKNLLPCTNDLAKPPAKAQVVGWPPVRSFRKNILS-  117

Query  475  ksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDA  654
                + +  E       AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+  
Sbjct  118  --VQKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTI--  173

Query  655  GNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  834
            GN G QGM DFMNE KLMDLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG
Sbjct  174  GNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG  233

Query  835  SEAIGLAPRAVEKCKNR  885
            SEAIGLAPRAVEKCK R
Sbjct  234  SEAIGLAPRAVEKCKKR  250



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 172/222 (77%), Gaps = 14/222 (6%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL----------DLKEKMKSPSKEPNKDP  399
            NE ES  K  GKR FSETVDLKLNL ++ DS+L          ++KEK  +     + DP
Sbjct  32   NELESSNKNNGKRVFSETVDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDP  91

Query  400  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
             KPP+KAQVVGWPPVR++RKN+M         AGE SG G  AAFVKV +DGAPYLRKVD
Sbjct  92   AKPPAKAQVVGWPPVRSFRKNVMT-VQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKVD  150

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LKMY+SYQQLSDAL KMFSSFT+  GN G QG  DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  151  LKMYKSYQQLSDALGKMFSSFTI--GNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDG  208

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  209  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   281 bits (720),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 171/220 (78%), Gaps = 12/220 (5%)
 Frame = +1

Query  253  NESESL-KVTGKRGFSETVDLKLNLQSAADSSL--------DLKEKMKSPSKEPNKDPIK  405
            NE ES  K  GKR FSETVDLKLNL ++ DS+L        ++KEK  +     + DP K
Sbjct  32   NEVESTNKNNGKRVFSETVDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAK  91

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
             P+KAQVVGWPPVR++RKN+M         AGE SG G  AAFVKV +DGAPYLRKVDLK
Sbjct  92   SPAKAQVVGWPPVRSFRKNVMT-VQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKVDLK  150

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY+SYQQLSDAL KMFSSFT+  GN G QG  DFMNE KL+DLLN S+YVPTYEDKDGDW
Sbjct  151  MYKSYQQLSDALGKMFSSFTI--GNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDW  208

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  209  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 176/220 (80%), Gaps = 13/220 (6%)
 Frame = +1

Query  253  NESESLKVTGKRG--FSETVDLKLNLQSAADSSLDLKEKMKSPSKE------PNKDPIKP  408
            N+ E+ K  GKRG  FSETVDLKLNL S  D+  D  ++ K+  KE      PN DP KP
Sbjct  35   NDPEAAKSNGKRGQRFSETVDLKLNL-STKDTGKDGSDQEKAAMKEKAVAPRPN-DPAKP  92

Query  409  PSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PSKAQVVGWPP+R++RKN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK
Sbjct  93   PSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLK  152

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            +Y+SY++LSDAL KMFSSFT+  GN G+QG  +FMNE KL+DLLNSSEYVPTYEDKDGDW
Sbjct  153  LYKSYRELSDALGKMFSSFTI--GNCGSQGTKEFMNESKLIDLLNSSEYVPTYEDKDGDW  210

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  211  MLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>ref|XP_012089266.1| PREDICTED: auxin-responsive protein IAA16 [Jatropha curcas]
 gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 167/208 (80%), Gaps = 10/208 (5%)
 Frame = +1

Query  277  TGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN-KDPIKPPSKAQVVGWPPVRNY  453
             GKRGFSETVDLKLNL +        +EKMK  +  P+  DP KPP+KAQVVGWPP+R++
Sbjct  45   NGKRGFSETVDLKLNLSTKESGK---EEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSF  101

Query  454  RKNIMA----QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDAL  621
            RKN+M+         E+AA   + G   AAFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL
Sbjct  102  RKNVMSVQKSNGDEAEKAATATAAGSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDAL  161

Query  622  AKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV  801
             KMFSSFT+  GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWMLVGDVPWEMF+
Sbjct  162  GKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFI  219

Query  802  DSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  220  DSCKRLRIMKGSEAIGLAPRAVEKCKNR  247



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 158/187 (84%), Gaps = 14/187 (7%)
 Frame = +1

Query  346  LDLKEK-MKSPSKEPN------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaage  504
            +DL +  +K+ SK+ N      KDP KPP+KAQVVGWPPVR+YRKNIMAQK++ EE    
Sbjct  1    MDLNDNNIKNASKDKNHLPASIKDPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEGEKA  60

Query  505  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMID  684
             S       FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  GNYG QGMID
Sbjct  61   SSAA-----FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--GNYGTQGMID  113

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            FMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA
Sbjct  114  FMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  173

Query  865  VEKCKNR  885
            +EKCK+R
Sbjct  174  MEKCKSR  180



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 162/201 (81%), Gaps = 13/201 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFS+TVDLKLNL + + +  +      S         +KPP+KAQVVGWPPVR++RKN
Sbjct  25   KRGFSQTVDLKLNLDNPSININNTSSNNDS---------LKPPTKAQVVGWPPVRSFRKN  75

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            IM+QK +      EK        FVKV MDGAPYLRKVDLKMY+SYQQLSD+L KMFSSF
Sbjct  76   IMSQKGNNNVEISEKGEKTIA--FVKVSMDGAPYLRKVDLKMYKSYQQLSDSLTKMFSSF  133

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            TM  GNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLR
Sbjct  134  TM--GNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLR  191

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKGSEAIGLAPRA+EKCKNR
Sbjct  192  IMKGSEAIGLAPRAMEKCKNR  212



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 171/213 (80%), Gaps = 8/213 (4%)
 Frame = +1

Query  253  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  426
            NE E + K  GKR FSETVDLKLNL S+ DS++D + +KMK        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQV  91

Query  427  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            VGWPPVR++RKN++   +  +++ G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVL---NVQKKSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  786
            LSDAL KMFSSFT+  GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVP
Sbjct  149  LSDALGKMFSSFTI--GNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVP  206

Query  787  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  207  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   277 bits (708),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 170/218 (78%), Gaps = 15/218 (7%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            N++E+ K  GKRG+S+ VDLKLNL +  ++S+D  EKMK       K+  KPP+KAQVVG
Sbjct  32   NDNETAKNNGKRGYSDMVDLKLNLSTTKEASVDEAEKMKE------KNTAKPPAKAQVVG  85

Query  433  WPPVRNYRKNIM------AQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            WPPVR++RKNIM      +     +  +G       PAAFVKV MDGAPYLRKVDLK+Y+
Sbjct  86   WPPVRSFRKNIMTVQKNSSDNKGEKTGSGNTINTAVPAAFVKVSMDGAPYLRKVDLKLYK  145

Query  595  SYQQLSDALAKMFSSFTMDAGNYG-AQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWML  771
            SYQ+LSDAL KMFSSFT+  GN G +QGM DFMNE KL+DLLN SEYVPTYEDKDGDWML
Sbjct  146  SYQELSDALGKMFSSFTV--GNCGGSQGMKDFMNEGKLIDLLNGSEYVPTYEDKDGDWML  203

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            +GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK +
Sbjct  204  IGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  241



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 168/213 (79%), Gaps = 8/213 (4%)
 Frame = +1

Query  253  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  426
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  427  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            VGWPPVR++RKN++      + + G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVLT---VQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  786
            LSDAL KMFSSFT+  GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVP
Sbjct  149  LSDALGKMFSSFTI--GNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVP  206

Query  787  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  207  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 178/251 (71%), Gaps = 29/251 (12%)
 Frame = +1

Query  178  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETV-DLKLNLQSAADSSLDL  354
            ML     LNLK TELCLGLPGG    E+ +     KRGFSETV DLKLNL +      DL
Sbjct  1    MLGGGVDLNLKDTELCLGLPGG---GETAAPVSGNKRGFSETVVDLKLNLNNEPRDHKDL  57

Query  355  KEKMKSPSKEPN--------------KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspee  492
                 +  K+P+              KDP KPP+KAQVVGWPPVR+YRKN+ A       
Sbjct  58   GSV--TTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKNMTAMSQKASG  115

Query  493  aageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQ  672
             +           FVKV MDGAPYLRKVDLKMY SY+ LS+ALAKMFSSFT + GNYGAQ
Sbjct  116  GSAT---------FVKVSMDGAPYLRKVDLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQ  166

Query  673  GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL  852
            GMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGL
Sbjct  167  GMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGL  226

Query  853  APRAVEKCKNR  885
            APRA+EKCKNR
Sbjct  227  APRAMEKCKNR  237



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 182/236 (77%), Gaps = 19/236 (8%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  378
            LNL+ATEL LGLPGG     SE  +V  KRGFSETVDLKLNL S  ++ +D   K+KS  
Sbjct  11   LNLEATELRLGLPGG-----SEGSEVVRKRGFSETVDLKLNL-SGKEAGVD-DNKVKSLQ  63

Query  379  KEPNK-------DPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFV  537
            KE +K       DP +PP+KAQVVGWPPVR++RKN++A     +  + E       AAFV
Sbjct  64   KEKSKSLLPCGNDPARPPAKAQVVGWPPVRSFRKNMLA---GQKGGSEEGEKVSCNAAFV  120

Query  538  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLL  717
            KV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+  GNYG+QGM DFMNE KLMDLL
Sbjct  121  KVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTI--GNYGSQGMKDFMNESKLMDLL  178

Query  718  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            N  ++VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  179  NGFDHVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR  234



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 11/204 (5%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAAD-SSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  459
            KRGFS+TVDLKLNL    +  S+++    K  S        KPP+KAQVVGWPPVR++RK
Sbjct  22   KRGFSQTVDLKLNLHHNDNIPSMNINNPPKDNSSN------KPPTKAQVVGWPPVRSFRK  75

Query  460  NIMAQk--sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            N+++QK  ++               AFVKV MDGAPYLRKVDLKMY+SYQQLS +L  MF
Sbjct  76   NMLSQKGNNNNNNNEEISEKDEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQLSHSLTNMF  135

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFTM  GNYG+QGMIDFMNERKLMD+LNSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCK
Sbjct  136  SSFTM--GNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCK  193

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  194  RLRIMKGSEAIGLAPRAMEKCKNR  217



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 168/213 (79%), Gaps = 8/213 (4%)
 Frame = +1

Query  253  NESE-SLKVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPNKDPIKPPSKAQV  426
            NE E + K  GKR FSETVDLKLNL S+ DS++D + + +K        DP KPP+KAQV
Sbjct  33   NEGEMTSKNNGKRVFSETVDLKLNL-SSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQV  91

Query  427  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            VGWPPVR++RKN++      + + G     GG AAFVKV +DGAPYLRKVDLKMY+SYQQ
Sbjct  92   VGWPPVRSFRKNVLT---VQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQ  148

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  786
            LSDAL KMFSSFT+  GN G  G  DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVP
Sbjct  149  LSDALGKMFSSFTI--GNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVP  206

Query  787  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  207  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 171/218 (78%), Gaps = 13/218 (6%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNL----QSAADSS--LDLK-EKMKSPSKEPNKDPIKP-P  411
            + E+ K TGKRGF+ETVDLKLN+    QSA D    +D+K EK  +P    N DP KP  
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSN-DPTKPHA  96

Query  412  SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  591
            +KAQVVGWPPVR++R NI+A     + +   +      AAFVKV MDGAPYLRKVDLK+Y
Sbjct  97   AKAQVVGWPPVRSFRXNILA--VQKDVSDEGEKTNSXSAAFVKVSMDGAPYLRKVDLKLY  154

Query  592  ESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWML  771
            +SYQ+LS AL KMFSSFT+  G+YG+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWML
Sbjct  155  KSYQELSTALGKMFSSFTI--GSYGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWML  212

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VGDVPWEMFV+SCKRLRIM+GSEAIGLAPRAVEKCKNR
Sbjct  213  VGDVPWEMFVNSCKRLRIMRGSEAIGLAPRAVEKCKNR  250



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 164/212 (77%), Gaps = 13/212 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  429
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN++A               G  AA VKV MDGAPYLRKVDL+MY SY QL
Sbjct  107  GWPPVRSFRKNMLA----ATTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQL  162

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT+  GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW
Sbjct  163  SDALAKMFSSFTI--GNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPW  220

Query  790  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  221  EMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   274 bits (701),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 163/205 (80%), Gaps = 6/205 (3%)
 Frame = +1

Query  283  KRGFSETV-DLKLNLQSAADSSLDL--KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            KRGF++TV DLKLNL +     +D+  K K KS S     D  KPP+KAQVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSF  101

Query  454  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  630
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  631  FSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  810
            FSSFT+  GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPW+MFVDSC
Sbjct  162  FSSFTI--GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSC  219

Query  811  KRLRIMKGSEAIGLAPRAVEKCKNR  885
            KRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  220  KRLRIMKGSEAIGLAPRAVEKCKNR  244



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 172/220 (78%), Gaps = 4/220 (2%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADSSLDLKEKMKSP  375
            +NLK TELCLGLPGG    ES +    G KRGFSETVDLKLNLQS     +DL       
Sbjct  1    MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK  60

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDG  555
             K   KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDG
Sbjct  61   EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDG  119

Query  556  APYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYV  735
            APYLRKVDLKMY SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYV
Sbjct  120  APYLRKVDLKMYTSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYV  177

Query  736  PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            P+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGL 
Sbjct  178  PSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLG  217



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 163/205 (80%), Gaps = 6/205 (3%)
 Frame = +1

Query  283  KRGFSETV-DLKLNLQSAADSSLDLKEKMK--SPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            KRGF++TV DLKLNL +     +D+ EK K  S S     D  KPP+K+QVVGWPPVR++
Sbjct  42   KRGFADTVVDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSF  101

Query  454  RKNIMA-QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  630
            RKNIMA QK + E      S      AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KM
Sbjct  102  RKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKM  161

Query  631  FSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  810
            FSSFT+  GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPW+MFVDSC
Sbjct  162  FSSFTI--GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSC  219

Query  811  KRLRIMKGSEAIGLAPRAVEKCKNR  885
            KRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  220  KRLRIMKGSEAIGLAPRAVEKCKNR  244



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 188/254 (74%), Gaps = 19/254 (7%)
 Frame = +1

Query  169  MGSMLA---EHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAAD  339
            M S+L    E  GL L+ TEL LGLPGGGGG    S K +GKRGFSET+DLKL L + AD
Sbjct  1    MASLLVRGKEDYGLGLEETELRLGLPGGGGGEGDVS-KNSGKRGFSETIDLKLKLHTVAD  59

Query  340  SS---LDLKEKMK-SPSKEPN-----KDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspe  489
            S    ++  EKMK SP  + N      DP KPP+ KAQVVGWPPVR++RKN+MA  S   
Sbjct  60   SKEVVMEASEKMKRSPPSQNNILTCTNDPEKPPAPKAQVVGWPPVRSFRKNMMASHSDKG  119

Query  490  eaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGA  669
                 +      A FVKV MDGAPYLRKVDLKMY SY++LS AL KMFSSFT  +GN G+
Sbjct  120  SKEAGEKSSNSAA-FVKVSMDGAPYLRKVDLKMYSSYKELSMALEKMFSSFT--SGNCGS  176

Query  670  QGM--IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEA  843
            QGM   DFMNE KLMDLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEA
Sbjct  177  QGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEA  236

Query  844  IGLAPRAVEKCKNR  885
            IGLAPRA+EKCKNR
Sbjct  237  IGLAPRAMEKCKNR  250



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 167/231 (72%), Gaps = 29/231 (13%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNL------------------QSAADSSLDLKEKM--------KSP  375
            V  KRGFSETVDLKLN                   Q+A  + LDL +          K  
Sbjct  49   VGNKRGFSETVDLKLNFSTNNNKNDHNNNINSGKEQTATSAPLDLMKNDNKADVSADKEI  108

Query  376  SKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-QksspeeaageksggggpaaFVKVCMD  552
            S + N D +KPP+KAQVVGWPPVR+YRKN++A QK++    +  +    G  A VKV MD
Sbjct  109  SSKVNADSVKPPAKAQVVGWPPVRSYRKNMLAVQKTTGGPDSETEKPMNGGGALVKVSMD  168

Query  553  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEY  732
            GAPYLRKVDLKMY+SYQ LSDAL KMFSSFT+  GNYGAQGMIDFMNE KLMDLLN S+Y
Sbjct  169  GAPYLRKVDLKMYKSYQDLSDALGKMFSSFTL--GNYGAQGMIDFMNESKLMDLLNDSDY  226

Query  733  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  227  VPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  277



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 27/221 (12%)
 Frame = +1

Query  265  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  426
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  427  VGWPPVRNYRKNIMA--------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            VGWPPVR++RKN+M+             E+ +         AA+VKV MDGAPYLRK+DL
Sbjct  72   VGWPPVRSFRKNVMSGQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDL  131

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            K+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE +L+DLLN S+YVPTYEDKDGD
Sbjct  132  KLYKTYQDLSDALSKMFSSFTL--GNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGD  189

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  190  WMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  230



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 160/202 (79%), Gaps = 12/202 (6%)
 Frame = +1

Query  280  GKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRK  459
            GKRG+ +TVDLKLNL     SS DL  +      + N  P+KPP+KAQVVGWPPVRN+RK
Sbjct  37   GKRGYEQTVDLKLNL-----SSKDLPNQTDLAENKKNDQPVKPPAKAQVVGWPPVRNFRK  91

Query  460  NIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSS  639
            N+MA      +   +    GG AAFVKV MDGAPYLRKVDLKMY++Y++LSDAL KMFSS
Sbjct  92   NVMA-----VQKTEKAEESGGSAAFVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSS  146

Query  640  FTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  819
            FTM   +  AQGM+DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRL
Sbjct  147  FTMSKCD--AQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRL  204

Query  820  RIMKGSEAIGLAPRAVEKCKNR  885
            RIMKG+EAIGLAPRA+EKCK+R
Sbjct  205  RIMKGTEAIGLAPRAMEKCKSR  226



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 168/222 (76%), Gaps = 14/222 (6%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSS---------LDLK-EKMKSPSKEPNKDPIK  405
            + E+ K  GKRGFSETVDLKLN+ S  +++         L+LK EK  +       DP K
Sbjct  81   DGEAAKNNGKRGFSETVDLKLNISSQDETADEDDQDQQLLELKKEKNAAAPAPGANDPSK  140

Query  406  PP-SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            PP SKAQVVGWPPVR++RKNI A         GEKS     AAFVKV MDGAPYLRKVDL
Sbjct  141  PPASKAQVVGWPPVRSFRKNI-ATVQKKSSDEGEKSNSNISAAFVKVSMDGAPYLRKVDL  199

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            K+Y+SYQ+LS AL KMFSSFT+  GN G+ GM DFMNE KL+DLLN S+YVPTYEDKDGD
Sbjct  200  KLYKSYQELSTALGKMFSSFTI--GNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDGD  257

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            WMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC
Sbjct  258  WMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  299



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 163/212 (77%), Gaps = 13/212 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  429
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN++A               G  AA VKV MDGAPYLRKVDL+MY SY QL
Sbjct  107  GWPPVRSFRKNMLA----TTTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQL  162

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT+  GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGD MLVGDVPW
Sbjct  163  SDALAKMFSSFTI--GNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDRMLVGDVPW  220

Query  790  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  221  EMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 165/207 (80%), Gaps = 9/207 (4%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS--PSKEPNKDPIKPPSKAQVVGWPPV  444
            +V  KRGFSETVDLKLNL S   S +D  EK K+  P      DP KPP+KAQVVGWPPV
Sbjct  105  EVARKRGFSETVDLKLNLSSKESSGVDPNEKEKNLLPCAT---DPAKPPAKAQVVGWPPV  161

Query  445  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  624
            R++RKN+ A + S  E + +   G     FVKV MDGAPYLRKVDL+MY++Y +LSDALA
Sbjct  162  RSFRKNMFATQKSSSEESEKGGAGNAA--FVKVSMDGAPYLRKVDLRMYKTYLELSDALA  219

Query  625  KMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  804
            KMFSSFT+  GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  220  KMFSSFTI--GNCGSQGVKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVE  277

Query  805  SCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  278  SCKRLRIMKGTEAIGLAPRAMEKCKNR  304



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 164/222 (74%), Gaps = 15/222 (7%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQS---AADSSLDL--------KEKMKSPSKEPNKDPI  402
            + E+ K  GKRGFSETVDLKLN+ S   +AD S D         +EK  +       DP 
Sbjct  37   DGEAAKNNGKRGFSETVDLKLNISSQDQSADRSADQDQQLMELKREKNAAAPAPSANDPS  96

Query  403  KPP-SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
            KPP SKAQVVGWPPVR++RKNI+           EK      AAFVKV MDGAPYLRKVD
Sbjct  97   KPPASKAQVVGWPPVRSFRKNIVT-VQKKSSEEAEKGNSNISAAFVKVSMDGAPYLRKVD  155

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LK+Y+SYQ+LS AL KMFSSFT+  GN G+ GM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  156  LKLYKSYQELSTALGKMFSSFTI--GNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDG  213

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  214  DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  255



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 164/222 (74%), Gaps = 30/222 (14%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVG  73

Query  433  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  579
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LK+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTI--GNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDG  191

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  233



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 180/237 (76%), Gaps = 22/237 (9%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK---  369
            LN +ATEL LGLPGGGGGN+ E++K  GKR FS+TVDLKL L S+ +S++D  E +K   
Sbjct  2    LNFEATELRLGLPGGGGGNDGEAVKSNGKRAFSDTVDLKLKL-SSKESNVDQVENLKDNN  60

Query  370  -----SPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaF  534
                 SPS     D  KPP+KAQVVGWPPVR+YRKNI++               GG AA 
Sbjct  61   NNVVTSPS-----DSTKPPAKAQVVGWPPVRSYRKNILS------GQKAAGESSGGGAAL  109

Query  535  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDL  714
            VKV +DGAPYLRKVDLKMY+SY +LS+AL KMFSSFT+  GN G  G  DFMNE KL+DL
Sbjct  110  VKVSVDGAPYLRKVDLKMYKSYHELSEALGKMFSSFTI--GNCGTHGFKDFMNESKLIDL  167

Query  715  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LN S+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  168  LNGSDYVPTYEDKDGDWMLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  224



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 27/221 (12%)
 Frame = +1

Query  265  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  426
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  83   AMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKV-----------VKPPAKAQV  131

Query  427  VGWPPVRNYRKNIMA--------QksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            VGWPPVR++RKN+M+             E+ +         AA+VKV MDGAPYLRK+DL
Sbjct  132  VGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDL  191

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            K+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE +L+DLLN S+YVPTYEDKDGD
Sbjct  192  KLYKTYQDLSDALSKMFSSFTI--GNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGD  249

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  250  WMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  290



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 167/211 (79%), Gaps = 14/211 (7%)
 Frame = +1

Query  280  GKRGFSETVDLKLNLQSAA---DSSLDLKE------KMKSPSKEPNKDPIKPPSKAQVVG  432
            GKRGFSETVDLKLNL SA    DS++DLKE      K   PS  P  D +KPP+KAQVVG
Sbjct  25   GKRGFSETVDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPT-DSVKPPAKAQVVG  83

Query  433  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  612
            WPPVR++RKN+MA        + E   G G AAFVKV MDGAPYLRKVDLKMY++Y++LS
Sbjct  84   WPPVRSFRKNVMA--VQKRTDSDEAEKGTGGAAFVKVSMDGAPYLRKVDLKMYKTYKELS  141

Query  613  DALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            DAL KMFSSFT+  G   +QGM+DFM+E KLMDLLNSS+YVPTYEDKDGDWMLVGDVPWE
Sbjct  142  DALGKMFSSFTI--GKCDSQGMMDFMSESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWE  199

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFV SCKRLRIMKG+EA GLAP+A++KCK R
Sbjct  200  MFVGSCKRLRIMKGTEAKGLAPKAMDKCKTR  230



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 168/218 (77%), Gaps = 13/218 (6%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD-------LKEKMKSPSKEPNKDPIKPPS  414
            + E+ K TGKRGF+ETVDLKLN+ S   S+ D        KEK  +P    N +P KPP+
Sbjct  38   DGEASKNTGKRGFAETVDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSN-NPTKPPA  96

Query  415  -KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  591
             KAQ VGWPPVR++RKNI+A       +   +      AAFVKV +DGAPYLRKVDLK+Y
Sbjct  97   AKAQAVGWPPVRSFRKNILA--VQKNGSEEGEKTNSITAAFVKVSVDGAPYLRKVDLKLY  154

Query  592  ESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWML  771
            +SYQ+LS AL+KMFSSFT+  GN G+QGM DF+NE KL+DLL+ SEYVP+YEDKDGDWML
Sbjct  155  KSYQELSTALSKMFSSFTI--GNCGSQGMKDFVNESKLIDLLSGSEYVPSYEDKDGDWML  212

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  213  VGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 167/209 (80%), Gaps = 11/209 (5%)
 Frame = +1

Query  280  GKRGFSETVDLKLNLQSAADSSLD---LKEKMKSPSKE----PNKDPIKPPSKAQVVGWP  438
            GKRG+ ETVDLKLNL +    +LD   LKEK  S  K     PN D +KPP+KAQVVGWP
Sbjct  39   GKRGYEETVDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPN-DSVKPPAKAQVVGWP  97

Query  439  PVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  618
            PVR++RKN+MA      ++   + G GG AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDA
Sbjct  98   PVRSFRKNVMA-VQKVSDSEETEKGSGGAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  156

Query  619  LAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            L KMFSSFT+  G   +QGM+DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPWEMF
Sbjct  157  LGKMFSSFTI--GKCDSQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  214

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            V+SCKRLRIMKG+EA GLAPRA+EKCK+R
Sbjct  215  VESCKRLRIMKGTEAKGLAPRAMEKCKSR  243



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 163/222 (73%), Gaps = 30/222 (14%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      +LK K+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKGKV-----------VKPPAKTQVVG  73

Query  433  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  579
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LK+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTI--GNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDG  191

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  233



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 180/251 (72%), Gaps = 34/251 (14%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL------DLKE  360
            +N +ATEL LGLPGG  G +  ++K  GKRGFSETVDLKLNL S A  S+      D+KE
Sbjct  2    INFEATELRLGLPGGNHGGDMAAVKNNGKRGFSETVDLKLNLSSTAMDSVSGAQLEDIKE  61

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaage------------  504
            K          D +KPP+K QVVGWPPVR++RKN+M+ +      A E            
Sbjct  62   K----------DVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGAT  111

Query  505  ----ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQ  672
                       AA+VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+  GN G Q
Sbjct  112  SSASACAAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTI--GNCGPQ  169

Query  673  GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL  852
            GM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGL
Sbjct  170  GMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGL  229

Query  853  APRAVEKCKNR  885
            APRA+EKCKNR
Sbjct  230  APRALEKCKNR  240



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 156/201 (78%), Gaps = 2/201 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            T+  GN G+ GM DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  156  TI--GNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKG+EA GLAPRA+EKCKNR
Sbjct  214  IMKGTEATGLAPRAMEKCKNR  234



>ref|XP_006838867.1| PREDICTED: auxin-responsive protein IAA16 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 177/240 (74%), Gaps = 20/240 (8%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAA----------DSSL  348
            LN +ATEL LG PG    N   + K  GKRGFSETVDLKLNL   A          D+ +
Sbjct  7    LNFEATELRLGPPG----NGDSAGKGIGKRGFSETVDLKLNLMEPAPLDVPASTVKDTGV  62

Query  349  DLKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggp  525
            DL EK++  +     DP KPP+ KAQVVGWPPVR++R+N++A +SS      E+      
Sbjct  63   DLTEKLRGSNAV--ADPAKPPAHKAQVVGWPPVRSFRRNMLATQSSKGNNRSEEGEKNAG  120

Query  526  aaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKL  705
            A +VKV MDGAPYLRKVDL MY+SYQ LS++L KMFS FTM  G  G+QG I+F+NE KL
Sbjct  121  ATYVKVSMDGAPYLRKVDLNMYKSYQDLSNSLEKMFSCFTM--GQCGSQG-INFLNESKL  177

Query  706  MDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MDLLN SEYVPTYED+DGDWMLVGDVPWEMFVDSC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  178  MDLLNGSEYVPTYEDRDGDWMLVGDVPWEMFVDSCRRLRIMKGSEAIGLAPRAVEKCKNR  237



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 164/220 (75%), Gaps = 21/220 (10%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  429
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN++A               G  AA VKV MDGAPYLRKVDL+MY SY QL
Sbjct  107  GWPPVRSFRKNMLA----ATTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQL  162

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT+  GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW
Sbjct  163  SDALAKMFSSFTI--GNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPW  220

Query  790  EMFVDSCKRLRIMKGSEAIGL--------APRAVEKCKNR  885
            EMFV+SCKRLRIMKG+EAIGL        AP+AVEKCK R
Sbjct  221  EMFVESCKRLRIMKGTEAIGLENYMLIIAAPKAVEKCKKR  260



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 168/224 (75%), Gaps = 32/224 (14%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMGSVSEVDLVNMKEKV-----------VKPPAKAQVVG  73

Query  433  WPPVRNYRKNIMA-------------QksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            WPPVR++RKN+M+             +K+S    A   +  G  AA+VKV MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGPKPTTGDAVQATEKTSGSNGATSSASIGATAAYVKVSMDGAPYLRK  133

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  753
            +DLK+Y++YQ LSDAL+KMFSSFT+  G+YG QGM D +NE KL+DLLN S+YVPTYEDK
Sbjct  134  IDLKLYKTYQDLSDALSKMFSSFTI--GSYGPQGMKDIVNEGKLIDLLNGSDYVPTYEDK  191

Query  754  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 180/248 (73%), Gaps = 33/248 (13%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL------DLKE  360
            +N +ATEL LGLPGG  G E    K  GKRGFSETVDLKLNL S A  S+      ++KE
Sbjct  2    INFEATELRLGLPGGNHGGEMAG-KNNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKE  60

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg-------  519
            K+           +KPP+KAQVVGWPPVR++RKN+M+ +      A E +          
Sbjct  61   KV-----------VKPPAKAQVVGWPPVRSFRKNVMSGQKPTTGDATEGNDKTSGSSGAT  109

Query  520  ------gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMI  681
                     A+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+  GNYG QGM 
Sbjct  110  SSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTI--GNYGPQGMK  167

Query  682  DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPR  861
            DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPR
Sbjct  168  DFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPR  227

Query  862  AVEKCKNR  885
            A+EKCKNR
Sbjct  228  ALEKCKNR  235



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 180/242 (74%), Gaps = 25/242 (10%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  378
            +N +ATEL LGLPGG  G E    K  GKRGFSETVDLKLNL S   S ++L E MK   
Sbjct  2    INFEATELRLGLPGGNHGGEIAG-KNNGKRGFSETVDLKLNLSSTV-SEVEL-ENMK---  55

Query  379  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageks-------------ggg  519
                +  +KPP+KAQVVGWPPVR++RKN+M+ +      A E +               G
Sbjct  56   ----EKVVKPPAKAQVVGWPPVRSFRKNVMSGQKPTTGDAVEGTDKTSGSSGATSSASAG  111

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
               A+VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE 
Sbjct  112  TTVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTI--GNYGPQGMKDFMNES  169

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK
Sbjct  170  KLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCK  229

Query  880  NR  885
            NR
Sbjct  230  NR  231



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 10/215 (5%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN----KDPIKPPSKA  420
            N +   +V  KRGFSETVDLKLNL S+ +  +D  +  K+ S+E N     DP KPP+KA
Sbjct  35   NTASEGEVARKRGFSETVDLKLNL-SSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKA  93

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR++RK+++      + +  E    G    FVKV MDGAPYLRKVDLKMY+SY
Sbjct  94   QVVGWPPVRSFRKHMLT---VQKSSNEETEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSY  150

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
            Q+LSDAL KMFSSFT+  GN G+QGM DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGD
Sbjct  151  QELSDALGKMFSSFTI--GNCGSQGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGD  208

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW+MFV+SCKRLRIMKG+EA GLAPRA+EK KNR
Sbjct  209  VPWKMFVESCKRLRIMKGTEATGLAPRAMEKRKNR  243



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 158/204 (77%), Gaps = 6/204 (3%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  453
            KRGFSETVDLKL L S    +    EK  S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN++A           +   GG A FVKV MDGAPYLRKVDLKMY++YQ+LSDAL KMF
Sbjct  94   RKNMLA-VQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSDALGKMF  152

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFT+  GN G+ G+ DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGDVPW+MFV+SCK
Sbjct  153  SSFTI--GNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCK  210

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKG+EA GLAPRA+EKCKNR
Sbjct  211  RLRIMKGTEATGLAPRAMEKCKNR  234



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 181/242 (75%), Gaps = 25/242 (10%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  378
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  379  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-------------Qksspeeaageksggg  519
                +  +KPP+K QVVGWPPVR++RKN+M+              K+S    A   +   
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTSGSSGATSSASAC  111

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+  GNYG QGM DFMNE 
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTI--GNYGPQGMKDFMNES  169

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK
Sbjct  170  KLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCK  229

Query  880  NR  885
            NR
Sbjct  230  NR  231



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 165/207 (80%), Gaps = 14/207 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVR  447
            +V  KR FS TVDLKLNL S   S  D K+K   PS   + DP KPP +KAQVVGWPPVR
Sbjct  40   EVVRKRDFSHTVDLKLNLIST--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVR  94

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            ++RKN++A      + +      G  AAFVKV MDGAPYLRKVDL+MY++YQQLSDALAK
Sbjct  95   SFRKNMLA-----TQKSSASEDSGEKAAFVKVSMDGAPYLRKVDLRMYKTYQQLSDALAK  149

Query  628  MFSSFTMDAGNYGAQGMI-DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  804
            MFSSFT+  GN G+QG++ DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPWEMF++
Sbjct  150  MFSSFTI--GNCGSQGLLKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFIE  207

Query  805  SCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  208  SCKRLRIMKGTEAIGLAPRAMEKCKNR  234



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 184/241 (76%), Gaps = 12/241 (5%)
 Frame = +1

Query  193  GGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKS  372
            G L L+ TEL LGLPGGGGG E+E+ K + KRGF+ET+DLKL LQ+  D+   + EK + 
Sbjct  4    GSLGLEETELRLGLPGGGGGGEAEAAKNSCKRGFAETIDLKLKLQTPVDAEEQIIEKARG  63

Query  373  --PSKE-----PNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa  528
              PS+         DP KPP+ KAQVVGWPPVR++RKNI++  S      G +  G   A
Sbjct  64   SLPSQRNLGVFCGSDPEKPPAPKAQVVGWPPVRSFRKNILSAHSEKGSKEGGEKPGNPVA  123

Query  529  aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERK  702
            AFVKV MDGAPYLRKVDLKMY SYQ+LS  L KMF SFT  +GN G+QGM   DFMNER+
Sbjct  124  AFVKVSMDGAPYLRKVDLKMYRSYQELSMGLQKMFGSFT--SGNCGSQGMSGRDFMNERE  181

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            +MDLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKN
Sbjct  182  VMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKN  241

Query  883  R  885
            R
Sbjct  242  R  242



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 164/214 (77%), Gaps = 19/214 (9%)
 Frame = +1

Query  277  TGKRGFSETVDLKLNL--------QSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            +GKRGFSETVDLKLN         +S  D  +++K K K  S  P      P +KAQVVG
Sbjct  48   SGKRGFSETVDLKLNFSSENDDVSRSGRDGQVEIK-KEKDASAAP-----APRAKAQVVG  101

Query  433  WPPVRNYRKNIMA---QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            WPPVR++RKNI+A   + +  ++AA +       AAFVKV MDGAPYLRKVDLK+Y+SYQ
Sbjct  102  WPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLYQSYQ  161

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            +LS AL KMFSSFT+  GN G+QGM DFMNE KL+DLLN SEYVP+YEDKDGDWMLVGDV
Sbjct  162  ELSTALGKMFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSEYVPSYEDKDGDWMLVGDV  219

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  220  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNR  253



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 165/216 (76%), Gaps = 11/216 (5%)
 Frame = +1

Query  262  ESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMK-SPSKE----PNKDPIKPPS-KAQ  423
            ++ K +GKR F ETVDLKL LQ+  D      EKMK SPS +       DP +P + KAQ
Sbjct  35   DATKNSGKRAFEETVDLKLKLQTTVDVEEVAAEKMKRSPSHKNVAASATDPERPRAPKAQ  94

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR+YRKNI+A   S + +  E    G  AAFVKVCMDGAPYLRKVDLKMY SYQ
Sbjct  95   VVGWPPVRSYRKNILA-VQSEKASKEEGEKPGNTAAFVKVCMDGAPYLRKVDLKMYRSYQ  153

Query  604  QLSDALAKMFSSFTMDAGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            +LS AL KMFSSFT  + N G+QGM   DF NE KLMDL+N SEYVPTYEDKDGDWMLVG
Sbjct  154  ELSMALEKMFSSFT--SANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYEDKDGDWMLVG  211

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  212  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 180/242 (74%), Gaps = 25/242 (10%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  378
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  379  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggg-------------  519
                +  +KPP+K QVVGWPPVR++RKN+M+ +      A E +                
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDAVEGNDKTPGSSGATSSASAC  111

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+  GNYG QGM DF+NE 
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTI--GNYGPQGMKDFLNES  169

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK
Sbjct  170  KLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCK  229

Query  880  NR  885
            NR
Sbjct  230  NR  231



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 161/211 (76%), Gaps = 21/211 (10%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAAD-----SSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGW  435
            VTG KRGFSETVDLKLNL +  +     ++LD KEK        +KDP KPP+KAQVVGW
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTLDSKEKSSC-----SKDPAKPPAKAQVVGW  81

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY +LS 
Sbjct  82   PPVRSYRKNVMVSCQKASSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSYDELST  134

Query  616  ALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            AL+ MFSSFTM  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVGDVPW 
Sbjct  135  ALSNMFSSFTM--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWP  192

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  193  MFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  223



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 173/235 (74%), Gaps = 17/235 (7%)
 Frame = +1

Query  196  GLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADS-----SLDLKE  360
            GLNL+ TELCLGLPG     ++ S     KRGFSETVDLKLNL +  +S     S D+  
Sbjct  6    GLNLRETELCLGLPG----GDTASPLTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVVS  61

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  540
             +        KDP KPP+KAQVVGWPPVR+YRKN+M        +A   +       FVK
Sbjct  62   AISKEKSSCTKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-------FVK  114

Query  541  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLN  720
            V MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTM   N G +GMIDFMNERK+MD ++
Sbjct  115  VSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTM-GKNGGEEGMIDFMNERKVMDTVS  173

Query  721  SSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            S +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  174  SWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 158/230 (69%), Gaps = 30/230 (13%)
 Frame = +1

Query  283  KRGFSET-VDLKLNLQS----------AADSSL-----------------DLKEKMKSPS  378
            KRGFSET VDLKLNL +           A S L                 D+ +  K   
Sbjct  36   KRGFSETLVDLKLNLNNKSSPPSDLDQTATSDLIMMKNDMNKSGGGVIAKDVNDNTKVNG  95

Query  379  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGA  558
               N D  KPP+KAQVVGWPPVR+YRKN++A + S      E          VKV MDGA
Sbjct  96   ANNNADLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGA  155

Query  559  PYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVP  738
            PYLRKVDLK+Y+SYQ LSDAL KMFSSFT+  GNYG+QGMIDFMNE KLMDL+N S+YVP
Sbjct  156  PYLRKVDLKLYKSYQDLSDALGKMFSSFTL--GNYGSQGMIDFMNESKLMDLINGSDYVP  213

Query  739  TYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            TYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR 
Sbjct  214  TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRI  263



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 173/222 (78%), Gaps = 24/222 (11%)
 Frame = +1

Query  253  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDL-----KEKMKSPSKEP---NKDP  399
            NES ++K +G KRGFSET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFSETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPPPPSRANDP  81

Query  400  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
             KPP+KAQVVGWPPVR++RKNI+ +  + EEAA           FVKV MDGAPYLRKVD
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIVQRNKNEEEAA-----------FVKVSMDGAPYLRKVD  130

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            +K+Y+SYQ+LSDALAKMFSSFT++    G+QGM DFMNE KL+DLLN S+YVPTY+DKDG
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIE--KCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDG  188

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  189  DWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 162/224 (72%), Gaps = 32/224 (14%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KYNGKRGFSETVDLKLNLSSTAMDSVSKVDLENMKEKV-----------VKPPAKAQVVG  73

Query  433  WPPVRNYRKNIMAQksspeeaage-------------ksggggpaaFVKVCMDGAPYLRK  573
            WPPVR++RKN+M+ +      A                +      A+VKV MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGQKPTTGDATVGNDKTSGSSGATSSASVCAAVAYVKVSMDGAPYLRK  133

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  753
            +DLK+Y++YQ LSDAL+KMFSSFT+  G YG QGM DFMNE  L+DLLN S+YVPTYEDK
Sbjct  134  IDLKLYKTYQDLSDALSKMFSSFTI--GTYGPQGMKDFMNESILIDLLNGSDYVPTYEDK  191

Query  754  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  DGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 161/201 (80%), Gaps = 8/201 (4%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSK-EPNKDPIKPPSKAQVVGWPPVR  447
            K +GKRGFSETVDLKLNL S  DS  D  EKMK  S   P+ DP KPP+KAQVVGWPPVR
Sbjct  39   KSSGKRGFSETVDLKLNLLSK-DSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVR  97

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            ++RKNI+      ++ + E+      AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDAL K
Sbjct  98   SFRKNILT----VQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALGK  153

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MFSSFT+  GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV+S
Sbjct  154  MFSSFTI--GNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVES  211

Query  808  CKRLRIMKGSEAIGLAPRAVE  870
            CKRLRIMKGSEAIGLA  + E
Sbjct  212  CKRLRIMKGSEAIGLAKSSGE  232



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 175/236 (74%), Gaps = 19/236 (8%)
 Frame = +1

Query  196  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS-----SLDLK  357
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL +  +S     S D+ 
Sbjct  6    GLNLRETELCLGLPGGDTASP-----VTGTKRGFSETVDLKLNLNNEPESKEGSKSHDVV  60

Query  358  EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFV  537
              +        KDP KPP+KAQVVGWPPVR+YRKN+M        +A   +       FV
Sbjct  61   SAISKEKSSCPKDPTKPPAKAQVVGWPPVRSYRKNVMGSCQKSSSSADTAA-------FV  113

Query  538  KVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLL  717
            KV MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTM   N G +GMIDFMNERK+MD +
Sbjct  114  KVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTM-GKNGGEEGMIDFMNERKVMDTV  172

Query  718  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            +S +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  173  SSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 164/234 (70%), Gaps = 26/234 (11%)
 Frame = +1

Query  259  SESLKVTGKRGFSET----VDLKLNLQS-------------AADSSLDLKEKMKSPSKEP  387
            + S   TGKRGFS+T    VDLKLNL S             A D++        +PS  P
Sbjct  41   TSSASFTGKRGFSDTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPP  100

Query  388  NKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeea-------ageksggggpaaFVKVC  546
             KDP KPP+KAQVVGWPPVR++RKNI+                   ++ G   AAFVKV 
Sbjct  101  VKDPAKPPAKAQVVGWPPVRSFRKNIVNNNVQKSNNKEEVQGGTSGRNHGNTGAAFVKVS  160

Query  547  MDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSS  726
            MDGAPYLRKVDLK+Y+SYQ+LSD+LAKMFSSFT+D     +QGM DFMNE KL+D LN S
Sbjct  161  MDGAPYLRKVDLKVYKSYQELSDSLAKMFSSFTIDKCE--SQGMKDFMNETKLIDFLNGS  218

Query  727  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            +YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR 
Sbjct  219  DYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 160/215 (74%), Gaps = 24/215 (11%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +  ++          + D KEK   P     KDP KPPSKA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHDVVTFDSKEKSSCP-----KDPAKPPSKA  81

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
             +LS+AL+ MFSSFTM   + G +GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVGD
Sbjct  135  DELSNALSNMFSSFTM-GKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGD  193

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  194  VPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 170/217 (78%), Gaps = 12/217 (6%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN----KDPIKPPS  414
            +E+ES ++T     S  VDLKLNL S   SS   K K  M + +KE N     DP KPP+
Sbjct  39   SETES-QITTDDESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPA  97

Query  415  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            KAQVVGWPPVR++RKN+++   + + +  ++S  GG AA VKV MDGAPYLRKVDL MY+
Sbjct  98   KAQVVGWPPVRSFRKNMLS---AQKSSTTDESKAGGNAALVKVSMDGAPYLRKVDLNMYK  154

Query  595  SYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  774
            +Y QLSDALAKMFSSFT+  GN G+QG IDFMNERKLMDLLN S+Y+PTYEDKDGDWMLV
Sbjct  155  TYPQLSDALAKMFSSFTI--GNCGSQGTIDFMNERKLMDLLNDSDYIPTYEDKDGDWMLV  212

Query  775  GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            GDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  213  GDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  249



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 160/215 (74%), Gaps = 23/215 (11%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQS-AADS-SLDLKEKMKSPSKEPNKDPIKPPSKAQV  426
            +E ++ K  GKRGFSETVDLKLNL S A DS S+D  EKMK       K  +KPP+K+QV
Sbjct  18   HEEKAAKNNGKRGFSETVDLKLNLSSMATDSGSMDGSEKMKE------KTTVKPPAKSQV  71

Query  427  VGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQ  606
            VGWPPVR              + A + +     AAFVKV MDGAPYLRKVDLK+Y SY +
Sbjct  72   VGWPPVR------------XADEAEKPTSSSAAAAFVKVSMDGAPYLRKVDLKLYNSYHE  119

Query  607  LSDALAKMFSSFTMDAGNYGAQGMIDFMNER-KLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            LSDAL KMFSSFT  +GN+  QGM DFMNE  KL+DLLN SEY PTYEDKDGDWMLVGDV
Sbjct  120  LSDALGKMFSSFT--SGNHEQQGMNDFMNENNKLIDLLNGSEYAPTYEDKDGDWMLVGDV  177

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            PWEMFVDSCKRLRIMKGSEAIGLAPRA+ KCKNRC
Sbjct  178  PWEMFVDSCKRLRIMKGSEAIGLAPRALVKCKNRC  212



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = +1

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKN+MAQKS+ ++   + S     AAFVKVCMDGAPYLRKVDLKMY+SY+
Sbjct  1    VVGWPPVRSFRKNVMAQKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKSYK  60

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            QLSDALAKMFSSFTM  GNYGAQGMIDFMNE KLMDLLN+SEYVP+YEDKDGDWMLVGDV
Sbjct  61   QLSDALAKMFSSFTM--GNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDKDGDWMLVGDV  118

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  119  PWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  152



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 160/214 (75%), Gaps = 17/214 (8%)
 Frame = +1

Query  283  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  423
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+SY 
Sbjct  96   VVGWPPVRSFRKNMFA--AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYP  153

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            +LSDAL KMFSSFT+  GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGDWMLVGDV
Sbjct  154  ELSDALGKMFSSFTI--GNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDV  211

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  212  PWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNR  245



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 162/207 (78%), Gaps = 8/207 (4%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLD---LKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            KR FSE++DLKL L + + S  +   + E +   + +  ++  KPPSK QVVGWPPVR++
Sbjct  34   KRVFSESIDLKLELNTLSSSGNNNNNIDENIHQKNLKAEENNAKPPSKTQVVGWPPVRSF  93

Query  454  RKNIMA---QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  624
            RKNI+A     SS      +KS GG  AAFVKV +DGAPYLRKVDLKMY SYQQLSDAL 
Sbjct  94   RKNILAVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRKVDLKMYTSYQQLSDALG  153

Query  625  KMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  804
            KMFSSFT+  GN G++G+ D MNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVD
Sbjct  154  KMFSSFTI--GNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVD  211

Query  805  SCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SCKR+RIMKGSEAIGLAPRAVEKCKNR
Sbjct  212  SCKRIRIMKGSEAIGLAPRAVEKCKNR  238



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 176/247 (71%), Gaps = 15/247 (6%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQS  330
            MEVG KMG M  E   +  K  E                 +V  KR FS TVDLKLNL S
Sbjct  1    MEVGVKMG-MKGEGDEVGGKEKEKMGYEETELRLGLPGDGEVVRKRDFSHTVDLKLNLIS  59

Query  331  AADSSLDLKEKMKSPSKEPNKDPIKPP-SKAQVVGWPPVRNYRKNIMAQksspeeaagek  507
               S  D K+K   PS   + DP KPP +KAQVVGWPPVR++RKN++A      + +   
Sbjct  60   T--SPTDDKDKNIVPS---HLDPAKPPPAKAQVVGWPPVRSFRKNMLA-----TQKSSGS  109

Query  508  sggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMI-D  684
               G  AAFVKV MDGAPYLRKVDL+MY++YQQLSDALAKMFSSFT+  GN G+QG++ D
Sbjct  110  EDSGEKAAFVKVSMDGAPYLRKVDLRMYKTYQQLSDALAKMFSSFTI--GNCGSQGLLKD  167

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            FMNE KLMDLLN S+YVPTYEDKDGD MLVGDVPWEMF++SCKRLRIMKG+EAIGLAPRA
Sbjct  168  FMNESKLMDLLNGSDYVPTYEDKDGDLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRA  227

Query  865  VEKCKNR  885
            +EKCKNR
Sbjct  228  MEKCKNR  234



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 161/216 (75%), Gaps = 26/216 (12%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  601  QQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
             +LS+AL+ MFSSFTM  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVG
Sbjct  135  DELSNALSNMFSSFTM--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVG  192

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  193  DVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 165/221 (75%), Gaps = 27/221 (12%)
 Frame = +1

Query  265  SLKVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQV  426
            ++K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQV
Sbjct  23   AMKNNGKRGFSETVDLKLNLSSTAMDSVSGVDLENMKEKV-----------VKPPAKAQV  71

Query  427  VGWPPVRNYRKNIMAQksspeeaageksggggpaa--------FVKVCMDGAPYLRKVDL  582
            VGWPPVR++RKN+M+ +      A E +     +         +VKV +DGAPYLRK+DL
Sbjct  72   VGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNAATSSAAAYVKVSLDGAPYLRKIDL  131

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            K+Y++YQ LSDAL+KMFSSFT+  GN G QGM DFMNE +L+DLLN S+YVPTYEDKDGD
Sbjct  132  KLYKTYQDLSDALSKMFSSFTI--GNCGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGD  189

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  190  WMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  230



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 158/204 (77%), Gaps = 6/204 (3%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQVVGWPPVRNY  453
            KRGFSETVDLKL L S    +    EK +S  +E N    DP KPP+KAQVVGWPPVR++
Sbjct  34   KRGFSETVDLKLKLSSKERGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRSF  93

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN++A           +   GG A FVKV MDGAPYLRKVDLKMY++YQ+LS AL +MF
Sbjct  94   RKNMLA-VQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSGALEEMF  152

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFT+  GN G+ G+ DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGDVPW+MFV+SCK
Sbjct  153  SSFTI--GNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCK  210

Query  814  RLRIMKGSEAIGLAPRAVEKCKNR  885
            RLRIMKG+EA GLAPRA+EKCKNR
Sbjct  211  RLRIMKGTEATGLAPRAMEKCKNR  234



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 156/207 (75%), Gaps = 14/207 (7%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN------KDPIKPPSKAQVVGWPPV  444
            KRGFSETVDLKLNL     SS D  EK+KS  KE N        P KPP+K QVVGWPPV
Sbjct  33   KRGFSETVDLKLNL-----SSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPV  87

Query  445  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  624
            R++RKN++               GG  AAFVKV MDGAPYLRKVDL+MY +YQ L  AL 
Sbjct  88   RSFRKNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYQDLYHALG  146

Query  625  KMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  804
            KMFSSFT+  GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW MFV+
Sbjct  147  KMFSSFTI--GNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVE  204

Query  805  SCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            SCKRLRI+KG+EAIGLAPRA+EKCKNR
Sbjct  205  SCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 155/201 (77%), Gaps = 2/201 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL +MFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGEMFSSF  155

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            T+  GN G+ GM DF+NE KL+DLL  ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  156  TI--GNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKG+EA GLAPRA+EKCK+R
Sbjct  214  IMKGTEATGLAPRAMEKCKSR  234



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 157/203 (77%), Gaps = 6/203 (3%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  456
            KRGFSETVDLKLNL S+ D+S  +K  +K K P       P KPP+K QVVGWPPVR++R
Sbjct  33   KRGFSETVDLKLNL-SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFR  91

Query  457  KNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  636
            KN++               GG  AAFVKV MDGAPYLRKVDL+MY +Y+ L DAL KMFS
Sbjct  92   KNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMFS  150

Query  637  SFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  816
            SFT+  GN G+QGM DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR
Sbjct  151  SFTI--GNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKR  208

Query  817  LRIMKGSEAIGLAPRAVEKCKNR  885
            LRI+KG+EAIGLAPRA+EKCKNR
Sbjct  209  LRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 164/217 (76%), Gaps = 31/217 (14%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPPSK  417
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP+K
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  418  AQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYES  597
            AQVVGWPPVR+YRKN++      E AA           FVKV MDGAPYLRKVDLKMY+S
Sbjct  82   AQVVGWPPVRSYRKNVLVSSQKSEAAA-----------FVKVSMDGAPYLRKVDLKMYKS  130

Query  598  YQQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  774
            Y +LS+AL+ MFSSFTM  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLV
Sbjct  131  YDELSNALSNMFSSFTM--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLV  188

Query  775  GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            GDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  189  GDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  225



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 180/242 (74%), Gaps = 25/242 (10%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPS  378
            +N +ATEL LGLPGG  G E  S+K  GKRGFSETVDLKLNL S   S  DL E MK   
Sbjct  2    INFEATELRLGLPGGSHGGEM-SVKNNGKRGFSETVDLKLNLSSTV-SEADL-ENMK---  55

Query  379  KEPNKDPIKPPSKAQVVGWPPVRNYRKNIMA-------------Qksspeeaageksggg  519
                +  +KPP+K QVVGWPPVR++RKN+M+              K+S    A   +   
Sbjct  56   ----EKVVKPPAKTQVVGWPPVRSFRKNVMSGQKPITGDTVEGNDKTSGSSGATSSASAC  111

Query  520  gpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNER  699
              AA+VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+  GNYG QGM DFMNE 
Sbjct  112  AAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTI--GNYGPQGMKDFMNES  169

Query  700  KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK  879
            KL+DLLN S+ VPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK
Sbjct  170  KLIDLLNGSDCVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCK  229

Query  880  NR  885
            NR
Sbjct  230  NR  231



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 144/166 (87%), Gaps = 3/166 (2%)
 Frame = +1

Query  391  KDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLR  570
            KDP KPP+KAQVVGWPPVRNYRKN+MA + S E      SGGG  A FVKV MDGAPYLR
Sbjct  2    KDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVA-FVKVSMDGAPYLR  60

Query  571  KVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYED  750
            KVDLKMY SY+ LSDALAKMFSSFTM  G+YGAQGMIDFMNE K+MDLLNSSEYVP+YED
Sbjct  61   KVDLKMYTSYKDLSDALAKMFSSFTM--GSYGAQGMIDFMNESKVMDLLNSSEYVPSYED  118

Query  751  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            KDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR 
Sbjct  119  KDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  164



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 164/214 (77%), Gaps = 15/214 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  429
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKNIM+     +   G K  G   A FVKV MDGAPYLRK+DLKMY SYQ+L
Sbjct  90   GWPPVRSFRKNIMS----VQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQEL  145

Query  610  SDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            S AL KMFSSFT+  GN  +QG+   DFMNE KLMDL+N SEYVPTYEDKDGDWMLVGDV
Sbjct  146  SVALEKMFSSFTI--GNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDV  203

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMF+DSCKRLRIMKGSEAIGLAP+A+EKCKN+
Sbjct  204  PWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNK  237



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 161/216 (75%), Gaps = 26/216 (12%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +  ++          + D K+K   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCP-----KDPAKPPAKA  81

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  134

Query  601  QQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
             +LS+AL+ MFSSFT+  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVG
Sbjct  135  DELSNALSNMFSSFTL--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVG  192

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  193  DVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 163/216 (75%), Gaps = 25/216 (12%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +  ++          + D K+K+ S  K    DP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPK----DPAKPPAKA  82

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M     P       +       FVKV MDGAPYLRKVDL+MY+SY
Sbjct  83   QVVGWPPVRSYRKNVMVSCQKPSSGPEAAA-------FVKVSMDGAPYLRKVDLRMYKSY  135

Query  601  QQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
             +LS+AL+ MFSSFTM  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVG
Sbjct  136  DELSNALSNMFSSFTM--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVG  193

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  194  DVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  229



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 166/225 (74%), Gaps = 33/225 (15%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      ++KEK+           +KPP+KAQVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTAMDSVSELDLVNMKEKV-----------VKPPAKAQVVG  73

Query  433  WPPVRNYRKNIMA-------------QksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            WPPVR++RKN+M+             + +S    A   +  G  AA+VK+ MDGAPYLRK
Sbjct  74   WPPVRSFRKNVMSGPKPTTGDAFQATENTSSSNGATSSASIGATAAYVKISMDGAPYLRK  133

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLM-DLLNSSEYVPTYED  750
            +DLK+Y++YQ LSD L+KMFSSFT+  G+YG QGM D +NE KLM DLLN S+YVPTYED
Sbjct  134  IDLKLYKAYQDLSDTLSKMFSSFTI--GSYGPQGMKDIVNEGKLMIDLLNGSDYVPTYED  191

Query  751  KDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            KDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  KDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 150/200 (75%), Gaps = 10/200 (5%)
 Frame = +1

Query  286  RGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNI  465
            RGFS+TVDL  N     D   D+K+     SK    D +KPP+KAQVVGWPPVR+YRKN+
Sbjct  48   RGFSDTVDLMKN-----DKKADVKD---VCSKVVVTDSVKPPAKAQVVGWPPVRSYRKNV  99

Query  466  MAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFT  645
            M  +       GE          VKV MDGAPYLRKV LKMY+SYQ+LSDAL KMFS FT
Sbjct  100  MTLQKGTAGEEGETVDKSSSGGLVKVSMDGAPYLRKVHLKMYKSYQELSDALGKMFSFFT  159

Query  646  MDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRI  825
            +  GNYG QGMIDFMNERKLMDLLN S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR+RI
Sbjct  160  L--GNYGEQGMIDFMNERKLMDLLNDSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRIRI  217

Query  826  MKGSEAIGLAPRAVEKCKNR  885
            MKG EA GLAPRA+EKCKNR
Sbjct  218  MKGKEAAGLAPRAMEKCKNR  237



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 172/222 (77%), Gaps = 24/222 (11%)
 Frame = +1

Query  253  NESESLKVTG-KRGFSET--VDLKLNLQSAADSSLDL-----KEKMKSPSKEP---NKDP  399
            NES ++K +G KRGF ET  VDLKLNL S+ DS+ D       EK  + +  P     DP
Sbjct  22   NESTTVKGSGGKRGFPETASVDLKLNLSSSDDSASDSPSSASTEKTTTAAPLPPSRANDP  81

Query  400  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
             KPP+KAQVVGWPPVR++RKNI+ +  + EEAA           FVKV MDGAPYLRKVD
Sbjct  82   AKPPAKAQVVGWPPVRSFRKNIVQRNKNEEEAA-----------FVKVSMDGAPYLRKVD  130

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            +K+Y+SYQ+LSDALAKMFSSFT++    G+QGM DFMNE KL+DLLN S+YVPTY+DKDG
Sbjct  131  IKLYKSYQELSDALAKMFSSFTIE--KCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDG  188

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  189  DWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 169/226 (75%), Gaps = 23/226 (10%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNK-------------D  396
            ++E++K +GKRGF+ETVDLKL LQ+     +D+KE +   + E  K             D
Sbjct  25   DAEAVKNSGKRGFAETVDLKLQLQTP----VDVKEAVAEAASEKVKRSVSQKSLVSCGSD  80

Query  397  PIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            P KP + KAQVVGWPPVR++RKNI++  +S + +  E       AAFVKV MDGAPYLRK
Sbjct  81   PEKPSAPKAQVVGWPPVRSFRKNILS-VNSEKGSKEEGEKSSISAAFVKVSMDGAPYLRK  139

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYE  747
            VDLKMY SYQ+L  AL KMF SFT   GNYG+QG+   DFMNE K+MDLLN SEYVPTYE
Sbjct  140  VDLKMYRSYQELFMALQKMFISFT--GGNYGSQGLSGRDFMNESKVMDLLNGSEYVPTYE  197

Query  748  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKNR
Sbjct  198  DKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNR  243



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   261 bits (667),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 159/214 (74%), Gaps = 17/214 (8%)
 Frame = +1

Query  283  KRGFSET-------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN---KDPIKPPSKAQ  423
            KRGFSET       VDL LNL   ++AA    D +EK K+  KE      DP KPP+KAQ
Sbjct  36   KRGFSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQ  95

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+SY 
Sbjct  96   VVGWPPVRSFRKNMFA--AQKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYP  153

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            +LSDAL KMFSSFT+  GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGDWMLVGDV
Sbjct  154  ELSDALGKMFSSFTI--GNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLVGDV  211

Query  784  PWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PWEMFV+SCKRL IMKG EAIGLAPRAVEKCKNR
Sbjct  212  PWEMFVESCKRLHIMKGKEAIGLAPRAVEKCKNR  245



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 159/215 (74%), Gaps = 24/215 (11%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  26   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  80

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  133

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
             +LS+AL+ MFSSFTM   + G +GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVGD
Sbjct  134  DELSNALSNMFSSFTM-GKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGD  192

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  193  VPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 159/215 (74%), Gaps = 24/215 (11%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  134

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
             +LS+AL+ MFSSFTM   + G +GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVGD
Sbjct  135  DELSNALSNMFSSFTM-GKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGD  193

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  194  VPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 158/217 (73%), Gaps = 20/217 (9%)
 Frame = +1

Query  283  KRGFSET-------VDLKLNLQ------SAADSSLDLKEKMKSPSKEPNK---DPIKPPS  414
            KRGFSET       VDL LNL       +A     D +E  K+  KE N    DP KPP+
Sbjct  35   KRGFSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPA  94

Query  415  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            KAQVVGWPPVR++RKN+ A  +       E       A+FVKV MDGAPYLRKVDLKMY+
Sbjct  95   KAQVVGWPPVRSFRKNMFA--AQKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYK  152

Query  595  SYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  774
            SY +LSDAL KMFSSFT+  GN  +QG  DFMNE KLMDLLNSS+YVPTYED+DGDWMLV
Sbjct  153  SYPELSDALGKMFSSFTI--GNCESQGFKDFMNESKLMDLLNSSDYVPTYEDRDGDWMLV  210

Query  775  GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            GDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  211  GDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNR  247



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 163/241 (68%), Gaps = 32/241 (13%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEP---------------  387
            N   + +  GKR F ETVDLKLN  S  D     K +  +P+++                
Sbjct  31   NGEGATRSGGKRVFLETVDLKLNFSSKEDGGSVEKIRASAPAEKKMNSSDGKEKSVAAAA  90

Query  388  ----------NKDPIKPPSKAQVVGWPPVRNYRKNIMA-----Qksspeeaageksgggg  522
                      + +  KPP+KAQVVGWPPVR++RKNIMA        + +  +        
Sbjct  91   AAAAPPPPSSSSEVAKPPAKAQVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATS  150

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
             AAFVKV MDGAPYLRKVDLK+Y+SYQ LSDALAKMFSSFT+  GN G+ GM DFMNE K
Sbjct  151  GAAFVKVSMDGAPYLRKVDLKLYKSYQDLSDALAKMFSSFTI--GNCGSGGMKDFMNESK  208

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            L+DLLN S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKN
Sbjct  209  LIDLLNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  268

Query  883  R  885
            R
Sbjct  269  R  269



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 161/209 (77%), Gaps = 14/209 (7%)
 Frame = +1

Query  292  FSETVDLKLNLQSAADSS---LDLKEKMK-SPSKEP----NKDPIKPPS-KAQVVGWPPV  444
            FSET+DLKL LQ+ ADS    +++ EKMK SPS +       DP KPP+ KAQVVGWPPV
Sbjct  35   FSETIDLKLKLQTVADSKEVVMEVSEKMKRSPSHKNILPCTNDPEKPPAPKAQVVGWPPV  94

Query  445  RNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  624
            R++RKN+MA  S        +      A  VKV MDGAPYLRKVDLK+Y SY++LS AL 
Sbjct  95   RSFRKNMMATHSDKGSKEAGEKFSNSAA-LVKVSMDGAPYLRKVDLKIYSSYKELSMALE  153

Query  625  KMFSSFTMDAGNYGAQGM--IDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            KMFSSFT  +GN G+QGM   DFMNE KLMDLLN SEYVPTYEDKDGDWMLVGDVPWEMF
Sbjct  154  KMFSSFT--SGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMF  211

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VDSCKRLR+MKGSEAIGLAPRA+EKCKNR
Sbjct  212  VDSCKRLRMMKGSEAIGLAPRAMEKCKNR  240



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 163/221 (74%), Gaps = 18/221 (8%)
 Frame = +1

Query  271  KVTGKRGFSET------VDLKLNLQS------AADSSLDLKEKMKSPSKEPNKDPIKPPS  414
            +V  KRGFSET      VDL LNL S       AD S   K  ++        DP KPP+
Sbjct  38   EVVRKRGFSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPA  97

Query  415  KAQVVGWPPVRNYRKNIMAQkss----peeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            KAQVVGWPPVR++RKN++A + S             GGGG A+FVKV MDGAPYLRKVDL
Sbjct  98   KAQVVGWPPVRSFRKNMLAVQKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDL  157

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            KMY+SY+ LSD+LAKMFSSFT+  G   +QGM DFMNE KLMDLLNSS+YVPTYEDKDGD
Sbjct  158  KMYKSYRDLSDSLAKMFSSFTI--GTCESQGMKDFMNESKLMDLLNSSDYVPTYEDKDGD  215

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            WMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  216  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  256



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 153/201 (76%), Gaps = 18/201 (9%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGF ET+D KLN  S                 E   D +KPP+KAQVVGWPPVR++RKN
Sbjct  32   KRGFEETLDFKLNFASNG---------------ENINDSVKPPAKAQVVGWPPVRSFRKN  76

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            IMA      ++   + G GG  AFVKV MDGAPYLRK+DLKMY++YQ+LSDAL KMFSSF
Sbjct  77   IMA-VKKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRKIDLKMYKTYQELSDALGKMFSSF  135

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            TM  G    QGM+DFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  136  TM--GKCDTQGMMDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVESCKRLR  193

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            +MKG+EA GLAPRA+EKCK+R
Sbjct  194  VMKGTEAKGLAPRAMEKCKSR  214



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 163/216 (75%), Gaps = 14/216 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADS---SLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  423
            K +GKRGFSET+DLKL L +  DS    +++ +KMK    + N      DP KP + KAQ
Sbjct  37   KNSGKRGFSETIDLKLKLHTVVDSKEVEMEVWDKMKRLPSQKNLLPCTNDPEKPSAPKAQ  96

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKNI+A   S + +  E        A VKV MDGAPYLRKVDLKMY SYQ
Sbjct  97   VVGWPPVRSFRKNILA-THSDKGSKVEGEKSSNSVALVKVSMDGAPYLRKVDLKMYRSYQ  155

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            +LS AL KMFSSFT  +GN G+QGM   DFMNE KLMDLLN SEYVPTYEDKDGD MLVG
Sbjct  156  ELSMALEKMFSSFT--SGNCGSQGMSGRDFMNESKLMDLLNGSEYVPTYEDKDGDLMLVG  213

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  214  DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  249



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 174/240 (73%), Gaps = 29/240 (12%)
 Frame = +1

Query  196  GLNLKATElclglpgggggNESESLKVTG-KRGFSETVDLKLNLQSAADS----------  342
            GLNL+ TELCLGLPGG   +      VTG KRGFSETVDLKLNL S  +S          
Sbjct  170  GLNLRETELCLGLPGGDTAS-----PVTGTKRGFSETVDLKLNLNSEPESKEGSKSHDVV  224

Query  343  SLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  522
            S   KEK   P     KDP KP +KAQVVGWPPVR+YRKN+M        +A   +    
Sbjct  225  SAVFKEKSSCP-----KDPTKPLAKAQVVGWPPVRSYRKNVMGSCQKSSSSAETAA----  275

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
               FVKV MDGAPYLRKVDLKMY+SY +LSDAL+ MFSSFTM   N G +GMIDFMNERK
Sbjct  276  ---FVKVSMDGAPYLRKVDLKMYKSYDELSDALSNMFSSFTM-GNNGGEEGMIDFMNERK  331

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            +MD ++S +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+
Sbjct  332  VMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKS  391



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 178/241 (74%), Gaps = 15/241 (6%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSET--VDLKLNLQSAADSSLDLKEKMKS  372
            +N + TEL LGLPG G   ES      GKRGFSET  VDLKLNL    DS+      + S
Sbjct  15   INFEETELRLGLPGAGDHGESPVKNSCGKRGFSETANVDLKLNLSPINDSASS-SPTIAS  73

Query  373  PSKEPNKDP-----IKPP--SKAQVVGWPPVRNYRKNIM---AQksspeeaageksgggg  522
             ++   KD      + PP  +KAQVVGWPPVR++RKNI+    + +S  E     SGGGG
Sbjct  74   VAENKGKDTTTSATVSPPPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
              AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+D  N G+Q   DFMNE K
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTID--NCGSQVTKDFMNESK  191

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            L+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKN
Sbjct  192  LIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKN  251

Query  883  R  885
            R
Sbjct  252  R  252



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 156/206 (76%), Gaps = 13/206 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPNK---DPIKPPSKAQVVGWPPVR  447
            KRGFSETVDLKLNL +  +S    K    + S SK+ NK   DP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            +YRKN+M       +             FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNDVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MF SFTM   N G +GMIDFMNER++ DL+NS +YVP+YEDKDGDWMLVGDVPW MFVD+
Sbjct  139  MFGSFTM-GKNGGEEGMIDFMNEREVRDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDT  197

Query  808  CKRLRIMKGSEAIGLAPRAVEKCKNR  885
            CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  198  CKRLRLMKGSDAIGLAPRAMEKCKSR  223



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 164/220 (75%), Gaps = 34/220 (15%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSA-----ADSSLDL------KEKMKSPSKEPNKDPIKPP--  411
            VTG KRGFSETVDLKLNL +        ++ D+      KEK  SP     KDP KPP  
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSP-----KDPAKPPAK  81

Query  412  -SKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  588
             S+AQVVGWPPVR+YRKN++      E AA           FVKV MDGAPYLRKVDLKM
Sbjct  82   ISRAQVVGWPPVRSYRKNVLVSSQKSEAAA-----------FVKVSMDGAPYLRKVDLKM  130

Query  589  YESYQQLSDALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            Y+SY +LS+AL+ MFSSFTM  G YG + GMIDFMNERKLMDL+NS +YVP+YEDKDGDW
Sbjct  131  YKSYDELSNALSNMFSSFTM--GKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDW  188

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  189  MLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 154/206 (75%), Gaps = 13/206 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN---KDPIKPPSKAQVVGWPPVR  447
            KRGFSETVDLKLNL +  +S    K    + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            +YRKN+M                     FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNGVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MF SFTM   N G +GMIDFMNERK+ DL+NS +YVP+YEDKDGDWMLVGDVPW MFVD+
Sbjct  139  MFGSFTM-GKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDT  197

Query  808  CKRLRIMKGSEAIGLAPRAVEKCKNR  885
            CKRLR+MKGS+AIGLAPRA+ KCK+R
Sbjct  198  CKRLRLMKGSDAIGLAPRAMGKCKSR  223



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   254 bits (650),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 140/179 (78%), Gaps = 2/179 (1%)
 Frame = +1

Query  349  DLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa  528
            D+ +  K      N D  KPP+KAQVVGWPPVR+YRKN++A + S      E        
Sbjct  17   DVNDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANG  76

Query  529  aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLM  708
              VKV MDGAPYLRKVDLK+Y+SYQ LSDAL KMFSSFT+  GNYG+QGMIDFMNE KLM
Sbjct  77   GLVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTL--GNYGSQGMIDFMNESKLM  134

Query  709  DLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DL+N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  135  DLINGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  193



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 158/215 (73%), Gaps = 24/215 (11%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADS----------SLDLKEKMKSPSKEPNKDPIKPPSKA  420
            VTG KRGFSETVDLKLNL +   +          + D KEK   P     KDP KPP+KA
Sbjct  27   VTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACP-----KDPAKPPAKA  81

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWP VR+YRKN+M             +       FVKV MDGAPYLRK+DL+MY+SY
Sbjct  82   QVVGWPLVRSYRKNVMVSCQKSSGGPEAAA-------FVKVSMDGAPYLRKIDLRMYKSY  134

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
             +LS+AL+ MFSSFTM   + G +GMIDFMNERKLMDL+NS +YVP+YEDKDGDWMLVGD
Sbjct  135  DELSNALSNMFSSFTM-GKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGD  193

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  194  VPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 175/241 (73%), Gaps = 16/241 (7%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESES-LKVTG-KRGFSET--VDLKLNLQSAADS-----SLD  351
            +N + TEL LGLPGG     SES +K +G KRGFSET  VDLKLNL    DS     ++ 
Sbjct  15   INFEETELRLGLPGGSASEHSESPIKTSGGKRGFSETSNVDLKLNLSPTNDSVSPSSTIP  74

Query  352  LKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM---AQksspeeaageksgggg  522
            L    K   K     P  P +KAQVVGWPPVR++RKNI+      +  E        GGG
Sbjct  75   LVPANKVKDKTSTTAP--PRAKAQVVGWPPVRSFRKNIVNVQKSNNEVEAEKKTSGSGGG  132

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
              AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+  GN G+Q   DFMNE K
Sbjct  133  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTI--GNCGSQVTKDFMNESK  190

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            L+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKN
Sbjct  191  LIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKN  250

Query  883  R  885
            R
Sbjct  251  R  251



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 162/216 (75%), Gaps = 16/216 (7%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPN-----KDPIKPPS-KAQ  423
            + T KRGFS+T+DLKL L++    S D K   EKMK  + + N      DP KPP+ KAQ
Sbjct  30   EATKKRGFSKTIDLKLKLRTV--DSKDAKPEAEKMKRSASQKNLLACSSDPEKPPAPKAQ  87

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKNIM+   S +    E       A FVKV MDGAPYLRK+DLKMY SYQ
Sbjct  88   VVGWPPVRSFRKNIMS-IQSDKGKKDEGEKSATSATFVKVSMDGAPYLRKIDLKMYSSYQ  146

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            +LS AL KMFSSFT+  GN  +QG+   DFMNE KLMDLLN SEYVPTYEDKDGDWMLVG
Sbjct  147  ELSVALEKMFSSFTI--GNCSSQGIKGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVG  204

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFVDSCKRLRIMKGSEAIGLAP+ +EKCKN+
Sbjct  205  DVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQ  240



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 9/178 (5%)
 Frame = +1

Query  352  LKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa  531
            +KEK   P   P+ DP KPP+KAQVVGWPPVR++RKNI+      ++ + E+      AA
Sbjct  1    MKEKSALP---PSNDPAKPPAKAQVVGWPPVRSFRKNILT----VQKNSSEEEKASSSAA  53

Query  532  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMD  711
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+  GN G+QGM DFMNE KL+D
Sbjct  54   FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTI--GNCGSQGMKDFMNESKLID  111

Query  712  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LLN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  112  LLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  169



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 162/215 (75%), Gaps = 16/215 (7%)
 Frame = +1

Query  274  VTGKRGFSET------VDLKLNLQSAAD--SSLDLKEKMKSPSKEPN---KDPIKPPSKA  420
            V  KRGFSET      +DL LNL +  +  S +D  +  K   KE      DP KPP+KA
Sbjct  35   VVRKRGFSETETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKA  94

Query  421  QVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            QVVGWPPVR+YRKN++A + S  +  GE++       FVKV MDGAPYLRKVDLK+Y SY
Sbjct  95   QVVGWPPVRSYRKNMLAMQKSSNDVVGEENNAIS---FVKVSMDGAPYLRKVDLKIYNSY  151

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
             QLSD+L KMFSSFT+  GN  +QGM DFMNE KLMDLLN+S+YVPTYEDKDGDWM+VGD
Sbjct  152  SQLSDSLGKMFSSFTI--GNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDWMVVGD  209

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  210  VPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  244



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 164/216 (76%), Gaps = 14/216 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQS---AADSSLDLKEKMKSPSKEPN-----KDPIKPPS-KAQ  423
            K  GKRGF+ET+DLKL LQ+   A +++++  E MK      N      DP KPP+ KAQ
Sbjct  28   KNCGKRGFAETIDLKLQLQTPADAEEAAVEAAETMKRSLSHKNVVSCGSDPEKPPAPKAQ  87

Query  424  VVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQ  603
            VVGWPPVR++RKN+++   S +    E    G  AAFVKV MDGAPYLRKVDLKMY SY 
Sbjct  88   VVGWPPVRSFRKNVLS-VHSVKGGKEEGEKSGTSAAFVKVSMDGAPYLRKVDLKMYRSYH  146

Query  604  QLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            +LS AL KMFS+FT   GN G+QGM   DFMNE K+MDLLN SEYVPTYEDKDGDWMLVG
Sbjct  147  ELSMALQKMFSTFT--GGNCGSQGMSGRDFMNESKVMDLLNGSEYVPTYEDKDGDWMLVG  204

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  205  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  240



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 154/202 (76%), Gaps = 13/202 (6%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSS-LDLK-EKMKSPSKEPN-----KDPIKPPSKAQVV  429
            +V  KRGFSETVDLKLNL S  D+S +D   EK+K   +E N      DP KPP+KAQVV
Sbjct  47   EVVRKRGFSETVDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVV  106

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKN++A               G  AA VKV MDGAPYLRKVDL+MY SY QL
Sbjct  107  GWPPVRSFRKNMLA----ATTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQL  162

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            SDALAKMFSSFT+  GN G+QG+ DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW
Sbjct  163  SDALAKMFSSFTI--GNCGSQGIKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPW  220

Query  790  EMFVDSCKRLRIMKGSEAIGLA  855
            EMFV+SCKRLRIMKG+EAIGL 
Sbjct  221  EMFVESCKRLRIMKGTEAIGLG  242



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 161/211 (76%), Gaps = 17/211 (8%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN---KDPIKPPSKAQVVGW  435
            VTG KRGFSETVDLKLNL +  +S+   K    + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR+YRKN+M     P       S       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSCQKPSGGTETAS-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  616  ALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            AL+ MFSSFTM  G YG + GMIDFMNER  M L+N+ +YVP+YEDKDGDWMLVGDVPW 
Sbjct  140  ALSNMFSSFTM--GKYGGEEGMIDFMNERN-MALVNTWDYVPSYEDKDGDWMLVGDVPWP  196

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  197  MFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 161/211 (76%), Gaps = 17/211 (8%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN---KDPIKPPSKAQVVGW  435
            VTG KRGFSETVDLKLNL +  +S+   K    + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR+YRKN+M     P       S       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSCQKPSGGTETAS-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  616  ALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            AL+ MFSSFTM  G YG + GMIDFMNER  M L+N+ +YVP+YEDKDGDWMLVGDVPW 
Sbjct  140  ALSNMFSSFTM--GKYGGEEGMIDFMNERN-MALVNTWDYVPSYEDKDGDWMLVGDVPWP  196

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  197  MFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 153/206 (74%), Gaps = 13/206 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEK--MKSPSKEPN---KDPIKPPSKAQVVGWPPVR  447
            KRGFSETVDLKLNL +  +S    K    + S SKE N   KDP KPP+KAQVVGWPPVR
Sbjct  26   KRGFSETVDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  448  NYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAK  627
            +YRKN+M                     FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ 
Sbjct  86   SYRKNVMGSCQKSNGVTETAV-------FVKVSMDGAPYLRKVDLKMYKSYDELSNALSN  138

Query  628  MFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDS  807
            MF SFTM   N G +GMIDFMNERK+ DL+NS +YVP+YEDKDG WMLVGDVPW MFVD+
Sbjct  139  MFGSFTM-GKNGGEEGMIDFMNERKVRDLVNSWDYVPSYEDKDGVWMLVGDVPWPMFVDT  197

Query  808  CKRLRIMKGSEAIGLAPRAVEKCKNR  885
            CKRLR+MKGS+AIGLAPRA+ KCK+R
Sbjct  198  CKRLRLMKGSDAIGLAPRAMGKCKSR  223



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 165/218 (76%), Gaps = 14/218 (6%)
 Frame = +1

Query  265  SLKVTGKRGFSET--------VDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKA  420
            + +V  KRGFSET        VDLKLNL S  + + D + K K  +   +    KPP+KA
Sbjct  30   TTEVVRKRGFSETESESETNTVDLKLNL-STKEGATDPQFKPKEKALLLSDSGAKPPAKA  88

Query  421  QVVGWPPVRNYRKNIMA--QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            QVVGWPPVR++RKN+ A  + +   E + +K+    P +FVKV MDGAPYLRKVDLKMY+
Sbjct  89   QVVGWPPVRSFRKNMFAAQKSNEGSEESEKKNSNNNPISFVKVSMDGAPYLRKVDLKMYK  148

Query  595  SYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNE-RKLMDLLNSSEYVPTYEDKDGDWML  771
            SY +LSDALAKMF+SFT   GN  +QG+ DFMNE  KLMDLLNSS+YVPTYEDKDGDWML
Sbjct  149  SYPELSDALAKMFNSFT--TGNCESQGIKDFMNESNKLMDLLNSSDYVPTYEDKDGDWML  206

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VGDVPWEMF+DSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  207  VGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 168/225 (75%), Gaps = 19/225 (8%)
 Frame = +1

Query  151  MEVGRKMGSMLAEHGGLNLKATElc----lglpgggggNESESL---KVTGKRGFSETVD  309
            MEVGRKM +ML     LN K TELC     G+     GNE+ES    K  GKRGFSETVD
Sbjct  1    MEVGRKMANMLGTDHDLNFKETELCLGLPGGIAVVAAGNETESSSSPKTNGKRGFSETVD  60

Query  310  LKLNLQSAADSSLDLKEKMK-SPSKEPN---KDPIKPPSKAQVVGWPPVRNYRKNIMAQk  477
            LKLNLQS  +S++DL + +  + SKE +   KDP KPP+KAQVVGWPPVR+YRKNIMA +
Sbjct  61   LKLNLQSK-ESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSYRKNIMANQ  119

Query  478  sspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAG  657
             +  E +G           VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTM  G
Sbjct  120  KNSSEESGNSGAA-----LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTM--G  172

Query  658  NYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            NYG QGMIDFMNE KLMDLLNSS+YVP+YEDKDGDWMLVGDVPW+
Sbjct  173  NYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQ  217



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/241 (65%), Positives = 175/241 (73%), Gaps = 15/241 (6%)
 Frame = +1

Query  199  LNLKATElclglpgggggNESESLKVTGKRGFSET--VDLKLNLQSAADSSLDL------  354
            +N + TEL LGLPG G   ES      GKRGFSET  VDLKLNL    DS+         
Sbjct  15   INFEETELRLGLPGAGDHGESPVKNSCGKRGFSETANVDLKLNLSPINDSASSSSTIASV  74

Query  355  -KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIM---AQksspeeaageksgggg  522
             + K K  +      P  P +KAQVVGWPPVR++RKNI+    + +S  E     SGGGG
Sbjct  75   AENKGKDTTTSATVSP-PPRAKAQVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGG  133

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERK  702
              AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+D  N G+Q   DFMNE K
Sbjct  134  NGAFVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTID--NCGSQVTKDFMNESK  191

Query  703  LMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            L+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKN
Sbjct  192  LIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKN  251

Query  883  R  885
            R
Sbjct  252  R  252



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 164/222 (74%), Gaps = 23/222 (10%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSLDLK-EKMKSPSKEPN-----KDPIKPPS-KAQVV  429
            + T KRGFSET+DLKL LQ+     ++ + EKMK  + + N      DP KPP+ KAQVV
Sbjct  30   EATKKRGFSETIDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVV  89

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR++RKNIM+     +   G K  G   A FVKV MDGAPYLRK+DLKMY SYQ+L
Sbjct  90   GWPPVRSFRKNIMS----VQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQEL  145

Query  610  SDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDV  783
            S AL KMFSSFT+  GN  +QG+   DFMNE KLMDL+N SEYVPTYEDKDGDWMLVGDV
Sbjct  146  SVALEKMFSSFTI--GNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDV  203

Query  784  PWE--------MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            PW+        MF+DSCKRLRIMKGSEAIGLAP+A+EKCKN+
Sbjct  204  PWDDLLSIKFRMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNK  245



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 179/243 (74%), Gaps = 16/243 (7%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  348
            MGS+L      + K TEL LGLPG  G N+ +++K   KRGF+ETVDLKL++ + +D   
Sbjct  1    MGSLL------DFKETELRLGLPGWEGRNDGDAVK---KRGFTETVDLKLHIATDSDQGN  51

Query  349  DLKEKMKSPSKEPNKD-PIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksg---g  516
               +K    S   NKD P  PP+K QV+GWPPV++ R+NI+  K +  E   + +     
Sbjct  52   KTIDK-NVVSSFVNKDLPKPPPAKTQVIGWPPVKSLRRNIIGPKKNKLEETKKSAVGDCS  110

Query  517  ggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNE  696
             G  AF+KV M+GAPYLRKVDLKMYESYQQL DAL+KMF SFT   GN GAQ M D+MNE
Sbjct  111  VGAVAFIKVSMEGAPYLRKVDLKMYESYQQLFDALSKMFGSFT--TGNCGAQKMKDYMNE  168

Query  697  RKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKC  876
            RKL D+LN S+YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKGSEAIGLAPRA+EKC
Sbjct  169  RKLKDVLNGSDYVPTYEDKDGDWMLVGDVPWDMFVNSCKRLRIMKGSEAIGLAPRALEKC  228

Query  877  KNR  885
            KNR
Sbjct  229  KNR  231



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16 [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 179/247 (72%), Gaps = 20/247 (8%)
 Frame = +1

Query  169  MGSMLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSL  348
            MGS+L        + TEL LGLPGG G N+ +++K   KRGF+ETVDLKLN+ + ++   
Sbjct  1    MGSLLG------FEETELRLGLPGGDGRNDGDAVK---KRGFTETVDLKLNIVTDSNQGN  51

Query  349  DLKEKMKSPSKEPNKD-PIKPPSKAQVVGWPPVRNYRKNIMA-------Qksspeeaage  504
               +K    S   NKD P  PP+KAQVVGWPPV++ R+NI+        +++        
Sbjct  52   KTTDK-NVVSSFVNKDLPKPPPAKAQVVGWPPVKSLRRNIVGPPKKNKLEETEKNAVISG  110

Query  505  ksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMID  684
                 G AAF+KV MDGAPYLRKVDLKMY SYQ+LSDAL KMF+SFT  AG  GAQ M D
Sbjct  111  GGCSVGAAAFIKVSMDGAPYLRKVDLKMYGSYQELSDALRKMFASFT--AGQCGAQKMRD  168

Query  685  FMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA  864
            +MNERKL+D+ N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA
Sbjct  169  YMNERKLIDVSNGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRA  228

Query  865  VEKCKNR  885
            +EKCKNR
Sbjct  229  LEKCKNR  235



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 157/201 (78%), Gaps = 5/201 (2%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSETVDLKLNL S  +S  D +EK  + S   +       +  QVVGWPPVR++RKN
Sbjct  49   KRGFSETVDLKLNLASK-NSQADEEEKSVAASSSSSPSKPPAKT--QVVGWPPVRSFRKN  105

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            I++ + +    A +   G   AAFVKV +DGAPYLRKVDLK ++SYQ+LS AL+KMFSS 
Sbjct  106  ILSVQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKSYQELSQALSKMFSSS  165

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            T+  G+YG+Q   DFMNERKL+DLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  166  TI--GSYGSQEFKDFMNERKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  223

Query  823  IMKGSEAIGLAPRAVEKCKNR  885
            IMKGSEA+GLAPRAVEKCKNR
Sbjct  224  IMKGSEAVGLAPRAVEKCKNR  244



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 163/222 (73%), Gaps = 19/222 (9%)
 Frame = +1

Query  253  NESESLKVTGKRGFSET------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN--KDP  399
             ESE ++   KRGFSET      VDL LNL   ++A+  S D +   K+  K+     DP
Sbjct  31   TESEGVR---KRGFSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDP  87

Query  400  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
             KPP+K QVVGWPPVR++RKN+ A   + +    E       A+FVKV MDGAPYLRKVD
Sbjct  88   AKPPAKEQVVGWPPVRSFRKNMFA---AQKSMVEESEKNSPNASFVKVSMDGAPYLRKVD  144

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LKMY+SY +LSDAL KMFSSFT+  GN  +QG  DFMNE KLMDLLNSS+ VPTYED+DG
Sbjct  145  LKMYKSYPELSDALGKMFSSFTI--GNCESQGFKDFMNESKLMDLLNSSDCVPTYEDRDG  202

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  203  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 157/204 (77%), Gaps = 11/204 (5%)
 Frame = +1

Query  196  GLNLKATEl-----clglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKE  360
            GLNLK TEL       G  GGGGG+E E+ + +GKRGFSETVDLKLNLQ+  D    L E
Sbjct  7    GLNLKETELCLGLPGGGGGGGGGGSEVETPRASGKRGFSETVDLKLNLQTKED----LNE  62

Query  361  KMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVK  540
            K  S  K   KDP KPP+KAQVVGWPPVR+YRKN+MAQK +  E   + +     AAFVK
Sbjct  63   KSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVK  122

Query  541  VCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLN  720
            V MDGAPYLRKVDL MY++Y+ LSDALAKMFSSFT   GNYGAQGMIDFMNE KLMDLLN
Sbjct  123  VSMDGAPYLRKVDLTMYKTYKDLSDALAKMFSSFT--TGNYGAQGMIDFMNESKLMDLLN  180

Query  721  SSEYVPTYEDKDGDWMLVGDVPWE  792
            SSEYVPTYEDKDGDWMLVGDVPWE
Sbjct  181  SSEYVPTYEDKDGDWMLVGDVPWE  204



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 152/203 (75%), Gaps = 12/203 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYR  456
            KRGFSETVDLKLNL S+ D+S  +K  +K K P       P KPP+K QVVGWPPVR++R
Sbjct  33   KRGFSETVDLKLNL-SSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFR  91

Query  457  KNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  636
            KN++               GG  AAFVKV MDGAPYLRKVDL+MY +Y+ L DAL KMFS
Sbjct  92   KNMLG-VVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMFS  150

Query  637  SFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  816
            SFT+        GM DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR
Sbjct  151  SFTI--------GMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKR  202

Query  817  LRIMKGSEAIGLAPRAVEKCKNR  885
            LRI+KG+EAIGLAPRA+EKCKNR
Sbjct  203  LRIVKGTEAIGLAPRAMEKCKNR  225



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 160/223 (72%), Gaps = 18/223 (8%)
 Frame = +1

Query  259  SESLKVTGKRGFSET--------VDLKLNLQSAADSS-LDLKEKMKSPSKEPN---KDPI  402
            S + +V  KRGFSET        VDL LNL S   ++  D   K  +  KE      DP 
Sbjct  27   SATEEVLRKRGFSETETQDDTATVDLMLNLSSKEPTTGADPTHKHNTLPKEKTLLPADPA  86

Query  403  KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDL  582
            KPP+KAQVVGWPPVR++RKN++A           +      A+FVKV MDGAPYLRKVDL
Sbjct  87   KPPAKAQVVGWPPVRSFRKNMLA--VQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDL  144

Query  583  KMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGD  762
            KMY+SY++LSD+L KMFSSFT+  GN  +QGM DFMNE KLMDLLNSS+YVPTYEDKDGD
Sbjct  145  KMYQSYRELSDSLGKMFSSFTI--GNCESQGMKDFMNESKLMDLLNSSDYVPTYEDKDGD  202

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  885
            WMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ K KNR
Sbjct  203  WMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNR  245



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 165/215 (77%), Gaps = 20/215 (9%)
 Frame = +1

Query  280  GKRGFSETVDLKLNLQSAADSSLD---------LKEK--MKSPSKEPNKDPIKPPSKAQV  426
            GKRGF+ETVDLKL L S     LD          KEK  M SP+     +  +PP+KAQV
Sbjct  40   GKRGFAETVDLKLKLSSKEIGDLDRGGLERKDLCKEKNLMPSPT-----ESARPPAKAQV  94

Query  427  VGWPPVRNYRKNIMA--QksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESY  600
            VGWPPVR++RKN+MA  +KS  E+A    +  GG AAFVKV MDGAPYLRKVDLKMY++Y
Sbjct  95   VGWPPVRSFRKNVMAVQKKSEAEDAEKVAAASGGGAAFVKVSMDGAPYLRKVDLKMYKAY  154

Query  601  QQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGD  780
            Q+L DAL KMFSSFTM   +  ++GM+DFMNE KLMDLLN S+YVPTYEDKDGDWMLVGD
Sbjct  155  QELYDALGKMFSSFTMVKCD--SEGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGD  212

Query  781  VPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VPW MFV+SCKRLRIMKG+EA GLAPRA+EKCK+R
Sbjct  213  VPWGMFVESCKRLRIMKGTEAKGLAPRAMEKCKSR  247



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 153/220 (70%), Gaps = 44/220 (20%)
 Frame = +1

Query  283  KRGFSETV--------DLKLNLQS-----------AADSSLDLKEKMKSPSKEPNKDPIK  405
            KRGF+ETV        DLKLNL S            ADS+   K+K    +     DP K
Sbjct  35   KRGFAETVSSETISKVDLKLNLSSKETVGVGDDDLVADSNPSNKDKAVLTA-----DPAK  89

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+KAQVVGWPPVR++RKN M                    AFVKV MDGAPYLRKVDLK
Sbjct  90   PPAKAQVVGWPPVRSFRKNNM-------------------LAFVKVSMDGAPYLRKVDLK  130

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY+SY+QLSDALA MF SFT   GN G+Q M DFMNE KLMDLL+ S+YVPTYEDKDGDW
Sbjct  131  MYKSYKQLSDALAAMFGSFTT-IGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDW  189

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  190  MLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  229



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 154/212 (73%), Gaps = 20/212 (9%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSSLD--LKEKMKSPSKEPNKDPIKPPSKAQVV  429
            E+ +     KRG+SETVDLKLNL +  +++ +  L  K  + S  P      PP+KAQVV
Sbjct  14   ETTATVAGNKRGYSETVDLKLNLNNEPETNKEGSLVSKENTSSICPKDSTKPPPAKAQVV  73

Query  430  GWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQL  609
            GWPPVR+YRKN+M+  +                 FVKV MDGAPYLRK+DLKMY+SY  L
Sbjct  74   GWPPVRSYRKNVMSATAEAT--------------FVKVSMDGAPYLRKIDLKMYKSYNDL  119

Query  610  SDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  789
            S+AL  MFSSFTM + N G +GMIDFM ERK+MD    SEYVP+YEDKDGDWMLVGDVPW
Sbjct  120  SNALTTMFSSFTM-SNNKGGEGMIDFMKERKIMD---GSEYVPSYEDKDGDWMLVGDVPW  175

Query  790  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EMFV+SCKR+RIMKGSEAIGLAPRA+EKC++R
Sbjct  176  EMFVESCKRIRIMKGSEAIGLAPRAMEKCESR  207



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 158/224 (71%), Gaps = 26/224 (12%)
 Frame = +1

Query  253  NESESLKVTGKRGFSET--VDLKLNLQSAADSSLDL-----------KEKMKSPSKEPNK  393
            N+S       KRGFSET  VDLKLNL S  + S              + K  +    P  
Sbjct  16   NDSALKGSAAKRGFSETASVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPAN  75

Query  394  DPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            DP KPP+KAQVVGWPPVR++RKNI+ + S+ EEA            FVKV MDGAPYLRK
Sbjct  76   DPAKPPAKAQVVGWPPVRSFRKNIVQRNSNEEEAEKSTKNA-----FVKVSMDGAPYLRK  130

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  753
            VD+K+Y+SYQ+LSDALAKMFSSFT++    G+QGM DFMNE       N S+YVPTYEDK
Sbjct  131  VDIKLYKSYQELSDALAKMFSSFTIE--KCGSQGMKDFMNE------TNGSDYVPTYEDK  182

Query  754  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  183  DGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  226



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 160/212 (75%), Gaps = 17/212 (8%)
 Frame = +1

Query  274  VTG-KRGFSETVDLKLNLQSAADSSLDLK--EKMKSPSKEPN---KDPIKPPSKAQVVGW  435
            VTG KRGFSETVDLKLNL +  + +   K  + + S SKE +   KDP KPP+KAQVVGW
Sbjct  27   VTGTKRGFSETVDLKLNLNNEPEINEGSKPHDVVTSVSKEKSSSPKDPAKPPAKAQVVGW  86

Query  436  PPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSD  615
            PPVR+YRKN+M     P       +       FVKV MDGAPYLRKVDLKMY+SY +LS+
Sbjct  87   PPVRSYRKNVMGSYQKPSGGTETAA-------FVKVSMDGAPYLRKVDLKMYKSYDELSN  139

Query  616  ALAKMFSSFTMDAGNYGAQ-GMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            AL+ MFSSFTM  G YG + GMIDFMNER  M L+ + +YVP+YEDKDGDWMLVGDVPW 
Sbjct  140  ALSNMFSSFTM--GKYGGEEGMIDFMNERN-MALVTTWDYVPSYEDKDGDWMLVGDVPWP  196

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R 
Sbjct  197  MFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA  228



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 162/231 (70%), Gaps = 29/231 (13%)
 Frame = +1

Query  274  VTGKRGFSET-----------VDLKLNL-----QSAADSSLDLKEKMKSPSKEPNK----  393
            V  KRGFSET           VDLKLNL     ++ +    D   +    +KE N     
Sbjct  28   VMRKRGFSETESDISTDASTCVDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDF  87

Query  394  ---DPIKPPS-KAQVVGWPPVRNYRKNIMA---QksspeeaageksggggpaaFVKVCMD  552
               DP KPP+ KAQVVGWPPVR++RKN+     + ++  E+     G    A  VKV MD
Sbjct  88   RASDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMD  147

Query  553  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEY  732
            GAPYLRKVDLKMY+SY +LSDALAKMFSSFT+  GN G+QGM DFMNERKLMD+LN S+Y
Sbjct  148  GAPYLRKVDLKMYKSYPELSDALAKMFSSFTI--GNCGSQGMKDFMNERKLMDVLNGSDY  205

Query  733  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            +PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  206  IPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 173/218 (79%), Gaps = 11/218 (5%)
 Frame = +1

Query  259  SESLKVT---GKRGFSET-VDLKLNLQSAADSSL-DL-KEKMKSPSKEPNKDPIKPPSKA  420
            +E+LK T   GKR FS+T VDLKLNL S ++S+  DL KEK  + +  P  DP KPP+KA
Sbjct  27   NETLKTTCSTGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKNITAAAPPANDPAKPPAKA  86

Query  421  QVVGWPPVRNYRKNIMAQkssp---eeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  591
            QVVGWPPVR++RKNI+ + ++    + A    +     AAFVKV MDGAPYLRKVDLK+Y
Sbjct  87   QVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLY  146

Query  592  ESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWML  771
            +SYQ+L DALAKMFSSFT+D    G+QGM DFMNE KL+DLLN S+YVPTYEDKD DWML
Sbjct  147  KSYQELLDALAKMFSSFTID--KCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWML  204

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  205  VGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 162/222 (73%), Gaps = 19/222 (9%)
 Frame = +1

Query  253  NESESLKVTGKRGFSET------VDLKLNL---QSAADSSLDLKEKMKSPSKEPN--KDP  399
             ESE ++   KRGFSET      VDL LNL   ++A+  S D +   K+  K+     DP
Sbjct  31   TESEGVR---KRGFSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDP  87

Query  400  IKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVD  579
             KPP+K QVVGWPPVR++RKN+ A   + +    E       A+FVKV MDGAPYLRKVD
Sbjct  88   AKPPAKEQVVGWPPVRSFRKNMFA---AQKSMVEESEKNSPNASFVKVSMDGAPYLRKVD  144

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LKMY++Y +LSDAL KMFSSFT+  GN  +QG  DFMNE KLMD LNSS+ VPTYED+DG
Sbjct  145  LKMYKNYPELSDALGKMFSSFTI--GNCESQGFKDFMNESKLMDFLNSSDCVPTYEDRDG  202

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  203  DWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 152/216 (70%), Gaps = 36/216 (17%)
 Frame = +1

Query  283  KRGFSETV--------DLKLNLQSAADSSLDLKEKMKSPSKEPNKD-------PIKPPSK  417
            KRGF+ETV        DLKLNL S     +   + + + S   NKD       P KPP+K
Sbjct  35   KRGFAETVSSETISKVDLKLNLSSKETVGVG-GDDVVANSNPSNKDKAVLTADPAKPPAK  93

Query  418  AQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYES  597
            AQVVGWPPVR++RKN M                    AFVKV MDGAPYLRKVDLKMY+S
Sbjct  94   AQVVGWPPVRSFRKNNM-------------------LAFVKVSMDGAPYLRKVDLKMYKS  134

Query  598  YQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVG  777
            Y+QLSDALA MF SFT   GN G+Q M DFMNE KLMDLL+ S+YVPTYEDKDGDWMLVG
Sbjct  135  YKQLSDALAAMFGSFTT-IGNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDWMLVG  193

Query  778  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DVPWEMFV+SCKR+RIMKG EAIGLAPRA+EKCKNR
Sbjct  194  DVPWEMFVESCKRVRIMKGKEAIGLAPRAMEKCKNR  229



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 153/212 (72%), Gaps = 30/212 (14%)
 Frame = +1

Query  271  KVTGKRGFSETVDLKLNLQSAADSSL------DLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            K  GKRGFSETVDLKLNL S A  S+      +LKEK+           +KPP+K QVVG
Sbjct  25   KNNGKRGFSETVDLKLNLSSTALDSVSEVDIQNLKEKV-----------VKPPAKTQVVG  73

Query  433  WPPVRNYRKNIMAQksspeeaag-----------eksggggpaaFVKVCMDGAPYLRKVD  579
            WPPVR++RKN+M+ +    E A              S      A+VKV MDGAPYLRK+D
Sbjct  74   WPPVRSFRKNVMSGQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKID  133

Query  580  LKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDG  759
            LK+Y++YQ LSDAL+KMFSSFT+  GNYG QGM DFMNE KL+DLLN S+YVPTYEDKDG
Sbjct  134  LKLYKTYQDLSDALSKMFSSFTI--GNYGPQGMKDFMNESKLIDLLNGSDYVPTYEDKDG  191

Query  760  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            DWMLVGDVPW+MFVDSCKR+RIMKGSEAIGL 
Sbjct  192  DWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLG  223



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 166/250 (66%), Gaps = 50/250 (20%)
 Frame = +1

Query  280  GKRGFSET------VDLKLNLQSAA---------------------DSSLD---LKEKMK  369
            GKRGF+ET      VDLKLNL ++                      DS ++   +    K
Sbjct  49   GKRGFTETEAEAANVDLKLNLSTSTTKSAASVASVAVAVAATTTVKDSKVEQGGIVVDHK  108

Query  370  SPSKEP--------------NKDPIKP-PSKAQVVGWPPVRNYRKNIMA---Qksspeea  495
            +  KE               + DP KP  +KAQVVGWPPVR +RKNI+A   + S  +  
Sbjct  109  AKDKETVAAAAAAANNNTSTSADPAKPSAAKAQVVGWPPVRAFRKNIVAVQKKSSEEQAD  168

Query  496  ageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQG  675
                +     AAFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+  GN G+QG
Sbjct  169  QKASNNTIASAAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTI--GNCGSQG  226

Query  676  MIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  855
            M DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLA
Sbjct  227  MKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLA  286

Query  856  PRAVEKCKNR  885
            PRAVEKCK+R
Sbjct  287  PRAVEKCKSR  296



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 168/209 (80%), Gaps = 8/209 (4%)
 Frame = +1

Query  277  TGKRGFSET-VDLKLNLQSAADSSL-DL-KEKMKSPSKEPNKDPIKPPSKAQVVGWPPVR  447
            TGKR FS+T VDLKLNL S ++S+  DL KEK  + +  P  DP KPP+KAQVVGWPPVR
Sbjct  36   TGKRVFSDTAVDLKLNLSSTSNSASSDLAKEKNITAAAPPANDPAKPPAKAQVVGWPPVR  95

Query  448  NYRKNIMAQkssp---eeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDA  618
            ++RKNI+ + ++    + A    +     AAFVKV MDGAPYLRKVDLK+Y+SYQ+L DA
Sbjct  96   SFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLYKSYQELLDA  155

Query  619  LAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  798
            LAKMFSSFT+D    G+QGM DFMNE KL+DLLN S+YVPTYEDKD DWMLVGDVPWEMF
Sbjct  156  LAKMFSSFTID--KCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWMLVGDVPWEMF  213

Query  799  VDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            V+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  214  VESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 158/237 (67%), Gaps = 29/237 (12%)
 Frame = +1

Query  256  ESESLKVTGKRGFSET-----------VDLKLNLQSAADSSLDLKEKMKSPSKE------  384
            + + + V  KRGFSET           VDLKLNL S +  +     K  S  K       
Sbjct  24   DGDQVIVMRKRGFSETESDISTDTSTCVDLKLNLSSNSKEANSTGGKDGSAEKSKTNKEK  83

Query  385  ------PNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksgg---ggpaaF  534
                  P  DP KPP+ KAQVVGWPPVR++RKN+     +       +         A  
Sbjct  84   NNNLDFPASDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQNSTNDGESEQMNKGGNNNAVL  143

Query  535  VKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDL  714
            VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+  GN G+QGM DFMNE KLMD+
Sbjct  144  VKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTI--GNCGSQGMKDFMNESKLMDV  201

Query  715  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            LN S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  202  LNGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  258



>ref|XP_009417112.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 156/222 (70%), Gaps = 14/222 (6%)
 Frame = +1

Query  256  ESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPN--------KDPIKP-  408
            E ES K +GKRGF E VDLKL LQ+         E  +   + PN         DP KP 
Sbjct  29   EVESGKNSGKRGFVEIVDLKLQLQTPVGVQEAAAEAAEKVKRSPNDDSIVSCGSDPEKPS  88

Query  409  PSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKM  588
            P KAQVVGWPPVR++RKNI++   S +    E       AA VKV MDGAPYLRKVDLK 
Sbjct  89   PPKAQVVGWPPVRSFRKNILS-VHSEKGRKEEGEKSSSLAALVKVSMDGAPYLRKVDLKT  147

Query  589  YESYQQLSDALAKMFSSFTMDAGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGD  762
            + SYQ+L  AL KMF SFT   G+YG+QGM   DFMNERK+ DLL+ SEYVPTYEDKDGD
Sbjct  148  HRSYQELFVALQKMFDSFT--TGDYGSQGMSGRDFMNERKVKDLLHGSEYVPTYEDKDGD  205

Query  763  WMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  888
            WMLVGDVPWEMFV SCKRL IMKGSEAIGLAPRA+EKCKN+C
Sbjct  206  WMLVGDVPWEMFVASCKRLSIMKGSEAIGLAPRAMEKCKNKC  247



>ref|XP_011648754.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
sativus]
 gb|KGN60808.1| hypothetical protein Csa_2G010920 [Cucumis sativus]
Length=237

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 156/203 (77%), Gaps = 11/203 (5%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            KRGF ETVDLKLNL S+  S+ +     E++K+ S++PN D  KPPSKAQVVGWPPVR+ 
Sbjct  40   KRGFMETVDLKLNLASSMASTKEEATNLEEIKTSSQQPN-DFAKPPSKAQVVGWPPVRSS  98

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN+         +      GG   +FVKV MDGAPYLRKVDLK+Y SY++LS ALA+MF
Sbjct  99   RKNL-----GVVSSRKGGDEGGAGGSFVKVSMDGAPYLRKVDLKLYASYKELSHALAQMF  153

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFT+  G   ++GM DFMNE K +DLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCK
Sbjct  154  SSFTI--GKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  211

Query  814  RLRIMKGSEAIGLAPRAVEKCKN  882
            RLRIMK S+AIGLAPR++EK KN
Sbjct  212  RLRIMKESDAIGLAPRSMEKQKN  234



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 162/230 (70%), Gaps = 29/230 (13%)
 Frame = +1

Query  274  VTGKRGFSET-----------VDLKLNLQSAA---------DSSLDLKEKMKSPSKE---  384
            V  KRGFSET           VDLKLNL +++         D S D  +  K  +     
Sbjct  28   VMRKRGFSETESKISTDTSTCVDLKLNLSNSSKAANSTGGKDGSADKSKTDKEKNNHLDL  87

Query  385  PNKDPIKPPS-KAQVVGWPPVRNYRKNIMA---QksspeeaageksggggpaaFVKVCMD  552
            P  DP KPP+ KAQVVGWPPVR++RKN+     + S+  E+     GG   A  VKV MD
Sbjct  88   PASDPAKPPAAKAQVVGWPPVRSFRKNMFTAVQKSSNDGESEQMNKGGNNNAVLVKVSMD  147

Query  553  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEY  732
            GAPYLRKVDLKMY+SY +LSDALAKMFSSFT+  GN G+QGM DFMNE KLMD+LN S+Y
Sbjct  148  GAPYLRKVDLKMYKSYPELSDALAKMFSSFTI--GNCGSQGMKDFMNESKLMDVLNGSDY  205

Query  733  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  882
            +PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKN
Sbjct  206  IPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKN  255



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 136/164 (83%), Gaps = 4/164 (2%)
 Frame = +1

Query  394  DPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            DP KPP+KAQVVGWPPVR+YRKN++A + S  E     +       FVKV MDGAPYLRK
Sbjct  90   DPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAIT--FVKVSMDGAPYLRK  147

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  753
            VDLKMY SY QLSD+L KMFSSFT+  GN  +QGM DFMNE KLMDLLN+S+YVPTYEDK
Sbjct  148  VDLKMYTSYSQLSDSLGKMFSSFTI--GNCESQGMKDFMNESKLMDLLNNSDYVPTYEDK  205

Query  754  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  206  DGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  249



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 163/231 (71%), Gaps = 29/231 (13%)
 Frame = +1

Query  274  VTGKRGFSET-----------VDLKLNLQSAAD--SSLDLKEKMKSPSKE----------  384
            V  KRGFSET           VDLKLNL +++   +S   K+ +   SK           
Sbjct  28   VMRKRGFSETESKISTDTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHLDL  87

Query  385  PNKDPIKPPS-KAQVVGWPPVRNYRKNIMA---QksspeeaageksggggpaaFVKVCMD  552
            P  DP KPP+ KAQVVGWPPVR++RKN+     + S+  E+     GG   A  VKV MD
Sbjct  88   PASDPAKPPAAKAQVVGWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMD  147

Query  553  GAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEY  732
            GAPYLRKVDLKMY+SY +LSDALAKMFSSFT+  GN G+QGM DFMNE KLMD+LN S+Y
Sbjct  148  GAPYLRKVDLKMYKSYPELSDALAKMFSSFTI--GNCGSQGMKDFMNESKLMDVLNGSDY  205

Query  733  VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
             PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  206  TPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            ++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFSSF  155

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            T+  GN G+ GM DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  156  TI--GNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  823  IMKGSEAIGLA  855
            IMKG+EA GL 
Sbjct  214  IMKGTEATGLG  224



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score =   243 bits (620),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 133/164 (81%), Gaps = 9/164 (5%)
 Frame = +1

Query  415  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaa------FVKVCMDGAPYLRKV  576
            +AQVVGWPPVRNYRKNI+ Q+ +  +        G           VKV MDGAPYLRKV
Sbjct  12   RAQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKV  71

Query  577  DLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKD  756
            DLKMY+SY+  SDALAKMFSSFTM  G YGAQGMIDFMNE KLMDLLNSSEYVP+YEDKD
Sbjct  72   DLKMYKSYKDFSDALAKMFSSFTM--GKYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKD  129

Query  757  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  885
            GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  130  GDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNR  173



>ref|XP_010522504.1| PREDICTED: auxin-responsive protein IAA17-like [Tarenaya hassleriana]
Length=235

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 170/245 (69%), Gaps = 20/245 (8%)
 Frame = +1

Query  178  MLAEHGGLNLKATElclglpgggggNESESLKVTGKRGFSETVDLKLNLQSAADSSLDLK  357
            ML     LN+K TELCLGLPG     E+ +     KRGFSETVDLKLNL +     +   
Sbjct  1    MLGGGVDLNMKETELCLGLPG----GETAAPVAGNKRGFSETVDLKLNLNNEPHKDVGSA  56

Query  358  EKMKSPSK---EPNKDPI--KPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksgggg  522
               + PS     PN      KPP+KAQVVGWPPVR YRKN+M + SS  E A   +    
Sbjct  57   LSEQDPSSLVSVPNDSSSCPKPPAKAQVVGWPPVRTYRKNMMGRTSSEGEKATANA----  112

Query  523  paaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFT----MDAGNYGAQGMIDFM  690
               FVKV +DGAPYLRKVDLK Y SY  LS AL+ MFSSFT       G  G +GMIDFM
Sbjct  113  ---FVKVSIDGAPYLRKVDLKTYSSYDDLSTALSTMFSSFTNTGNYGGGGGGGEGMIDFM  169

Query  691  NERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVE  870
            +ERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+E
Sbjct  170  SERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAME  229

Query  871  KCKNR  885
            KCKNR
Sbjct  230  KCKNR  234



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 157/222 (71%), Gaps = 25/222 (11%)
 Frame = +1

Query  283  KRGFSET-----------VDLKLNLQS-----AADSSLDLKEKMKSPSKEPN---KDPIK  405
            KRGFSET           VDL LNL S      A ++ D  +K K+  KE      DP K
Sbjct  25   KRGFSETETGHEDESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAK  84

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+K QVVGWPPVR++RKN++A           +      A+FVKV MDGAPYLRKVDLK
Sbjct  85   PPAKTQVVGWPPVRSFRKNMLA--VQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLK  142

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY+SY++LSD+L KMFSSFT   GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDGDW
Sbjct  143  MYKSYRELSDSLGKMFSSFTF--GNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDW  200

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  201  MLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  242



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 157/222 (71%), Gaps = 25/222 (11%)
 Frame = +1

Query  283  KRGFSET-----------VDLKLNLQS-----AADSSLDLKEKMKSPSKEPN---KDPIK  405
            KRGFSET           VDL LNL S      A ++ D  +K K+  KE      DP K
Sbjct  34   KRGFSETETGHEDESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAK  93

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+K QVVGWPPVR++RKN++A           +      A+FVKV MDGAPYLRKVDLK
Sbjct  94   PPAKTQVVGWPPVRSFRKNMLA--VQKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLK  151

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY+SY++LSD+L KMFSSFT   GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDGDW
Sbjct  152  MYKSYRELSDSLGKMFSSFTF--GNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDW  209

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  210  MLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  251



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +1

Query  352  LKEKMKSPSKEPNKDPIKPPS-KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpa  528
            +KEK  +P    N DP KPP+ KAQVVGWPPVR++RKNI+        +   ++     A
Sbjct  1    MKEKNVAPVPRSN-DPTKPPAAKAQVVGWPPVRSFRKNILT--VQKNSSEEGENTNSISA  57

Query  529  aFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLM  708
            AFVKV MDGAPYLRKVDLK+Y+SYQ+LS AL+KMFSSFT+  GN G+QGM DFMNE KL+
Sbjct  58   AFVKVSMDGAPYLRKVDLKLYKSYQELSTALSKMFSSFTI--GNCGSQGMKDFMNESKLI  115

Query  709  DLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DLL+ SEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  116  DLLSGSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNR  174



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 151/211 (72%), Gaps = 31/211 (15%)
 Frame = +1

Query  253  NESESLKVTGKRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVG  432
            +++++  V GKRGF   VDLKLNL S      D+     S  K P         K Q+VG
Sbjct  33   DDNDTYNVNGKRGF---VDLKLNLSS------DINNIKNSTLKAP-------AVKTQIVG  76

Query  433  WPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLS  612
            WPPVR++RKNI+  +   +E+             VKV MDGAPYLRKVDL MY+SYQ+LS
Sbjct  77   WPPVRSFRKNILTSQKLGQESDNI---------LVKVSMDGAPYLRKVDLNMYKSYQELS  127

Query  613  DALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  792
            DALAKMF+SFT+       QGM DFMNERKLMDLLNSS+YVPTYEDKDGDWMLVGDVPW 
Sbjct  128  DALAKMFNSFTI------VQGMKDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWG  181

Query  793  MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MFVDSCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  182  MFVDSCKRLRIMKGTEAIGLAPRAMEKCKNR  212



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = +1

Query  370  SPSKEPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCM  549
            S S + N+    P  KAQVVGWPPVR++RKN++      +++ G      G AAFVKV +
Sbjct  53   SSSGKENEQDSAPAPKAQVVGWPPVRSFRKNVLT---VQKKSTGNGESSSGGAAFVKVSV  109

Query  550  DGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSE  729
            DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+  GN G  G  DFMNE KL+DLLN S+
Sbjct  110  DGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTI--GNCGNHGFKDFMNESKLIDLLNGSD  167

Query  730  YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  168  YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  219



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +1

Query  394  DPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRK  573
            DP KPP+KAQVVGWPPVR+YRKN++A + S  E     +       FVKV MDGAPYLRK
Sbjct  90   DPAKPPAKAQVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAIT--FVKVSMDGAPYLRK  147

Query  574  VDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDK  753
            VDLKMY SY QLSD+L KMFSSFT+  GN  +QGM DFMNE KLMDLLN+S+YVPTYEDK
Sbjct  148  VDLKMYTSYSQLSDSLGKMFSSFTI--GNCESQGMKDFMNESKLMDLLNNSDYVPTYEDK  205

Query  754  DGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            DGDWMLVGDVPW MFV+SCKRLRIMKG EAIG+APRA+EKCKNR
Sbjct  206  DGDWMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNR  249



>ref|XP_008455985.1| PREDICTED: auxin-responsive protein IAA16 isoform X1 [Cucumis 
melo]
Length=236

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 153/203 (75%), Gaps = 13/203 (6%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLK---EKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNY  453
            KRGF ETVDLKLNL S+  S+ +     E++KS S++PN D  KPPSK QVVGWPPVR+ 
Sbjct  41   KRGFMETVDLKLNLASSMASAKEEGTNLEEIKSCSQQPN-DFAKPPSKTQVVGWPPVRSS  99

Query  454  RKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  633
            RKN+    S      G  S       FVKV MDGAPYLRKVDLK+Y SY+ LS ALAKMF
Sbjct  100  RKNLGVSSSRKGGDEGGGS-------FVKVSMDGAPYLRKVDLKLYGSYKDLSHALAKMF  152

Query  634  SSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  813
            SSFT+  G   ++GM DFMNE K +DLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCK
Sbjct  153  SSFTI--GKCESEGMKDFMNESKSVDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCK  210

Query  814  RLRIMKGSEAIGLAPRAVEKCKN  882
            RLRIMK S+AIGLAPR++EK KN
Sbjct  211  RLRIMKESDAIGLAPRSMEKQKN  233



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 170/218 (78%), Gaps = 11/218 (5%)
 Frame = +1

Query  259  SESLKVT---GKRGFSET-VDLKLNLQSAADSSL-DL-KEKMKSPSKEPNKDPIKPPSKA  420
            +E+LK T   GKR FS+T VDLKLNL S ++S+  DL KEK  + +  P  DP KPP+KA
Sbjct  27   NETLKTTCSTGKRVFSDTAVDLKLNLSSTSNSASSDLTKEKNITAAAPPANDPAKPPAKA  86

Query  421  QVVGWPPVRNYRKNIMAQkssp---eeaageksggggpaaFVKVCMDGAPYLRKVDLKMY  591
            QVVGWPPVR++RKNI+ + ++    + A    +     AAFVKV MDGAPYLRKVDLK+Y
Sbjct  87   QVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLY  146

Query  592  ESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWML  771
            +SYQ+L DALAKMFSSFT+D    G+QGM DFMNE KL+D  N S+YVPTYEDKD DWML
Sbjct  147  KSYQELLDALAKMFSSFTID--KCGSQGMKDFMNESKLIDFFNGSDYVPTYEDKDADWML  204

Query  772  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            VGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  205  VGDVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNR  242



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  283  KRGFSETVDLKLNLQSAADSSLDLKEKMKSPSKEPNKDPIKPPSKAQVVGWPPVRNYRKN  462
            KRGFSETVDLKLNL S         EK +        DP KPP+KAQVVGWPPVR++RKN
Sbjct  36   KRGFSETVDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  463  IMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSF  642
            ++A + S  +        GG A FVKV MDGAPYLRKVDL MY++Y +LSDAL KMFSSF
Sbjct  96   MLAVQKSSTDQESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFSSF  155

Query  643  TMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  822
            T+  GN G+ GM DF+NE KL+DLLN ++YVP+YEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  156  TI--GNCGSHGMKDFLNESKLIDLLNGTDYVPSYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  823  IMKGSEAIGLA  855
            IMKG+EA GL 
Sbjct  214  IMKGTEATGLG  224



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 157/222 (71%), Gaps = 25/222 (11%)
 Frame = +1

Query  283  KRGFSET-----------VDLKLNLQS-----AADSSLDLKEKMKSPSKEPN---KDPIK  405
            KRGFSET           VDL LNL S     AA ++ D  +K K+  KE      DP K
Sbjct  34   KRGFSETETGHEDESATTVDLMLNLSSKEAATAAAAAADPTDKHKTLPKEKTLLPADPAK  93

Query  406  PPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLK  585
            PP+K QVVGWPPVR++RKN++A           +      A+FVKV MDG PYLRKVDLK
Sbjct  94   PPAKTQVVGWPPVRSFRKNMLA--VQKSVGEESEKNSSPNASFVKVSMDGTPYLRKVDLK  151

Query  586  MYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDW  765
            MY+SY++LSD+L KMFSSFT   GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDGDW
Sbjct  152  MYKSYRELSDSLGKMFSSFTF--GNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDW  209

Query  766  MLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  885
            MLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR
Sbjct  210  MLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNR  251



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 164/240 (68%), Gaps = 53/240 (22%)
 Frame = +1

Query  277  TGKRGFSETVDLKLNLQSAADSSLDLKE--------------------------KMK-SP  375
            +GKRGF+ET+DLKL L+ A + +   ++                          KMK SP
Sbjct  28   SGKRGFAETIDLKLKLEPAGEEAPAAEDRSDVAVVAAAAAEEEHEKAAADACVGKMKRSP  87

Query  376  SK----------EPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggp  525
            S+          +P + P  P  KAQVVGWPPVR++RKNI+A+KSSP  AA         
Sbjct  88   SQSSVVTTAALPDPAEKPRAP--KAQVVGWPPVRSFRKNILAEKSSPAAAA---------  136

Query  526  aaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKL  705
              FVKV MDGAPYLRKVDL MY++YQ LS AL KMFSSFT+  GN G QGM + MNE KL
Sbjct  137  --FVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMFSSFTI--GNCGTQGM-NGMNESKL  191

Query  706  MDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MDLLN SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  MDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 164/240 (68%), Gaps = 53/240 (22%)
 Frame = +1

Query  277  TGKRGFSETVDLKLNLQSAADSSLDLKE--------------------------KMK-SP  375
            +GKRGF+ET+DLKL L+ A + +   ++                          KMK SP
Sbjct  28   SGKRGFAETIDLKLKLEPAGEEAPAAEDRSDVAVVAAAAAEEEHEKAAADACVGKMKRSP  87

Query  376  SK----------EPNKDPIKPPSKAQVVGWPPVRNYRKNIMAQksspeeaageksggggp  525
            S+          +P + P  P  KAQVVGWPPVR++RKNI+A+KSSP  AA         
Sbjct  88   SQSSVVTTAALPDPAEKPRAP--KAQVVGWPPVRSFRKNILAEKSSPAAAA---------  136

Query  526  aaFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKL  705
              FVKV MDGAPYLRKVDL MY++YQ LS AL KMFSSFT+  GN G QGM + MNE KL
Sbjct  137  --FVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMFSSFTI--GNCGTQGM-NGMNESKL  191

Query  706  MDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            MDLLN SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  MDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>ref|XP_003521268.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
 gb|KHN10705.1| Auxin-induced protein AUX28 [Glycine soja]
Length=254

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 160/219 (73%), Gaps = 21/219 (10%)
 Frame = +1

Query  283  KRGFSET------------VDLKLNLQS-AADSSLDLKEKMKSPSKEPN---KDPIKPPS  414
            KRGFSET            VDL LNL S  A ++ D  +K K+  KE      DP KPP+
Sbjct  38   KRGFSETETETEEDESATTVDLMLNLSSKEAAAAADPTDKHKTLPKEKTLLPADPAKPPA  97

Query  415  KAQVVGWPPVRNYRKNIMAQksspeeaageksggggpaaFVKVCMDGAPYLRKVDLKMYE  594
            KAQVVGWPPVR++RKN++A          EK+     A+FVKV MDGAPYLRKVDLKMY+
Sbjct  98   KAQVVGWPPVRSFRKNMLA-VQKSVGEENEKNSSSPNASFVKVSMDGAPYLRKVDLKMYK  156

Query  595  SYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLV  774
            SY++LSD+L KMFSSFT+  GN  +QGM DFMNE KL DLLNSS+YVPTYEDKDGDWMLV
Sbjct  157  SYRELSDSLGKMFSSFTI--GNCESQGMKDFMNESKLNDLLNSSDYVPTYEDKDGDWMLV  214

Query  775  GDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNR  885
            GDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ K KNR
Sbjct  215  GDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNR  253



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 163/233 (70%), Gaps = 32/233 (14%)
 Frame = +1

Query  274  VTGKRGFSETVDLKLNLQSAADSSLDLKE-------------KMK-SPSKE------PNK  393
             +GKRGF+ET+DLKL L+ AA + +   E             KMK SPS+          
Sbjct  34   ASGKRGFAETIDLKLKLEPAAAAVVAEDEEVDAAAEESSPAGKMKRSPSQSSVVTAAAQP  93

Query  394  DPIKPPS--KAQVVGWPPVRNYRKNIM-------AQksspeeaageksggggpaaFVKVC  546
            DP + P   KAQVVGWPPVR++RKNIM       A      +         G AAFVKV 
Sbjct  94   DPAEKPRAPKAQVVGWPPVRSFRKNIMSVQSEKGAGSKDATDGDKSSPAASGGAAFVKVS  153

Query  547  MDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMDAGNYGAQGMIDFMNERKLMDLLNSS  726
            +DGAPYLRKVDLKMY+SYQ+LS AL KMFSSFT+  G+ G+QGM + MNE KL+DLLN S
Sbjct  154  LDGAPYLRKVDLKMYKSYQELSKALEKMFSSFTI--GSCGSQGM-NGMNESKLVDLLNGS  210

Query  727  EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  885
            EYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  211  EYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3646169840416