BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6467

Length=958
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769918.1|  PREDICTED: uncharacterized protein LOC104220702    261   6e-78   Nicotiana sylvestris
ref|XP_006352713.1|  PREDICTED: uncharacterized protein LOC102605986    259   5e-77   Solanum tuberosum [potatoes]
ref|XP_009601758.1|  PREDICTED: uncharacterized protein LOC104096985    257   2e-76   Nicotiana tomentosiformis
ref|XP_004242382.1|  PREDICTED: ribonuclease inhibitor                  253   5e-75   Solanum lycopersicum
ref|XP_012085177.1|  PREDICTED: protein NLRC3                           248   4e-73   Jatropha curcas
ref|XP_008235539.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    231   9e-67   Prunus mume [ume]
gb|KDO65820.1|  hypothetical protein CISIN_1g0074791mg                  224   3e-66   Citrus sinensis [apfelsine]
ref|XP_007201725.1|  hypothetical protein PRUPE_ppa003067mg             229   5e-66   Prunus persica
ref|XP_010652448.1|  PREDICTED: protein NLRC3 isoform X1                227   4e-65   Vitis vinifera
ref|XP_010243650.1|  PREDICTED: uncharacterized protein LOC104587...    227   4e-65   
ref|XP_010243649.1|  PREDICTED: uncharacterized protein LOC104587...    227   5e-65   
ref|XP_010243648.1|  PREDICTED: uncharacterized protein LOC104587...    227   5e-65   
ref|XP_008382798.1|  PREDICTED: protein NLRC3                           221   5e-65   
ref|XP_007050066.1|  RNI-like superfamily protein, putative             226   1e-64   
ref|XP_006443678.1|  hypothetical protein CICLE_v10019392mg             224   1e-64   
ref|XP_011083100.1|  PREDICTED: uncharacterized protein LOC105165...    225   2e-64   Sesamum indicum [beniseed]
ref|XP_006480171.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    224   3e-64   Citrus sinensis [apfelsine]
ref|XP_006443679.1|  hypothetical protein CICLE_v10019392mg             224   3e-64   Citrus clementina [clementine]
ref|XP_011083098.1|  PREDICTED: uncharacterized protein LOC105165...    225   3e-64   Sesamum indicum [beniseed]
ref|XP_006480172.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    224   3e-64   
gb|KJB42368.1|  hypothetical protein B456_007G151600                    220   9e-63   Gossypium raimondii
gb|KJB42369.1|  hypothetical protein B456_007G151600                    220   2e-62   Gossypium raimondii
ref|XP_002521155.1|  protein binding protein, putative                  218   1e-61   
ref|XP_004290025.1|  PREDICTED: protein NLRC5 isoform X1                216   3e-61   Fragaria vesca subsp. vesca
ref|XP_010091857.1|  Ribonuclease inhibitor                             213   6e-60   
gb|KGN44555.1|  hypothetical protein Csa_7G330390                       207   2e-58   Cucumis sativus [cucumbers]
ref|XP_004139728.1|  PREDICTED: protein NLRC3 isoform X1                207   1e-57   Cucumis sativus [cucumbers]
ref|XP_010069680.1|  PREDICTED: uncharacterized protein LOC104456...    205   4e-57   Eucalyptus grandis [rose gum]
ref|XP_008461989.1|  PREDICTED: protein NLRC3 isoform X1                202   5e-56   Cucumis melo [Oriental melon]
ref|XP_006604527.1|  PREDICTED: protein NLRC3-like                      202   1e-55   Glycine max [soybeans]
ref|XP_004493854.1|  PREDICTED: uncharacterized protein LOC101511205    201   1e-55   Cicer arietinum [garbanzo]
ref|XP_007162646.1|  hypothetical protein PHAVU_001G168300g             196   9e-54   Phaseolus vulgaris [French bean]
ref|XP_003520623.1|  PREDICTED: protein NLRC3-like                      196   1e-53   Glycine max [soybeans]
gb|KHN09410.1|  Protein NLRC5                                           196   1e-53   Glycine soja [wild soybean]
ref|XP_010540942.1|  PREDICTED: protein NLRC3 isoform X1                196   1e-53   Tarenaya hassleriana [spider flower]
gb|AAD21766.1|  hypothetical protein                                    185   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014860.1|  PREDICTED: uncharacterized protein LOC105118...    192   2e-52   Populus euphratica
ref|XP_011014859.1|  PREDICTED: uncharacterized protein LOC105118...    192   2e-52   Populus euphratica
emb|CDY65850.1|  BnaCnng48880D                                          192   2e-52   Brassica napus [oilseed rape]
ref|XP_011014863.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    192   3e-52   Populus euphratica
ref|XP_011014861.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    192   3e-52   Populus euphratica
ref|XP_011014862.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    192   3e-52   Populus euphratica
ref|XP_010684911.1|  PREDICTED: uncharacterized protein LOC104899423    192   5e-52   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI37239.3|  unnamed protein product                                191   7e-52   Vitis vinifera
ref|XP_010652449.1|  PREDICTED: protein NLRC3 isoform X2                191   8e-52   
ref|XP_010416125.1|  PREDICTED: uncharacterized protein LOC104702...    188   1e-50   
ref|XP_010416119.1|  PREDICTED: uncharacterized protein LOC104702...    188   1e-50   
ref|XP_010416111.1|  PREDICTED: uncharacterized protein LOC104702...    188   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010495912.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    186   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010495911.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    186   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010495909.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    186   5e-50   Camelina sativa [gold-of-pleasure]
tpg|DAA54822.1|  TPA: hypothetical protein ZEAMMB73_341952              178   5e-50   
dbj|BAF00875.1|  hypothetical protein                                   185   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489083.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    184   6e-50   
ref|XP_010495908.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    186   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008789483.1|  PREDICTED: uncharacterized protein LOC103706...    184   8e-50   
ref|XP_011458062.1|  PREDICTED: protein NLRC5 isoform X2                185   9e-50   Fragaria vesca subsp. vesca
ref|XP_010489082.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    185   1e-49   
ref|NP_179611.2|  RNI-like superfamily protein                          185   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489080.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    185   1e-49   
ref|XP_008789482.1|  PREDICTED: uncharacterized protein LOC103706...    184   2e-49   
ref|XP_009102053.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    184   3e-49   Brassica rapa
emb|CDY31987.1|  BnaA07g00080D                                          184   4e-49   Brassica napus [oilseed rape]
ref|XP_008789480.1|  PREDICTED: uncharacterized protein LOC103706...    184   4e-49   Phoenix dactylifera
ref|XP_002321304.2|  hypothetical protein POPTR_0014s18520g             183   7e-49   
ref|XP_002443071.1|  hypothetical protein SORBIDRAFT_08g007590          182   1e-48   
ref|XP_010940684.1|  PREDICTED: uncharacterized protein LOC105059...    182   2e-48   Elaeis guineensis
ref|XP_010940682.1|  PREDICTED: uncharacterized protein LOC105059...    182   2e-48   
ref|XP_002443070.1|  hypothetical protein SORBIDRAFT_08g007580          181   2e-48   
ref|XP_010940683.1|  PREDICTED: uncharacterized protein LOC105059...    182   3e-48   Elaeis guineensis
ref|XP_006408937.1|  hypothetical protein EUTSA_v10001935mg             181   4e-48   Eutrema salsugineum [saltwater cress]
ref|XP_006300089.1|  hypothetical protein CARUB_v10016317mg             179   2e-47   Capsella rubella
ref|NP_001066441.1|  Os12g0228900                                       172   3e-47   
ref|XP_002883938.1|  leucine-rich repeat family protein                 178   4e-47   
ref|XP_008674147.1|  PREDICTED: uncharacterized protein LOC103650329    177   8e-47   Zea mays [maize]
gb|KEH23987.1|  LRR ribonuclease inhibitor domain protein               176   4e-46   Medicago truncatula
gb|AES81685.2|  LRR ribonuclease inhibitor domain protein               174   1e-45   Medicago truncatula
ref|XP_003625467.1|  hypothetical protein MTR_7g099450                  174   1e-45   
ref|XP_006664439.1|  PREDICTED: protein NLRC3-like                      173   2e-45   
gb|KFK40400.1|  hypothetical protein AALP_AA3G368500                    172   5e-45   Arabis alpina [alpine rockcress]
ref|XP_004960752.1|  PREDICTED: uncharacterized protein LOC101762404    172   8e-45   Setaria italica
gb|ABA96837.1|  Leucine Rich Repeat family protein, expressed           172   8e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69043.1|  hypothetical protein OsI_37874                          171   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_009405714.1|  PREDICTED: protein NLRC3 isoform X1                170   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003576947.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    166   7e-43   
emb|CDP21849.1|  unnamed protein product                                155   2e-42   Coffea canephora [robusta coffee]
ref|XP_010540943.1|  PREDICTED: protein NLRC3 isoform X2                164   3e-42   Tarenaya hassleriana [spider flower]
gb|ERN15812.1|  hypothetical protein AMTR_s00039p00144340               160   1e-40   Amborella trichopoda
ref|XP_011627038.1|  PREDICTED: uncharacterized protein LOC18444105     159   3e-40   
gb|EMT06714.1|  Protein NLRC3                                           155   6e-39   
gb|EMS58433.1|  Protein NLRC3                                           151   9e-38   Triticum urartu
gb|KDO65821.1|  hypothetical protein CISIN_1g0074791mg                  139   5e-35   Citrus sinensis [apfelsine]
ref|XP_006480175.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    140   4e-34   
ref|XP_007151779.1|  hypothetical protein PHAVU_004G074200g             127   1e-31   Phaseolus vulgaris [French bean]
ref|XP_011659160.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    128   7e-30   Cucumis sativus [cucumbers]
ref|XP_010652450.1|  PREDICTED: uncharacterized protein LOC100261...    128   8e-30   
ref|XP_008461991.1|  PREDICTED: leucine-rich repeat-containing pr...    127   2e-29   Cucumis melo [Oriental melon]
gb|KJB42372.1|  hypothetical protein B456_007G151600                    122   8e-28   Gossypium raimondii
ref|XP_008652837.1|  PREDICTED: uncharacterized protein LOC103632898    112   2e-26   
gb|EYU17964.1|  hypothetical protein MIMGU_mgv1a0245892mg               115   7e-26   Erythranthe guttata [common monkey flower]
tpg|DAA54821.1|  TPA: hypothetical protein ZEAMMB73_341952              109   4e-25   
ref|XP_008673554.1|  PREDICTED: uncharacterized protein LOC103649591    105   1e-23   
ref|XP_008664178.1|  PREDICTED: uncharacterized protein LOC103642767    106   2e-23   
gb|EYU17965.1|  hypothetical protein MIMGU_mgv1a0245891mg             98.6    8e-22   Erythranthe guttata [common monkey flower]
ref|XP_011659161.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    100   2e-20   Cucumis sativus [cucumbers]
ref|XP_008664260.1|  PREDICTED: uncharacterized protein LOC103642868  94.0    6e-20   
ref|XP_008461992.1|  PREDICTED: uncharacterized protein LOC103500...  99.4    7e-20   Cucumis melo [Oriental melon]
emb|CDP20991.1|  unnamed protein product                              98.6    2e-19   Coffea canephora [robusta coffee]
ref|XP_008461993.1|  PREDICTED: uncharacterized protein LOC103500...  97.8    2e-19   
ref|XP_008461994.1|  PREDICTED: uncharacterized protein LOC103500...  94.4    4e-18   
ref|XP_001751929.1|  predicted protein                                91.3    8e-18   
gb|KDO65823.1|  hypothetical protein CISIN_1g0074791mg                89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_009405738.1|  PREDICTED: protein NLRC3 isoform X2              92.0    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002964411.1|  hypothetical protein SELMODRAFT_405633           91.3    7e-17   
ref|XP_008661204.1|  PREDICTED: uncharacterized protein LOC103640392  82.4    1e-15   
gb|KJB42371.1|  hypothetical protein B456_007G151600                  85.1    3e-15   Gossypium raimondii
gb|KJB42370.1|  hypothetical protein B456_007G151600                  84.7    6e-15   Gossypium raimondii
ref|XP_010069681.1|  PREDICTED: uncharacterized protein LOC104456...  84.0    1e-14   
gb|AFW59093.1|  hypothetical protein ZEAMMB73_800081                  82.8    5e-14   
tpg|DAA52872.1|  TPA: putative RNA helicase family protein            80.5    3e-13   
tpg|DAA52871.1|  TPA: putative RNA helicase family protein            79.7    3e-13   
tpg|DAA52873.1|  TPA: putative RNA helicase family protein            80.1    4e-13   
gb|AFW59095.1|  hypothetical protein ZEAMMB73_800081                  70.5    4e-10   
emb|CCW67258.1|  unnamed protein product                              63.9    8e-08   Phytomonas sp. isolate Hart1
ref|XP_010887134.1|  PREDICTED: protein NLRC3 isoform X2              63.9    9e-08   
ref|XP_010887131.1|  PREDICTED: protein NLRC3 isoform X1              63.5    1e-07   
gb|EPS66692.1|  hypothetical protein M569_08084                       60.8    3e-07   Genlisea aurea
gb|KFH74161.1|  hypothetical protein MVEG_01374                       59.3    2e-06   Mortierella verticillata NRRL 6337
ref|WP_010302754.1|  hypothetical protein                             58.5    2e-06   Candidatus Odyssella thessalonicensis
ref|XP_004346272.1|  hypothetical protein CAOG_05599                  57.8    6e-06   Capsaspora owczarzaki ATCC 30864
emb|CCW59765.1|  unnamed protein product                              57.8    8e-06   Phytomonas sp. isolate EM1
ref|XP_005535850.1|  probable Ran GTPase activating protein           56.6    2e-05   Cyanidioschyzon merolae strain 10D
ref|XP_006782761.1|  PREDICTED: leucine-rich repeat-containing pr...  56.6    2e-05   Neolamprologus brichardi [lyretail cichlid]
emb|CDQ58729.1|  unnamed protein product                              56.2    3e-05   Oncorhynchus mykiss
gb|KFH62941.1|  hypothetical protein MVEG_10979                       55.5    4e-05   Mortierella verticillata NRRL 6337
ref|XP_004556391.1|  PREDICTED: leucine-rich repeat-containing pr...  55.5    4e-05   
ref|WP_032112569.1|  hypothetical protein                             54.3    1e-04   Candidatus Paracaedibacter symbiosus
ref|XP_005454339.1|  PREDICTED: leucine-rich repeat-containing pr...  53.9    1e-04   
gb|KFH65222.1|  hypothetical protein MVEG_08703                       53.5    2e-04   Mortierella verticillata NRRL 6337
ref|WP_044881576.1|  hypothetical protein                             52.4    3e-04   
ref|XP_009311228.1|  putative leucine-richprotein                     51.6    5e-04   Trypanosoma grayi
ref|XP_006117873.1|  PREDICTED: uncharacterized protein C14orf166...  51.2    7e-04   
ref|XP_008659073.1|  PREDICTED: protein NLRC3 isoform X2              50.8    0.001   
gb|KFH66485.1|  hypothetical protein MVEG_07010                       51.2    0.001   Mortierella verticillata NRRL 6337
gb|AFW85195.1|  hypothetical protein ZEAMMB73_319583                  51.2    0.001   
gb|KFH68944.1|  hypothetical protein MVEG_05746                       51.2    0.001   Mortierella verticillata NRRL 6337



>ref|XP_009769918.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
 ref|XP_009769919.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
 ref|XP_009769920.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
Length=626

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 173/243 (71%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            RN   Q+DDVDC RY  +++PN E LDLSDNPIEDDG R L TY     +    +VEL+L
Sbjct  384  RNCNLQRDDVDCLRYVLVHIPNLEQLDLSDNPIEDDGFRCLTTYFKDMSQRYFSLVELKL  443

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CELT  GV  LLE LS L KP + LSIG NYLGSEIG  +GKF+  GI + DI+DIGL
Sbjct  444  ESCELTCSGVCELLEVLSALRKPLSFLSIGGNYLGSEIGTPLGKFLCGGIQAFDIEDIGL  503

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF KA +E+V + K+  INISKNRGGI+TA+F+SKLFS+AP+L +INA++N M  ES
Sbjct  504  GSSGFLKAGKELVRESKLRSINISKNRGGIETARFLSKLFSHAPDLSSINAKYNFMAKES  563

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENS-ADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            L+I+ SG+  A GKLE LDL GN  CE   AD S L++   +G  V+    S A NVPYD
Sbjct  564  LSILSSGIKVAKGKLEHLDLRGNIICEEELADFSELAELRTSGNFVLELSSSPAQNVPYD  623

Query  254  DDP  246
            DDP
Sbjct  624  DDP  626



>ref|XP_006352713.1| PREDICTED: uncharacterized protein LOC102605986 [Solanum tuberosum]
Length=627

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 174/243 (72%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            RN   Q DDVDC RYA +++PN E LDLSDNPIE  G+R LI Y + +      +VEL+L
Sbjct  386  RNCNLQMDDVDCLRYALVHIPNLEQLDLSDNPIETSGIRCLIPYFKETSHKYFPLVELKL  445

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CELT  GV  LLE LS L KP   LSIG N LGSEIG ++GKF+  GI +LDI+DIGL
Sbjct  446  ESCELTCFGVCELLEALSSLRKPLNFLSIGGNSLGSEIGTALGKFLCGGIQALDIEDIGL  505

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF +A +EIV + K+  INISKNRGGI+TA+F+SKLFSYAP+L  +NA++N MP ES
Sbjct  506  GSSGFMRAGQEIVTETKLHSINISKNRGGIETARFLSKLFSYAPDLSTVNAKYNFMPKES  565

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L+I+ S + AA GKLE LDL GN  C      S L++++ NG   I++L SS A N PYD
Sbjct  566  LSILSSAVKAAKGKLEHLDLRGNIMCGQQVHLSELAEFQTNG-FSILELSSSPALNEPYD  624

Query  254  DDP  246
            DDP
Sbjct  625  DDP  627



>ref|XP_009601758.1| PREDICTED: uncharacterized protein LOC104096985 [Nicotiana tomentosiformis]
Length=626

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 173/243 (71%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            RN   Q+DDVDC RY  +++PN E LDLSDNPIEDDG R L TY     +    +VEL+L
Sbjct  384  RNCNLQRDDVDCLRYVLVHIPNLEQLDLSDNPIEDDGFRCLSTYFTEMSQRYFSLVELKL  443

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CELT  GV  LL  LS L KP + LSIG NYLGSEIG  +GKF+  GI + DI+DIGL
Sbjct  444  ESCELTCSGVCELLVVLSALRKPLSFLSIGGNYLGSEIGTPLGKFLCGGIQAFDIEDIGL  503

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF KA +E+V++ K+  INISKNRGGI+TA+F+SKLFS+AP+L ++NA++N M  ES
Sbjct  504  GSSGFLKAGKELVKESKLRSINISKNRGGIETARFLSKLFSHAPDLSSVNAKYNFMAKES  563

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENS-ADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            L+I+ SG+  A GKLE LDL GN  CE   AD S L++   +G  V+    S A NVPYD
Sbjct  564  LSILSSGVKVAKGKLEHLDLRGNIICEEELADFSELAELRTSGNFVLELSSSPAQNVPYD  623

Query  254  DDP  246
            DDP
Sbjct  624  DDP  626



>ref|XP_004242382.1| PREDICTED: ribonuclease inhibitor [Solanum lycopersicum]
Length=625

 Score =   253 bits (647),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 175/243 (72%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL-EYSCK---IVELRL  789
            RN   Q DDVDC RYA +++PN E LDLSDNPIE  G+R LI Y  E S K   +VEL+L
Sbjct  384  RNCNLQMDDVDCLRYALVHVPNLEQLDLSDNPIETSGIRCLIPYFKETSYKYFPLVELKL  443

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CELT  GV  LLE LS L KP   LSIG N LGSEIG ++GKF+  GI +LDI+DIGL
Sbjct  444  ESCELTCFGVCELLEALSSLRKPLNFLSIGGNSLGSEIGTALGKFLCCGIQALDIEDIGL  503

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS+GF +A + IV++ K+  INISKNRGGI+TA+F+SKLFS+AP+L  +NA++N MP ES
Sbjct  504  GSTGFMRAGQAIVKETKLHSINISKNRGGIETARFLSKLFSHAPDLSTVNAKYNFMPKES  563

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L+I+ S + AA GKLE LDL GN  C      S L++++ NG   I++L SS A N PYD
Sbjct  564  LSILSSAVKAAKGKLEHLDLRGNIICGQQVHLSELAEFQTNG-FSILELSSSPALNEPYD  622

Query  254  DDP  246
            DDP
Sbjct  623  DDP  625



>ref|XP_012085177.1| PREDICTED: protein NLRC3 [Jatropha curcas]
 gb|KDP26432.1| hypothetical protein JCGZ_17590 [Jatropha curcas]
Length=603

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 172/242 (71%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   KDDV+  RYA + MPN E LDLSDNPIED+G+R LI Y    LE    +VEL L
Sbjct  362  RGNSLHKDDVESLRYALLCMPNLEILDLSDNPIEDEGIRCLIPYFVEPLERFSSLVELNL  421

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL+ LS L++P  SLS+  N LGS +  ++GKF+S  I  LDI  IGL
Sbjct  422  ENCELSCDGVTQLLDTLSALQRPIKSLSLADNGLGSPVAGALGKFLSTSIRELDIGGIGL  481

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS+GF + Q+E++ DLK++ INISKNRGG++TAKF+SKL S AP++V+++A +NLMP ES
Sbjct  482  GSAGFEELQKEMMADLKLVKINISKNRGGLETAKFLSKLMSSAPDIVSVDASYNLMPTES  541

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L II S L AA G LE LDL+GN      A AS+L++++ NG+ ++I   S A +VPYDD
Sbjct  542  LIIICSALKAAKGNLECLDLNGNTWDWQQAHASILAEFQHNGRPILILPLSRATDVPYDD  601

Query  251  DP  246
            DP
Sbjct  602  DP  603



>ref|XP_008235539.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5 [Prunus 
mume]
Length=607

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 162/242 (67%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  RYA +++PN E LD+SDNPIEDDG+RSLI Y     E      +L L
Sbjct  366  RGNNLNKDDADGLRYALVHIPNLEVLDMSDNPIEDDGIRSLIPYFVEASEKCFPFADLML  425

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+ HGV  L++ LS LE+P  SLS+  N LGS++ A++GK +S  I  L+++ IGL
Sbjct  426  ENCELSCHGVTYLIDTLSTLERPLKSLSVADNDLGSQVAAALGKLLSTSIRILNVEGIGL  485

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF + Q+ I ++LK++ +NISKNRGGI TA F+SKL S APELV ++A +NLMP +S
Sbjct  486  GSSGFQELQDGITKELKLVKVNISKNRGGIGTANFLSKLISMAPELVTVDAAYNLMPLKS  545

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L  I S L AA G +E LDL GN        AS+ +  + NG+ V+I   S  P+ PYDD
Sbjct  546  LNTICSALKAAKGNIERLDLRGNIWDYQPGYASMHADIQCNGRPVLILSSSPTPDAPYDD  605

Query  251  DP  246
            DP
Sbjct  606  DP  607



>gb|KDO65820.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
Length=390

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 162/243 (67%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  149  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  208

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  209  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  268

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL   APELV +NA +NLMP ES
Sbjct  269  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMPLAPELVEVNAGYNLMPLES  328

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  329  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  387

Query  254  DDP  246
            D+P
Sbjct  388  DEP  390



>ref|XP_007201725.1| hypothetical protein PRUPE_ppa003067mg [Prunus persica]
 gb|EMJ02924.1| hypothetical protein PRUPE_ppa003067mg [Prunus persica]
Length=607

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 162/242 (67%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  RYA +++PN E LD+SDNPIED G+RSLI Y     E      +L L
Sbjct  366  RGNNLNKDDADGLRYALVHIPNLEVLDMSDNPIEDAGIRSLIPYFVEASEKCFPFADLML  425

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+ HGV  L++ LS L++P  SLS+  N LGS++ A++GK +S  I  L+++ IGL
Sbjct  426  ENCELSCHGVTYLIDTLSTLQRPLKSLSVADNDLGSQVAAALGKLLSTSIQILNVEGIGL  485

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF + Q+ I ++LK++ +NISKNRGGI+TA F+SKL S APELV ++A +NLMP +S
Sbjct  486  GSSGFQELQDGITKELKLVKVNISKNRGGIETANFLSKLISMAPELVTVDAAYNLMPLKS  545

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L  I S L AA G +E LDL GN        AS+ +  + NG+ V+I   S  P+ PYDD
Sbjct  546  LTTICSALKAAKGNIERLDLRGNIWDYQPGYASMHADIQCNGRPVLILSSSPTPDAPYDD  605

Query  251  DP  246
            DP
Sbjct  606  DP  607



>ref|XP_010652448.1| PREDICTED: protein NLRC3 isoform X1 [Vitis vinifera]
Length=620

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 159/242 (66%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  +YA IYMPN E LDLSDNPIEDDG+ SLI Y     E    + +L L
Sbjct  379  RGNNLCKDDADSLKYALIYMPNLEILDLSDNPIEDDGISSLIPYFVEASERHSPLADLSL  438

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
             +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGL
Sbjct  439  GDCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGL  498

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ES
Sbjct  499  GSSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVES  558

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L ++ S L    GKLE LDL GNA    SA A +  +++  G+ ++I  P  A + PYDD
Sbjct  559  LTVVHSSLKVGKGKLERLDLRGNARFCQSAHAPLFDEFQHRGRPIVILPPLPAADEPYDD  618

Query  251  DP  246
            DP
Sbjct  619  DP  620



>ref|XP_010243650.1| PREDICTED: uncharacterized protein LOC104587649 isoform X3 [Nelumbo 
nucifera]
Length=613

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 172/244 (70%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD    ++A ++MPN ESLD+SDNPIEDDG+R+LI Y     E    +V+L++
Sbjct  372  RGNNLLKDDAGDLKHALVHMPNLESLDISDNPIEDDGIRNLIPYFTEASERGSSLVDLKI  431

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  432  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  490

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  491  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  550

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  258
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  551  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  609

Query  257  DDDP  246
            DDDP
Sbjct  610  DDDP  613



>ref|XP_010243649.1| PREDICTED: uncharacterized protein LOC104587649 isoform X2 [Nelumbo 
nucifera]
Length=621

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 172/244 (70%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD    ++A ++MPN ESLD+SDNPIEDDG+R+LI Y     E    +V+L++
Sbjct  380  RGNNLLKDDAGDLKHALVHMPNLESLDISDNPIEDDGIRNLIPYFTEASERGSSLVDLKI  439

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  440  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  498

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  499  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  558

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  258
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  559  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  617

Query  257  DDDP  246
            DDDP
Sbjct  618  DDDP  621



>ref|XP_010243648.1| PREDICTED: uncharacterized protein LOC104587649 isoform X1 [Nelumbo 
nucifera]
Length=629

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 172/244 (70%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD    ++A ++MPN ESLD+SDNPIEDDG+R+LI Y     E    +V+L++
Sbjct  388  RGNNLLKDDAGDLKHALVHMPNLESLDISDNPIEDDGIRNLIPYFTEASERGSSLVDLKI  447

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  448  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  506

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  507  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  566

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  258
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  567  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  625

Query  257  DDDP  246
            DDDP
Sbjct  626  DDDP  629



>ref|XP_008382798.1| PREDICTED: protein NLRC3, partial [Malus domestica]
Length=375

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 156/242 (64%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDVD  RYA ++MP  E LD+SDNPIEDDG+RSLI Y     E      +L L
Sbjct  134  RGNNLNKDDVDGLRYALVHMPKLEVLDISDNPIEDDGIRSLIPYFVEASEKCTPYADLML  193

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CEL+  GV  L++ LS L++P  SLS+  N LGS++  ++GK +S  I  L+++ IGL
Sbjct  194  ESCELSCDGVTLLIDTLSTLKRPLKSLSVADNDLGSQVAPALGKILSASIQVLNVEGIGL  253

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G SGF + Q+ I +DLK++ INISKNRGGI+ AKF+  L S APELV +N  +NL+P  S
Sbjct  254  GLSGFRELQDGITKDLKLVEINISKNRGGIEAAKFLVNLISRAPELVTVNVAYNLLPLNS  313

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L I+ S + AA G LE LDL GN     S  AS+L+  + NGK V I   S     PYDD
Sbjct  314  LTIVCSAIKAAKGHLEHLDLRGNTWDNQSGYASMLADAQCNGKPVFILSSSQTVGAPYDD  373

Query  251  DP  246
            DP
Sbjct  374  DP  375



>ref|XP_007050066.1| RNI-like superfamily protein, putative [Theobroma cacao]
 gb|EOX94223.1| RNI-like superfamily protein, putative [Theobroma cacao]
Length=604

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 167/243 (69%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  +KDD    RYA ++MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L
Sbjct  363  RGNNLRKDDAGSLRYALVHMPSLEILDLSDNPIEDDGIRSLIPYFAEASKMFIPLTDLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL+ LS + KP  SLS+  N LGS++  ++G F    I  L+++ IGL
Sbjct  423  ENCELSYDGVTQLLDALSSVGKPLNSLSVADNGLGSQVAEALGNFWGTSIQVLNLEGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G SGF K ++  +EDL ++ INISKNRGGI+TAKF+SKL   AP+L+A+NA +NLMP ES
Sbjct  483  GPSGFRKLKDVGMEDLMLVEINISKNRGGIETAKFLSKLIRQAPKLIAVNAAYNLMPVES  542

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L II S L  A G LE +DL+GN      +  ++L++++ NG+ ++I LPSS A +VPYD
Sbjct  543  LIIICSALKTATGHLEQVDLTGNIWDYQPSHDTMLAEFQHNGRPILI-LPSSVASDVPYD  601

Query  254  DDP  246
            DDP
Sbjct  602  DDP  604



>ref|XP_006443678.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
 ref|XP_006480174.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X4 [Citrus sinensis]
 gb|ESR56918.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
Length=549

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  308  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  367

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  368  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  427

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  428  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  487

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  488  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  546

Query  254  DDP  246
            D+P
Sbjct  547  DEP  549



>ref|XP_011083100.1| PREDICTED: uncharacterized protein LOC105165701 isoform X2 [Sesamum 
indicum]
Length=608

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 172/237 (73%), Gaps = 7/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL-EYSCK---IVELRLENCELT  771
            ++D DC + A ++MPN ++LDLSDN IED GVRSLI+Y  E S +     +L LENCELT
Sbjct  373  REDADCLKQALVHMPNLQNLDLSDNSIED-GVRSLISYFREISSRDLPFSDLMLENCELT  431

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
             + V  LL  LS ++KP   LSI  N LGSEIGA  GKF+  G+ ++D++DIGLGSSGF 
Sbjct  432  CNQVIELLGVLSTMKKPVNLLSIKGNRLGSEIGAPFGKFLCTGVRAVDVEDIGLGSSGFL  491

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
            +A  EI  +LKI  INIS N+GGI+ AKF+S + S++ ++VAI+A +NLMP ESL++I S
Sbjct  492  EALREISTELKIAYINISNNQGGIEAAKFMSSIISHSQKIVAIDARYNLMPMESLSVISS  551

Query  410  GL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            G+ A+ GKLE LDL+GN+ C++ AD ASVL++ +I+G+  +     +AP+ PYDDDP
Sbjct  552  GMKASKGKLEHLDLAGNSFCDHLADAASVLAELQIHGQSALSLSLWAAPSAPYDDDP  608



>ref|XP_006480171.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X1 [Citrus sinensis]
Length=602

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  361  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  420

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  421  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  480

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  481  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  540

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  541  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  599

Query  254  DDP  246
            D+P
Sbjct  600  DEP  602



>ref|XP_006443679.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
 ref|XP_006480173.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X3 [Citrus sinensis]
 gb|ESR56919.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
Length=599

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  358  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  417

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  418  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  477

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  478  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  537

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  538  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  596

Query  254  DDP  246
            D+P
Sbjct  597  DEP  599



>ref|XP_011083098.1| PREDICTED: uncharacterized protein LOC105165701 isoform X1 [Sesamum 
indicum]
 ref|XP_011083099.1| PREDICTED: uncharacterized protein LOC105165701 isoform X1 [Sesamum 
indicum]
Length=620

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 172/237 (73%), Gaps = 7/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL-EYSCK---IVELRLENCELT  771
            ++D DC + A ++MPN ++LDLSDN IED GVRSLI+Y  E S +     +L LENCELT
Sbjct  385  REDADCLKQALVHMPNLQNLDLSDNSIED-GVRSLISYFREISSRDLPFSDLMLENCELT  443

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
             + V  LL  LS ++KP   LSI  N LGSEIGA  GKF+  G+ ++D++DIGLGSSGF 
Sbjct  444  CNQVIELLGVLSTMKKPVNLLSIKGNRLGSEIGAPFGKFLCTGVRAVDVEDIGLGSSGFL  503

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
            +A  EI  +LKI  INIS N+GGI+ AKF+S + S++ ++VAI+A +NLMP ESL++I S
Sbjct  504  EALREISTELKIAYINISNNQGGIEAAKFMSSIISHSQKIVAIDARYNLMPMESLSVISS  563

Query  410  GL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            G+ A+ GKLE LDL+GN+ C++ AD ASVL++ +I+G+  +     +AP+ PYDDDP
Sbjct  564  GMKASKGKLEHLDLAGNSFCDHLADAASVLAELQIHGQSALSLSLWAAPSAPYDDDP  620



>ref|XP_006480172.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X2 [Citrus sinensis]
Length=600

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 163/243 (67%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  359  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  418

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  419  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  478

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  479  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  538

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  539  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  597

Query  254  DDP  246
            D+P
Sbjct  598  DEP  600



>gb|KJB42368.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=581

 Score =   220 bits (561),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 166/241 (69%), Gaps = 7/241 (3%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLEN  783
            N  QKDD    RY  + MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L +
Sbjct  342  NNLQKDDAGNLRYVLVQMPSLEILDLSDNPIEDDGIRSLIPYFAEASKSCSPLTDLNLGS  401

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG 
Sbjct  402  CELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLGP  461

Query  602  SGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLA  423
            SGF K ++  +E+LK++ +NISKNRGGI+TAKF+SKL  +AP+LVA+NA +NLMPAESL 
Sbjct  462  SGFRKLRDIRMENLKLVKLNISKNRGGIETAKFLSKLILHAPKLVAVNAAYNLMPAESLP  521

Query  422  IIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDDD  249
            +I S L  A G +E +DL GN      +  ++L++++ NGK ++I LPSS A N+PYDDD
Sbjct  522  LICSALKTAKGLVEQVDLRGNICEYQPSHDTMLAEFQHNGKPILI-LPSSVALNIPYDDD  580

Query  248  P  246
            P
Sbjct  581  P  581



>gb|KJB42369.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=604

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 166/241 (69%), Gaps = 7/241 (3%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLEN  783
            N  QKDD    RY  + MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L +
Sbjct  365  NNLQKDDAGNLRYVLVQMPSLEILDLSDNPIEDDGIRSLIPYFAEASKSCSPLTDLNLGS  424

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG 
Sbjct  425  CELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLGP  484

Query  602  SGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLA  423
            SGF K ++  +E+LK++ +NISKNRGGI+TAKF+SKL  +AP+LVA+NA +NLMPAESL 
Sbjct  485  SGFRKLRDIRMENLKLVKLNISKNRGGIETAKFLSKLILHAPKLVAVNAAYNLMPAESLP  544

Query  422  IIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDDD  249
            +I S L  A G +E +DL GN      +  ++L++++ NGK ++I LPSS A N+PYDDD
Sbjct  545  LICSALKTAKGLVEQVDLRGNICEYQPSHDTMLAEFQHNGKPILI-LPSSVALNIPYDDD  603

Query  248  P  246
            P
Sbjct  604  P  604



>ref|XP_002521155.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41306.1| protein binding protein, putative [Ricinus communis]
Length=598

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 166/242 (69%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            RNN  +K D+   RY  + MPN + LDL +NPIED+G+R LI Y     E    +VEL L
Sbjct  357  RNNNLRKCDMKSLRYTLLCMPNLDILDLGENPIEDEGIRCLIPYFTEAVERCSPLVELNL  416

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+CEL+  GV  LL+ LS L+KP  SL++  N LGS I  ++GKF+   I  L+I  IGL
Sbjct  417  ESCELSCEGVTLLLDTLSTLQKPLNSLTLADNGLGSPIAGALGKFLCTPIRELNIGGIGL  476

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS+GF + Q+ ++E+LK++ INISKNRGG++TAKF+ KL S AP+LVA+ A +NLMPAES
Sbjct  477  GSAGFLELQKGMMEELKLVEINISKNRGGLETAKFLLKLMSLAPDLVAVKASYNLMPAES  536

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I SGL A+ G L+ LDL+GN        ASVL+ ++ NG+ ++I     AP++PYDD
Sbjct  537  LTLICSGLKASKGNLQHLDLTGNTWDYQQTHASVLADFQHNGRPILILSSIHAPHIPYDD  596

Query  251  DP  246
            DP
Sbjct  597  DP  598



>ref|XP_004290025.1| PREDICTED: protein NLRC5 isoform X1 [Fragaria vesca subsp. vesca]
Length=612

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 159/242 (66%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  RYA +++PN E LD+SDNPI DDG+RSLI +L    E   + V+L L
Sbjct  372  RGNNLNKDDADDLRYALVHLPNLEVLDMSDNPIGDDGIRSLIPFLMEASEKCTRFVDLML  431

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+ HGV  L++ LS L +P  SLSI  N LGS++   +G+F+   I  L+   IGL
Sbjct  432  ENCELSCHGVTELIKTLSSLSRPLKSLSIADNDLGSQVAGVLGEFLCTPIQVLNAGGIGL  491

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
             SSGF   QE++ ++LK++ I+ISKNRGGI+TA F+SKL S AP+L  +NA +NLMP ES
Sbjct  492  RSSGFQVLQEKLTKELKLVEIDISKNRGGIETANFLSKLMSEAPKLAIVNAAYNLMPVES  551

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L  I S +  A G L+ +DLSGN         S+L+  + N +L++I LPS  P+ PYD 
Sbjct  552  LTAICSAIKNAKGTLQRMDLSGNTWDYQPVYDSMLADIQCNERLILI-LPSLTPDAPYDA  610

Query  251  DP  246
            DP
Sbjct  611  DP  612



>ref|XP_010091857.1| Ribonuclease inhibitor [Morus notabilis]
 gb|EXB46065.1| Ribonuclease inhibitor [Morus notabilis]
Length=615

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 155/244 (64%), Gaps = 11/244 (5%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD    RYA ++MPN E LD+SDNPIEDDG+RSL+ Y     E      +L +
Sbjct  376  RGNNLDKDDAVGLRYALVHMPNLEVLDISDNPIEDDGIRSLLPYFVEAFEACSPFAKLYV  435

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E+C+L   GV  LL  LS  ++P  SLSI  N+LGS++ A +GKF+S  I  L+I  IGL
Sbjct  436  ESCDLNASGVIELLNTLSSFKRPLESLSIADNFLGSKVAAVLGKFLSTSIQVLNISGIGL  495

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
             SSGF   Q+ I +++K+I INIS+NRGGI TA F+S L   APELV +NAE+N MP ES
Sbjct  496  SSSGFEDLQQSITKEVKLIGINISRNRGGIATANFLSTLLPRAPELVFVNAEYNFMPVES  555

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEI--NGKLVIIDLPSSAPNVPY  258
              I+ S L AA G LELLDL+GN    N    ++L   EI  NGKL +I     A + PY
Sbjct  556  SRIMCSALKAAKGNLELLDLTGN----NLDSQTILGLAEIQRNGKLALIFSSLPAADAPY  611

Query  257  DDDP  246
            DDDP
Sbjct  612  DDDP  615



>gb|KGN44555.1| hypothetical protein Csa_7G330390 [Cucumis sativus]
Length=533

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 156/244 (64%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E +C   +L L
Sbjct  292  RGNGLKKDDADNLRYALFHIPNLEFLDMSDNPIEDDGIRNLIPYFIEASERNCPFADLNL  351

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  352  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  411

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF    E +     I+ INISKNRGGI+ A F+ KL S A +LV++NA +NLMP ES
Sbjct  412  GPCGFQDLVEGVTAGSNIVNINISKNRGGIEIATFLLKLLSGASDLVSVNASYNLMPVES  471

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  258
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+PN+   Y
Sbjct  472  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPNLDGLY  529

Query  257  DDDP  246
            D DP
Sbjct  530  DADP  533



>ref|XP_004139728.1| PREDICTED: protein NLRC3 isoform X1 [Cucumis sativus]
Length=604

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 156/244 (64%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E +C   +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDMSDNPIEDDGIRNLIPYFIEASERNCPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF    E +     I+ INISKNRGGI+ A F+ KL S A +LV++NA +NLMP ES
Sbjct  483  GPCGFQDLVEGVTAGSNIVNINISKNRGGIEIATFLLKLLSGASDLVSVNASYNLMPVES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  258
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+PN+   Y
Sbjct  543  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPNLDGLY  600

Query  257  DDDP  246
            D DP
Sbjct  601  DADP  604



>ref|XP_010069680.1| PREDICTED: uncharacterized protein LOC104456563 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58100.1| hypothetical protein EUGRSUZ_H00824 [Eucalyptus grandis]
Length=603

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 156/242 (64%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL-EYSCK---IVELRL  789
            R N   K+D D  R+A  +MP    LDLSDNPIEDDG+R LI +L E S K   + +L L
Sbjct  362  RGNNLHKEDADNLRHALAHMPALRKLDLSDNPIEDDGLRHLIPFLVEASGKGFTLADLSL  421

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+ +GV   L  LS  + P +SLSI  N LGS +  ++ K +S  I  L+I  +GL
Sbjct  422  ENCELSSNGVIEFLTTLSTSDIPLSSLSISDNSLGSHVAEALVKLLSSSIQVLNISGVGL  481

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF + Q+   + LK++ I+ISKNRGGI++AKF+SKL   AP+LV +NA FNLMP ES
Sbjct  482  GSSGFEELQKVSFKSLKLVKIDISKNRGGIESAKFLSKLMECAPQLVTVNAAFNLMPPES  541

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L II S L AA G L LL+L GN   +   DAS+L   + +G+L II   S   + PYDD
Sbjct  542  LTIICSALKAAKGNLGLLELRGNNLDKPPNDASLLVDLQRDGRLRIIFESSPTLDAPYDD  601

Query  251  DP  246
            DP
Sbjct  602  DP  603



>ref|XP_008461989.1| PREDICTED: protein NLRC3 isoform X1 [Cucumis melo]
 ref|XP_008461990.1| PREDICTED: protein NLRC3 isoform X1 [Cucumis melo]
Length=604

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 151/242 (62%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E S    +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDISDNPIEDDGIRNLIPYFIEASERSFPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF    E + E   I+ INISKNRGGI+ A F+ KL S   +LV++NA +NLMP ES
Sbjct  483  GPCGFQDLVEGVTEGSNIVNINISKNRGGIEIATFLLKLLSGGSDLVSVNASYNLMPVES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   S   +  YD 
Sbjct  543  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILIYSSSPTLDGLYDG  602

Query  251  DP  246
            DP
Sbjct  603  DP  604



>ref|XP_006604527.1| PREDICTED: protein NLRC3-like [Glycine max]
 gb|KHN02437.1| Protein NLRC3 [Glycine soja]
Length=604

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 152/242 (63%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  RYA  ++PN E LD+S N IED+G+R+LI Y     E    I  L+L
Sbjct  363  RENNLGKDDVESLRYALQHVPNLEELDISGNSIEDEGIRNLIPYFVGASETCPHITCLKL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LL  LS  + P  SLSI  NYLGS++  ++GKF S  I  LDI  IGL
Sbjct  423  ENCDLSCVGVNNLLHILSNFKGPLKSLSIADNYLGSQVAEALGKFFSTPIEVLDIAGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + Q  I E +K++ INISKNRGGI TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSYGFQELQSLIKEKVKLVKINISKNRGGIATAKFLSKLLSQAPQLVDVNAASNLMPIES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            LAII S L  A G ++ +DL+G+         S  +++  NG  ++I   SSA   P+D 
Sbjct  543  LAIICSALKFAKGNVQQVDLTGHIWDYKPEHVSPYTEFVHNGLPILILPSSSASAAPHDH  602

Query  251  DP  246
            DP
Sbjct  603  DP  604



>ref|XP_004493854.1| PREDICTED: uncharacterized protein LOC101511205 [Cicer arietinum]
Length=616

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 149/242 (62%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD +    A  YMPN E LD+SDN I D+G+R+LI Y     E   ++  L+L
Sbjct  375  RGNSLRKDDAENLGNALAYMPNLEDLDISDNSIGDEGIRNLIPYFVGTSEKCSRVTCLKL  434

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E CEL+  GV   L+ LS L  P  SLSI  NYLG ++  ++G+F+S  I  LD   I  
Sbjct  435  EACELSYDGVNHFLDSLSTLRGPLKSLSIAENYLGRKVAGALGRFLSTPIEELDASGIDF  494

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G SGF   Q  I E+LK++ INISKNRGG +TAKF+SKL S AP+L+ +NA  N MP ES
Sbjct  495  GPSGFQDLQNLIKEELKLVKINISKNRGGTETAKFLSKLLSQAPQLIDVNAASNFMPIES  554

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L+II S L  A G ++ LDL+G+        AS+ +++  NGK ++I  PSS    PYD 
Sbjct  555  LSIISSALKLAKGNVQRLDLTGHKWDYKPEHASLSTEFVYNGKPILILPPSSITAAPYDH  614

Query  251  DP  246
            DP
Sbjct  615  DP  616



>ref|XP_007162646.1| hypothetical protein PHAVU_001G168300g [Phaseolus vulgaris]
 gb|ESW34640.1| hypothetical protein PHAVU_001G168300g [Phaseolus vulgaris]
Length=604

 Score =   196 bits (499),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD +  RYA  ++PN E LD+SDN IED+G+R+LI Y     E    I  L+L
Sbjct  363  RENNLGKDDAENLRYALEHLPNLEELDISDNSIEDEGIRNLIPYFVGASETFSPINCLKL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LL  LS  + P  SLSI  NYLGS++  ++G F S  I  LDI  IGL
Sbjct  423  ENCDLSCVGVNHLLHVLSSFKGPLKSLSIADNYLGSQVTEALGNFFSTPIEVLDIAGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + +  I E+LK++ INISKNRGGI+TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSYGFQELKNLIKEELKLVKINISKNRGGIETAKFLSKLLSQAPQLVEVNAASNLMPIES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP-YD  255
            LAI+ S L  A G ++ +DL+G+     S   S+ +++ ++ +L I+ LPSS+ +   +D
Sbjct  543  LAIVCSALKFAKGNVQHVDLTGHIWDCKSEHVSLCTEF-VHNELPILVLPSSSISAALHD  601

Query  254  DDP  246
             DP
Sbjct  602  HDP  604



>ref|XP_003520623.1| PREDICTED: protein NLRC3-like [Glycine max]
Length=604

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 151/243 (62%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV   RYA  ++PN E LD+SDN IED+G+R+LI Y     E   +I  L+L
Sbjct  363  RENNLGKDDVQHLRYALEHVPNLEELDISDNSIEDEGIRNLIPYFVGASETCPRITCLKL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LL  LS  + P  SLSI  NYLG ++  ++G F    I  LDI  IGL
Sbjct  423  ENCDLSCVGVNLLLHYLSTFKGPLKSLSIAENYLGRQVVEALGNFFHTPIEVLDIAGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + Q  I E++K++ INISKNRGG +TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSDGFQELQSLIKEEIKLVKINISKNRGGTETAKFLSKLLSQAPQLVDVNAACNLMPIES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            LAII   L  A G ++ +DL+G+         S  +++  NG L I+ LPS S    P+D
Sbjct  543  LAIICCALKFAKGNVQQVDLTGHIWDYKPEHVSPYAEFVHNG-LPILVLPSPSVSAAPHD  601

Query  254  DDP  246
             DP
Sbjct  602  HDP  604



>gb|KHN09410.1| Protein NLRC5 [Glycine soja]
Length=604

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 151/243 (62%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV   RYA  ++PN E LD+SDN IED+G+R+LI Y     E   +I  L+L
Sbjct  363  RENNLGKDDVQHLRYALEHVPNLEELDISDNSIEDEGIRNLIPYFVGASETCPRITCLKL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LL  LS  + P  SLSI  NYLG ++  ++G F    I  LDI  IGL
Sbjct  423  ENCDLSCVGVNLLLHYLSTFKGPLKSLSIAENYLGRQVVEALGNFFHTPIEVLDIAGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + Q  I E++K++ INISKNRGG +TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSDGFQELQSLIKEEIKLVKINISKNRGGTETAKFLSKLLSQAPQLVDVNAACNLMPIES  542

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  255
            LAII   L  A G ++ +DL+G+         S  +++  NG L I+ LPS S    P+D
Sbjct  543  LAIICCALKFAKGNVQQVDLTGHIWDYKPEHVSPYAEFVHNG-LPILVLPSPSVSAAPHD  601

Query  254  DDP  246
             DP
Sbjct  602  HDP  604



>ref|XP_010540942.1| PREDICTED: protein NLRC3 isoform X1 [Tarenaya hassleriana]
Length=602

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 164/244 (67%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D +   +A ++MPN E+LDLSDNPIEDDG+RSLI+Y     EY   +  L L
Sbjct  361  RGNDLNKSDAENLAHALVHMPNLETLDLSDNPIEDDGIRSLISYFTNHPEYP--LANLNL  418

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL+ LS+LEKP  SLSI  N LGS +  +IG F++  I SL+I  +GL
Sbjct  419  ENCELSCDGVIDLLDSLSLLEKPLKSLSIADNALGSGVADAIGDFLASPIQSLNISGMGL  478

Query  608  GSSGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            GS GF + Q +IV++L ++  INISKNRGG++ A+F+SKL   AP+L++ +  +NLMP+E
Sbjct  479  GSIGFLELQRKIVKELMMLLNINISKNRGGLEAARFLSKLIPLAPKLLSADTSYNLMPSE  538

Query  431  SLAIIGSGL-AANGKLELLDLSGNA-SCENSADASVLSKYEINGKLVIIDLPSSAPNVPY  258
            SL+++ + L +  G LE +D++GN+ S     D  +  +++ NGK + +   S A NVPY
Sbjct  539  SLSLLCTSLKSTKGDLESIDMTGNSCSYRTDNDHPLFHEFQRNGKPIFVLPKSPASNVPY  598

Query  257  DDDP  246
            DDDP
Sbjct  599  DDDP  602



>gb|AAD21766.1| hypothetical protein [Arabidopsis thaliana]
Length=271

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 159/244 (65%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   + D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  30   RGNELDRYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPDSRLADLNLEN  89

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGLG 
Sbjct  90   CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGLGP  149

Query  602  SGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
             GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP E
Sbjct  150  LGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMPPE  207

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  258
            +L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +VPY
Sbjct  208  ALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHVPY  267

Query  257  DDDP  246
            DDDP
Sbjct  268  DDDP  271



>ref|XP_011014860.1| PREDICTED: uncharacterized protein LOC105118587 isoform X2 [Populus 
euphratica]
Length=606

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  R A + MPN E LD+SDNPIEDDG+R LI Y+    +    + EL L
Sbjct  365  RGNDLHKDDVESLRCALVSMPNLEILDISDNPIEDDGIRCLIPYIVEAHDRCSPLAELYL  424

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  425  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  484

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  485  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  544

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  545  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  603

Query  254  DDP  246
            DDP
Sbjct  604  DDP  606



>ref|XP_011014859.1| PREDICTED: uncharacterized protein LOC105118587 isoform X1 [Populus 
euphratica]
Length=607

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  R A + MPN E LD+SDNPIEDDG+R LI Y+    +    + EL L
Sbjct  366  RGNDLHKDDVESLRCALVSMPNLEILDISDNPIEDDGIRCLIPYIVEAHDRCSPLAELYL  425

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  426  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  485

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  486  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  545

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  546  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  604

Query  254  DDP  246
            DDP
Sbjct  605  DDP  607



>emb|CDY65850.1| BnaCnng48880D [Brassica napus]
Length=602

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 161/242 (67%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+Y + +    + +L LEN
Sbjct  361  RGNELNKYDAENLSHALLHMPGLESLDLSGNPIEDSGIRSLISYFKKNPDSPLADLNLEN  420

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS +EKP   LS+  N LGSE+  ++   ++  I SLDI  IGLG 
Sbjct  421  CELSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAVMNSLTVSIESLDISSIGLGP  480

Query  602  SGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMPAESL
Sbjct  481  VGFLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPAESL  540

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
             ++   L +A G L+ LD++GN    + AD +S+L +++ NG+ + +   SS  +VPYDD
Sbjct  541  LMLCDSLRSAKGDLKRLDMTGNICISSEADHSSLLDEFQHNGEPIFVLPSSSTSHVPYDD  600

Query  251  DP  246
            +P
Sbjct  601  EP  602



>ref|XP_011014863.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X5 [Populus euphratica]
Length=571

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  R A + MPN E LD+SDNPIEDDG+R LI Y+    +    + EL L
Sbjct  330  RGNDLHKDDVESLRCALVSMPNLEILDISDNPIEDDGIRCLIPYIVEAHDRCSPLAELYL  389

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  390  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  449

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  450  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  509

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  510  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  568

Query  254  DDP  246
            DDP
Sbjct  569  DDP  571



>ref|XP_011014861.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X3 [Populus euphratica]
Length=599

 Score =   192 bits (488),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  R A + MPN E LD+SDNPIEDDG+R LI Y+    +    + EL L
Sbjct  358  RGNDLHKDDVESLRCALVSMPNLEILDISDNPIEDDGIRCLIPYIVEAHDRCSPLAELYL  417

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  418  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  477

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  478  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  537

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  538  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  596

Query  254  DDP  246
            DDP
Sbjct  597  DDP  599



>ref|XP_011014862.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X4 [Populus euphratica]
Length=578

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDDV+  R A + MPN E LD+SDNPIEDDG+R LI Y+    +    + EL L
Sbjct  337  RGNDLHKDDVESLRCALVSMPNLEILDISDNPIEDDGIRCLIPYIVEAHDRCSPLAELYL  396

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  397  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  456

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  457  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  516

Query  428  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  255
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  517  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  575

Query  254  DDP  246
            DDP
Sbjct  576  DDP  578



>ref|XP_010684911.1| PREDICTED: uncharacterized protein LOC104899423 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010684912.1| PREDICTED: uncharacterized protein LOC104899423 [Beta vulgaris 
subsp. vulgaris]
Length=636

 Score =   192 bits (488),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 152/241 (63%), Gaps = 4/241 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK---IVELRLE  786
            R N  Q+ D++  R A  +MP  E+LDL+DN  EDDG++ LI Y+  S +   +  L L+
Sbjct  396  RGNNLQRSDMEDLRSALTHMPVLETLDLADNSFEDDGIKCLIPYIVKSSEHFSLTTLNLK  455

Query  785  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  606
            NC+L+  GV  LLE L  ++ P TSLS+  N LGS+I   +G FM   I SLDI DIGLG
Sbjct  456  NCKLSSTGVTELLEVLLAIKCPLTSLSLADNDLGSQIAPLLGDFMHTSIRSLDIRDIGLG  515

Query  605  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
            SSGF + +  + E +K+I INIS+NRGGI  A+F+ +L S A ELV + A +NLMP ESL
Sbjct  516  SSGFLELRIHMPEVVKLISINISENRGGIQAAEFLEELISRASELVDVQAGYNLMPPESL  575

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDD  249
             II S L  + GKL  +DL+GN     +   S LS+++ NG+ +++   S +    YDDD
Sbjct  576  NIICSSLKVSQGKLHCIDLTGNQKLSQTDHVSKLSEFQHNGEPIVLISTSPSQETLYDDD  635

Query  248  P  246
            P
Sbjct  636  P  636



>emb|CBI37239.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  +YA IYMPN E LDLSDNPIEDDG+ SLI Y     E    + +L L
Sbjct  379  RGNNLCKDDADSLKYALIYMPNLEILDLSDNPIEDDGISSLIPYFVEASERHSPLADLSL  438

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
             +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGL
Sbjct  439  GDCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGL  498

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ES
Sbjct  499  GSSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVES  558

Query  428  LAIIGSGL  405
            L ++ S L
Sbjct  559  LTVVHSSL  566



>ref|XP_010652449.1| PREDICTED: protein NLRC3 isoform X2 [Vitis vinifera]
Length=589

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  +YA IYMPN E LDLSDNPIEDDG+ SLI Y     E    + +L L
Sbjct  379  RGNNLCKDDADSLKYALIYMPNLEILDLSDNPIEDDGISSLIPYFVEASERHSPLADLSL  438

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
             +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGL
Sbjct  439  GDCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGL  498

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            GSSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ES
Sbjct  499  GSSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVES  558

Query  428  LAIIGSGL  405
            L ++ S L
Sbjct  559  LTVVHSSL  566



>ref|XP_010416125.1| PREDICTED: uncharacterized protein LOC104702013 isoform X3 [Camelina 
sativa]
Length=598

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 160/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+YL  +   ++ +L LEN
Sbjct  357  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYLTKNPNSRLADLDLEN  416

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  417  CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  476

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  477  LGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  536

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  537  LMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  595

Query  254  DDP  246
            DDP
Sbjct  596  DDP  598



>ref|XP_010416119.1| PREDICTED: uncharacterized protein LOC104702013 isoform X2 [Camelina 
sativa]
Length=605

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 160/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+YL  +   ++ +L LEN
Sbjct  364  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYLTKNPNSRLADLDLEN  423

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  424  CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  483

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  484  LGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  543

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  544  LMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  602

Query  254  DDP  246
            DDP
Sbjct  603  DDP  605



>ref|XP_010416111.1| PREDICTED: uncharacterized protein LOC104702013 isoform X1 [Camelina 
sativa]
Length=612

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 160/243 (66%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+YL  +   ++ +L LEN
Sbjct  371  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYLTKNPNSRLADLDLEN  430

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  431  CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  490

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  491  LGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  550

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  551  LMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  609

Query  254  DDP  246
            DDP
Sbjct  610  DDP  612



>ref|XP_010495912.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
Length=524

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   YA ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  283  RGNELDKYDAENLAYALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  342

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  343  CELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  402

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  403  LGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPESL  462

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VPYD
Sbjct  463  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVPYD  521

Query  254  DDP  246
            DDP
Sbjct  522  DDP  524



>ref|XP_010495911.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X3 [Camelina sativa]
Length=525

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   YA ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  284  RGNELDKYDAENLAYALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  343

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  344  CELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  403

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  404  LGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPESL  463

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VPYD
Sbjct  464  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVPYD  522

Query  254  DDP  246
            DDP
Sbjct  523  DDP  525



>ref|XP_010495909.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X2 [Camelina sativa]
Length=602

 Score =   186 bits (472),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   YA ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  361  RGNELDKYDAENLAYALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  420

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  421  CELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  480

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  481  LGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPESL  540

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VPYD
Sbjct  541  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVPYD  599

Query  254  DDP  246
            DDP
Sbjct  600  DDP  602



>tpg|DAA54822.1| TPA: hypothetical protein ZEAMMB73_341952 [Zea mays]
Length=250

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 151/242 (62%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QKDDV       I MPN   LD+S NP+ D+G+RSLI ++ +S +    ++ L +
Sbjct  10   RENNLQKDDVVDLHKILIKMPNLRDLDISGNPVMDEGIRSLIPFISWSIQKENPLLRLTV  69

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  70   ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  129

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP+LV++NA  NL+P ES
Sbjct  130  GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPDLVSVNAAGNLLPPES  189

Query  428  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ + + PYDD
Sbjct  190  LEVICNSLKQGTCNLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTSAPYDD  248

Query  251  DP  246
            DP
Sbjct  249  DP  250



>dbj|BAF00875.1| hypothetical protein [Arabidopsis thaliana]
Length=518

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 159/244 (65%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   + D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  277  RGNELDRYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPDSRLADLNLEN  336

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGLG 
Sbjct  337  CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGLGP  396

Query  602  SGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
             GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP E
Sbjct  397  LGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMPPE  454

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  258
            +L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +VPY
Sbjct  455  ALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHVPY  514

Query  257  DDDP  246
            DDDP
Sbjct  515  DDDP  518



>ref|XP_010489083.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
 ref|XP_010489084.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X5 [Camelina sativa]
 ref|XP_010489085.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
Length=524

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  283  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  342

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  343  CELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  402

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  403  LGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  462

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  463  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  521

Query  254  DDP  246
            DDP
Sbjct  522  DDP  524



>ref|XP_010495908.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X1 [Camelina sativa]
Length=609

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   YA ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  368  RGNELDKYDAENLAYALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  427

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  428  CELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  487

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  488  LGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPESL  547

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VPYD
Sbjct  548  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVPYD  606

Query  254  DDP  246
            DDP
Sbjct  607  DDP  609



>ref|XP_008789483.1| PREDICTED: uncharacterized protein LOC103706967 isoform X3 [Phoenix 
dactylifera]
Length=506

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 156/245 (64%), Gaps = 10/245 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +   +  ++MPN  SLDLSDNPI DDG+R+LI Y    LE +  + ++++
Sbjct  264  RGNNLHKEDAEDLNHILVHMPNLRSLDLSDNPITDDGIRNLIPYFIRALEKAHPLSDIKI  323

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  324  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  383

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  384  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  443

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  261
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  444  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  501

Query  260  YDDDP  246
            YDDDP
Sbjct  502  YDDDP  506



>ref|XP_011458062.1| PREDICTED: protein NLRC5 isoform X2 [Fragaria vesca subsp. vesca]
Length=578

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  RYA +++PN E LD+SDNPI DDG+RSLI +L    E   + V+L L
Sbjct  372  RGNNLNKDDADDLRYALVHLPNLEVLDMSDNPIGDDGIRSLIPFLMEASEKCTRFVDLML  431

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+ HGV  L++ LS L +P  SLSI  N LGS++   +G+F+   I  L+   IGL
Sbjct  432  ENCELSCHGVTELIKTLSSLSRPLKSLSIADNDLGSQVAGVLGEFLCTPIQVLNAGGIGL  491

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
             SSGF   QE++ ++LK++ I+ISKNRGGI+TA F+SKL S AP+L  +NA +NLMP ES
Sbjct  492  RSSGFQVLQEKLTKELKLVEIDISKNRGGIETANFLSKLMSEAPKLAIVNAAYNLMPVES  551

Query  428  LAIIGSGL  405
            L  I S +
Sbjct  552  LTAICSAI  559



>ref|XP_010489082.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X3 [Camelina sativa]
Length=603

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  362  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  421

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  422  CELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  481

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  482  LGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  541

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  542  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  600

Query  254  DDP  246
            DDP
Sbjct  601  DDP  603



>ref|NP_179611.2| RNI-like superfamily protein [Arabidopsis thaliana]
 gb|AEC06982.1| RNI-like superfamily protein [Arabidopsis thaliana]
Length=604

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 159/244 (65%), Gaps = 9/244 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   + D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  363  RGNELDRYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPDSRLADLNLEN  422

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGLG 
Sbjct  423  CELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGLGP  482

Query  602  SGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
             GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP E
Sbjct  483  LGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMPPE  540

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  258
            +L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +VPY
Sbjct  541  ALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHVPY  600

Query  257  DDDP  246
            DDDP
Sbjct  601  DDDP  604



>ref|XP_010489080.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X1 [Camelina sativa]
 ref|XP_010489081.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X2 [Camelina sativa]
Length=610

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 158/243 (65%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  369  RGNELDKYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNPNSRLADLDLEN  428

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGLG 
Sbjct  429  CELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGLGP  488

Query  602  SGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP ESL
Sbjct  489  LGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPESL  548

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VPYD
Sbjct  549  LMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVPYD  607

Query  254  DDP  246
            DDP
Sbjct  608  DDP  610



>ref|XP_008789482.1| PREDICTED: uncharacterized protein LOC103706967 isoform X2 [Phoenix 
dactylifera]
Length=572

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 156/245 (64%), Gaps = 10/245 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +   +  ++MPN  SLDLSDNPI DDG+R+LI Y    LE +  + ++++
Sbjct  330  RGNNLHKEDAEDLNHILVHMPNLRSLDLSDNPITDDGIRNLIPYFIRALEKAHPLSDIKI  389

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  390  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  449

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  450  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  509

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  261
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  510  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  567

Query  260  YDDDP  246
            YDDDP
Sbjct  568  YDDDP  572



>ref|XP_009102053.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103828197 
[Brassica rapa]
Length=609

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 156/240 (65%), Gaps = 5/240 (2%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLENCE  777
            N   K D +   +A  +MP  ESLDLS NPIED G+RSLI+Y + +    + +L LENCE
Sbjct  370  NELNKYDAENLSHALRHMPGLESLDLSGNPIEDSGIRSLISYFKKNPDSPLADLNLENCE  429

Query  776  LTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSG  597
            L+  GV   L+ LS +EKP   LS+  N LGSE+  +I   +   I SLDI  IGLG  G
Sbjct  430  LSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAIMNSLILSIESLDISSIGLGPVG  489

Query  596  FSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAI  420
            F +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP ESL +
Sbjct  490  FLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPESLLM  549

Query  419  IGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            +   L +A G L+ LD++GN    +  D +S+L +++ NG+ + +   SS  +VPYDD+P
Sbjct  550  LCDSLRSAKGDLKRLDMTGNICISSETDHSSLLGEFQHNGEPIFVLPSSSTSHVPYDDEP  609



>emb|CDY31987.1| BnaA07g00080D [Brassica napus]
Length=604

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 156/240 (65%), Gaps = 5/240 (2%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLENCE  777
            N   K D +   +A  +MP  ESLDLS NPIED G+RSLI+Y + +    + +L LENCE
Sbjct  365  NELNKYDAENLSHALRHMPGLESLDLSGNPIEDSGIRSLISYFKKNPDSPLADLNLENCE  424

Query  776  LTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSG  597
            L+  GV   L+ LS +EKP   LS+  N LGSE+  +I   +   I SLDI  IGLG  G
Sbjct  425  LSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAIMNSLILSIESLDISSIGLGPVG  484

Query  596  FSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAI  420
            F +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP ESL +
Sbjct  485  FLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPESLLM  544

Query  419  IGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            +   L +A G L+ LD++GN    +  D +S+L +++ NG+ + +   SS  +VPYDD+P
Sbjct  545  LCDSLRSAKGDLKRLDMTGNICISSETDHSSLLGEFQHNGEPIFVLPSSSTSHVPYDDEP  604



>ref|XP_008789480.1| PREDICTED: uncharacterized protein LOC103706967 isoform X1 [Phoenix 
dactylifera]
Length=620

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 156/245 (64%), Gaps = 10/245 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +   +  ++MPN  SLDLSDNPI DDG+R+LI Y    LE +  + ++++
Sbjct  378  RGNNLHKEDAEDLNHILVHMPNLRSLDLSDNPITDDGIRNLIPYFIRALEKAHPLSDIKI  437

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  438  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  497

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  498  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  557

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  261
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  558  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  615

Query  260  YDDDP  246
            YDDDP
Sbjct  616  YDDDP  620



>ref|XP_002321304.2| hypothetical protein POPTR_0014s18520g [Populus trichocarpa]
 gb|EEE99619.2| hypothetical protein POPTR_0014s18520g [Populus trichocarpa]
Length=651

 Score =   183 bits (465),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 156/239 (65%), Gaps = 11/239 (5%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCE  777
            R N  +KDDV+  R A + MPN E LD+SDNPIEDDG+R           + EL LENCE
Sbjct  422  RGNDLRKDDVESLRCALVSMPNLEILDISDNPIEDDGIRC--------SPLAELYLENCE  473

Query  776  LTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSG  597
            L+  G   LL+ LS L++P  SLS+  N LGS++   + K +   I +L++  +GLGS G
Sbjct  474  LSCSGATELLDSLSNLKRPLNSLSLADNGLGSDVAGPLQKILGTSIKTLNVGGVGLGSLG  533

Query  596  FSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAII  417
            F + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ESL +I
Sbjct  534  FQELEKGLMAELKLVDINISKNRGGFETARFLAKLMSLAPNIIAINTAYNLMPLESLTVI  593

Query  416  GSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDDDP  246
             S L  + G LE LDL+GN        AS+++++  NG+ + I LPS  A +VPYDDDP
Sbjct  594  CSALKLSKGSLERLDLTGNNWDYQPNHASMVAEFHRNGRPIFI-LPSYLAVDVPYDDDP  651



>ref|XP_002443071.1| hypothetical protein SORBIDRAFT_08g007590 [Sorghum bicolor]
 gb|EES16909.1| hypothetical protein SORBIDRAFT_08g007590 [Sorghum bicolor]
Length=606

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 151/242 (62%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QKDDV       I MPN   LD+S NPI D+G+RS+I ++ +S +    ++ L +
Sbjct  366  RENNLQKDDVVDLHKILIKMPNLRDLDISGNPIMDEGIRSMIPFISWSIQKENPLLRLTV  425

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LLECL+ +++P   LSI  N+LGS + A++ KF+   + +L+  DIGL
Sbjct  426  ENCELSSIGVIMLLECLTTVKQPLDVLSIADNHLGSSVAAALAKFLGSHVRALNATDIGL  485

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  NL+P ES
Sbjct  486  GTLGFQILEEALPTEVALSHINISKNRGGIRAAYFVSRLIGRAPNLVSVNAAANLLPPES  545

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ +   PYDD
Sbjct  546  LEVICNSLKQGTCYLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTCAPYDD  604

Query  251  DP  246
            DP
Sbjct  605  DP  606



>ref|XP_010940684.1| PREDICTED: uncharacterized protein LOC105059159 isoform X3 [Elaeis 
guineensis]
Length=641

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 152/243 (63%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +      ++MPN  SLDLSDNP+ DDG+R+LI Y    LE +  + ++++
Sbjct  399  RGNNLHKEDAEELNRILVHMPNLRSLDLSDNPLTDDGIRNLIPYIIRALEKAHPLSDIKI  458

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  459  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  518

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  519  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  578

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  579  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  638

Query  254  DDP  246
            DDP
Sbjct  639  DDP  641



>ref|XP_010940682.1| PREDICTED: uncharacterized protein LOC105059159 isoform X1 [Elaeis 
guineensis]
Length=683

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 152/243 (63%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +      ++MPN  SLDLSDNP+ DDG+R+LI Y    LE +  + ++++
Sbjct  441  RGNNLHKEDAEELNRILVHMPNLRSLDLSDNPLTDDGIRNLIPYIIRALEKAHPLSDIKI  500

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  501  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  560

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  561  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  620

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  621  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  680

Query  254  DDP  246
            DDP
Sbjct  681  DDP  683



>ref|XP_002443070.1| hypothetical protein SORBIDRAFT_08g007580 [Sorghum bicolor]
 gb|EES16908.1| hypothetical protein SORBIDRAFT_08g007580 [Sorghum bicolor]
Length=579

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 151/242 (62%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QKDDV       I MPN   LD+S NPI D+G+RS+I ++ +S +    ++ L +
Sbjct  339  RENNLQKDDVVDLHKIIIKMPNLRDLDISGNPIMDEGIRSMIPFISWSIQKENPLLRLTV  398

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LLECL+ +++P   LSI  N+LGS + A++ KF+   + +L+  DIGL
Sbjct  399  ENCELSSIGVIMLLECLTTVKQPLDVLSIADNHLGSSVAAALAKFLGSHVRALNATDIGL  458

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  NL+P ES
Sbjct  459  GTLGFQILEEALPTEVALSHINISKNRGGIRAAYFVSRLIGRAPNLVSVNAAANLLPPES  518

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      LE ++L+GN    ++   + L +++ +GK +++  P+ +   PYDD
Sbjct  519  LEVICNSLKQGTCNLERVNLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTCAPYDD  577

Query  251  DP  246
            DP
Sbjct  578  DP  579



>ref|XP_010940683.1| PREDICTED: uncharacterized protein LOC105059159 isoform X2 [Elaeis 
guineensis]
Length=668

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 152/243 (63%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N   K+D +      ++MPN  SLDLSDNP+ DDG+R+LI Y    LE +  + ++++
Sbjct  426  RGNNLHKEDAEELNRILVHMPNLRSLDLSDNPLTDDGIRNLIPYIIRALEKAHPLSDIKI  485

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  486  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  545

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  546  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  605

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  606  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  665

Query  254  DDP  246
            DDP
Sbjct  666  DDP  668



>ref|XP_006408937.1| hypothetical protein EUTSA_v10001935mg [Eutrema salsugineum]
 gb|ESQ50390.1| hypothetical protein EUTSA_v10001935mg [Eutrema salsugineum]
Length=603

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 155/242 (64%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A  +MP  ESLDLS NPIED G+RSLI+Y   +    + +L LEN
Sbjct  362  RGNELDKYDAENLAHALRHMPRLESLDLSGNPIEDGGIRSLISYFTKNPDSPLADLNLEN  421

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS  E+P   LS+  N LG E+  +I   ++  I SL+I  IGLG 
Sbjct  422  CELSCCGVIEFLDTLSTRERPLKFLSVADNALGREVSEAIVNSLTISIESLNISGIGLGP  481

Query  602  SGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF +   ++V+ LK +  INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP ESL
Sbjct  482  VGFLELGRKLVKGLKKLRSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPESL  541

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
             ++   L +A G L+ LD++GN    + AD +S+L +++ N + + +   SSA +VPYDD
Sbjct  542  LMLRDSLRSAKGDLKRLDMTGNNCISHEADHSSLLGEFQHNREPIFVLSSSSASHVPYDD  601

Query  251  DP  246
            +P
Sbjct  602  EP  603



>ref|XP_006300089.1| hypothetical protein CARUB_v10016317mg [Capsella rubella]
 gb|EOA32987.1| hypothetical protein CARUB_v10016317mg [Capsella rubella]
Length=603

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 158/245 (64%), Gaps = 11/245 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEY---SCKIVELRLE  786
            R N   K D +   +A   MP  ESL+LS NPI+D G+RSLI+Y +    SC + +L LE
Sbjct  362  RGNELNKYDAENLAHALFLMPGLESLNLSGNPIKDSGIRSLISYFKKNLNSC-LADLDLE  420

Query  785  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  606
            NCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  + S++I  IGLG
Sbjct  421  NCELSSCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNAFTFSVESINISGIGLG  480

Query  605  SSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
              GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP ES
Sbjct  481  PLGFLALGRKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPES  540

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSA--DASVLSKYEINGKLVIIDLPSS-APNVP  261
            L ++   L  A G L+ LD++GN SC N A   +++L +++ NG+ + + LPSS A +VP
Sbjct  541  LLMLCDSLRTAKGDLKRLDMTGN-SCINQAAEHSTLLCEFQHNGEPIFV-LPSSFASHVP  598

Query  260  YDDDP  246
            YDDDP
Sbjct  599  YDDDP  603



>ref|NP_001066441.1| Os12g0228900 [Oryza sativa Japonica Group]
 dbj|BAF29460.1| Os12g0228900 [Oryza sativa Japonica Group]
Length=304

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 140/237 (59%), Gaps = 7/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLENCELT  771
            K D++      + MPN   LD+SDNPI D+G+R LI ++  + +    +  LR ENC+LT
Sbjct  69   KGDIEDLCKILVKMPNLRDLDISDNPIMDEGIRLLICFISRTLRKEKSLSRLRAENCDLT  128

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
              GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG G  GF 
Sbjct  129  NIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGFGPLGFQ  188

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
              +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES+ +I  
Sbjct  189  ILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPESMEVICD  248

Query  410  GLAANGK--LELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
             L       LE LDL GN    ++A  + L ++  +GK ++I         PYDDDP
Sbjct  249  VLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYDDDP  304



>ref|XP_002883938.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60197.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 155/242 (64%), Gaps = 5/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSC--KIVELRLEN  783
            R N   + D +   +A ++MP  ESLDLS NPIED G+RSLI+Y   +   ++ +L LEN
Sbjct  362  RGNELDRYDAENLAHALLHMPGLESLDLSGNPIEDSGIRSLISYFTKNLDSRLADLDLEN  421

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I   ++  I SL+I  +GLG 
Sbjct  422  CELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSITVSIESLNISGVGLGP  481

Query  602  SGF-SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF +  ++      K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP E+L
Sbjct  482  LGFLALGRKLEKGLKKLLSINISKNRGGLETARFMSKLIPLAPKLISIDASYNLMPPEAL  541

Query  425  AIIGSGL-AANGKLELLDLSGNASCENSADASVLSK-YEINGKLVIIDLPSSAPNVPYDD  252
             ++   L  A   L+ LD++GN+   + AD S L + ++ NG+ + +   SS  +VPYDD
Sbjct  542  LMLCESLRTAKCDLKRLDMTGNSCISHEADHSSLHREFQHNGEPIFVLPSSSVSHVPYDD  601

Query  251  DP  246
            DP
Sbjct  602  DP  603



>ref|XP_008674147.1| PREDICTED: uncharacterized protein LOC103650329 [Zea mays]
Length=651

 Score =   177 bits (450),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 151/242 (62%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QKDDV       I MPN   LD+S NP+ D+G+RSLI ++ +S +    ++ L +
Sbjct  411  RENNLQKDDVVDLHKILIKMPNLRDLDISGNPVMDEGIRSLIPFISWSIQKENPLLRLTV  470

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  471  ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  530

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP+LV++NA  NL+P ES
Sbjct  531  GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPDLVSVNAAGNLLPPES  590

Query  428  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ + + PYDD
Sbjct  591  LEVICNSLKQGTCNLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTSAPYDD  649

Query  251  DP  246
            DP
Sbjct  650  DP  651



>gb|KEH23987.1| LRR ribonuclease inhibitor domain protein [Medicago truncatula]
Length=620

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 145/244 (59%), Gaps = 7/244 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD +   YA  YMPN E LD+SDNPIED+G+R LI Y     E   ++  L+L
Sbjct  377  RGNNLRKDDAENLGYAFAYMPNLEDLDISDNPIEDEGLRYLIPYFAGTSEMCSRLACLKL  436

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  437  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  496

Query  608  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  435
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  497  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  556

Query  434  ESLAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPY  258
            ESL+II S L  A G +  LDL+G+         S+ +++  NGK +++   SSA   P 
Sbjct  557  ESLSIISSALKFAKGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAAPI  616

Query  257  DDDP  246
            D DP
Sbjct  617  DHDP  620



>gb|AES81685.2| LRR ribonuclease inhibitor domain protein [Medicago truncatula]
Length=622

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 145/246 (59%), Gaps = 9/246 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD +   YA  YMPN E LD+SDNPIED+G+R LI Y     E   ++  L+L
Sbjct  377  RGNNLRKDDAENLGYAFAYMPNLEDLDISDNPIEDEGLRYLIPYFAGTSEMCSRLACLKL  436

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  437  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  496

Query  608  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  435
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  497  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  556

Query  434  ESLAIIGSGL---AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNV  264
            ESL+II S L    A G +  LDL+G+         S+ +++  NGK +++   SSA   
Sbjct  557  ESLSIISSALKFAKAAGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAA  616

Query  263  PYDDDP  246
            P D DP
Sbjct  617  PIDHDP  622



>ref|XP_003625467.1| hypothetical protein MTR_7g099450 [Medicago truncatula]
Length=602

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 145/246 (59%), Gaps = 9/246 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD +   YA  YMPN E LD+SDNPIED+G+R LI Y     E   ++  L+L
Sbjct  357  RGNNLRKDDAENLGYAFAYMPNLEDLDISDNPIEDEGLRYLIPYFAGTSEMCSRLACLKL  416

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  417  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  476

Query  608  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  435
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  477  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  536

Query  434  ESLAIIGSGL---AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNV  264
            ESL+II S L    A G +  LDL+G+         S+ +++  NGK +++   SSA   
Sbjct  537  ESLSIISSALKFAKAAGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAA  596

Query  263  PYDDDP  246
            P D DP
Sbjct  597  PIDHDP  602



>ref|XP_006664439.1| PREDICTED: protein NLRC3-like [Oryza brachyantha]
Length=631

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 144/237 (61%), Gaps = 8/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSC----KIVELRLENCELT  771
            K D++      + MPN   LD+SDNPI D+G+R LI ++  +      +  LR ENC+LT
Sbjct  397  KSDIEDLCKILVKMPNLRDLDISDNPIMDEGIRFLICFISRTLWKAKSLSRLRAENCDLT  456

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
              GV  LLECLS + +P   LSI  N+LGS + A++ KF+  G+  L+I+DIGLG  GF 
Sbjct  457  NIGVTELLECLSSVSEPLNLLSISDNHLGSSVAAALAKFLGSGVRELNIEDIGLGPIGFQ  516

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
              +E +  ++ +  IN+SKNRGGI  A F+S+L   AP LV++NA  NL+P ES+ +I +
Sbjct  517  ILEEALPAEVALSHINVSKNRGGIRAAHFVSRLIRQAPVLVSVNAGSNLLPPESMEVICN  576

Query  410  GLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDDDP  246
             L  N   LE LDL GN    ++A  + L ++   GK +++ LPS      PYDDDP
Sbjct  577  VLKQNTCNLERLDLMGNMHLSDAAFPAAL-EFRKRGKQILV-LPSQPGACAPYDDDP  631



>gb|KFK40400.1| hypothetical protein AALP_AA3G368500 [Arabis alpina]
Length=602

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 155/243 (64%), Gaps = 7/243 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYS--CKIVELRLEN  783
            R N   K D +   +A ++MP+ ESLDLS NPIED G+RSLI+Y   +    + +L LEN
Sbjct  361  RGNELDKYDAENLAHALLHMPSLESLDLSGNPIEDGGIRSLISYFTKNPDSPLTDLNLEN  420

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV   L+ L  L+K    LSI  N LGSE+   I   ++  I SL+I  IGLG 
Sbjct  421  CELSCCGVIEFLDTLLTLKKSLKFLSIADNALGSEVSEGIVNSLTIAIESLNISGIGLGP  480

Query  602  SGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  426
             GF + + ++ + +K +  INISKNRGG++TA+F+SKL   AP+LV+++  +NLMP ESL
Sbjct  481  GGFLELRRKLEKGMKKLSSINISKNRGGLETARFLSKLIPLAPKLVSVDTSYNLMPPESL  540

Query  425  AIIGSGLA-ANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSS-APNVPYD  255
             ++   L    G L+ +D++GN+   +  D +S+L +++ NG+ + + LPSS   +VPYD
Sbjct  541  LMLCDSLRNTKGDLKRIDMTGNSFISHETDHSSLLGEFQHNGEPIFV-LPSSLTSHVPYD  599

Query  254  DDP  246
            D+P
Sbjct  600  DEP  602



>ref|XP_004960752.1| PREDICTED: uncharacterized protein LOC101762404 [Setaria italica]
Length=656

 Score =   172 bits (435),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 150/242 (62%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  Q+DDV       I MPN   LD+S NPI D+G+RSL+ ++ ++ +    +++LR+
Sbjct  416  RGNNLQQDDVVDLHKILIQMPNLRDLDISGNPIMDEGIRSLVPFISWAIQKENPLLKLRV  475

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LLECL+ +++P   LSI  N LGS + A + KF+   +  L+I+DI L
Sbjct  476  ENCDLSSIGVSELLECLTYVKQPLDVLSIADNPLGSSVAAVLAKFLGSHVRDLNIEDIDL  535

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G+ GF   +E +  ++ +  INISKNRGGI  A F+SKL    P LV++NA  N++P ES
Sbjct  536  GALGFQILEEALPMEVALSHINISKNRGGIRAAYFVSKLILQTPNLVSVNAAANILPPES  595

Query  428  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      LE +DL+GN    +++  + L +++ +GK +++   + +   PYDD
Sbjct  596  LEVICNTLKQRTCNLERVDLTGNFHLSSTSFPAFL-EFKKHGKPILVVPSNLSTCAPYDD  654

Query  251  DP  246
            DP
Sbjct  655  DP  656



>gb|ABA96837.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ20033.1| hypothetical protein OsJ_35632 [Oryza sativa Japonica Group]
Length=648

 Score =   172 bits (435),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 140/237 (59%), Gaps = 7/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLENCELT  771
            K D++      + MPN   LD+SDNPI D+G+R LI ++  + +    +  LR ENC+LT
Sbjct  413  KGDIEDLCKILVKMPNLRDLDISDNPIMDEGIRLLICFISRTLRKEKSLSRLRAENCDLT  472

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
              GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG G  GF 
Sbjct  473  NIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGFGPLGFQ  532

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
              +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES+ +I  
Sbjct  533  ILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPESMEVICD  592

Query  410  GLAANGK--LELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
             L       LE LDL GN    ++A  + L ++  +GK ++I         PYDDDP
Sbjct  593  VLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYDDDP  648



>gb|EEC69043.1| hypothetical protein OsI_37874 [Oryza sativa Indica Group]
Length=648

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 139/237 (59%), Gaps = 7/237 (3%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLENCELT  771
            K D++      + MPN   LD+SDNPI D G+R LI ++  + +    +  LR ENC+LT
Sbjct  413  KGDIEDLCKILVKMPNLRDLDISDNPIMDKGIRLLICFISRTLRKEKSLSRLRAENCDLT  472

Query  770  GHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFS  591
              GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG G  GF 
Sbjct  473  NIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGFGPLGFQ  532

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
              +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES+ +I  
Sbjct  533  ILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPESMEVICD  592

Query  410  GLAANGK--LELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
             L       LE LDL GN    ++A  + L ++  +GK ++I         PYDDDP
Sbjct  593  VLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYDDDP  648



>ref|XP_009405714.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009405722.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009405731.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 144/243 (59%), Gaps = 9/243 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N  QK+D +      ++MP   SLD+SDN I DDG+RSLI Y    +E S  + +++L
Sbjct  382  RGNNFQKEDAEDLHNILVHMPVLSSLDISDNAIMDDGIRSLIPYFVWAVEKSYPLSDIKL  441

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
             NC L+  GV  LL  L  L+    S S+  N LGS I A + KF+ S  +  L+I+D+ 
Sbjct  442  NNCNLSCTGVAELLRSLPTLKG---SFSVAENNLGSSIAAPLAKFLASSSVRKLNIEDVE  498

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            LG+ GF + +++I + + +  INISKNRGG+  A FI KL  Y+P +  INA  NLMP E
Sbjct  499  LGTLGFQQLEDQIPKKMALQSINISKNRGGLRAAYFIVKLLMYSPSIAYINAGGNLMPPE  558

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            S  +I   L  + GKLE LDL GN     S  AS L+++ ++G+ ++I     A + PYD
Sbjct  559  SSEVIYGALKQSQGKLETLDLGGNTQLCQSNYASRLTEFRLHGRPIVIVPLLPASSTPYD  618

Query  254  DDP  246
            DDP
Sbjct  619  DDP  621



>ref|XP_003576947.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 [Brachypodium 
distachyon]
 ref|XP_010238597.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 [Brachypodium 
distachyon]
Length=653

 Score =   166 bits (421),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 141/242 (58%), Gaps = 6/242 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QK D++        M N  SLD+SDNPI D+G+R LI + E + +    +  LR 
Sbjct  413  RGNNLQKGDMEDLCNIIAKMSNLRSLDISDNPITDEGIRFLIHFFERALQKENLLWRLRA  472

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LLECL+ + +P   LSI  NYLGS + A++ KF+   +  L+++DIGL
Sbjct  473  ENCDLSSIGVTKLLECLTSVNRPLDMLSIADNYLGSSVAAALVKFLGSHVRELNVEDIGL  532

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF   +E +  ++ +  INISKNRGGI TA FIS+L   AP LV++NA  NL+P ES
Sbjct  533  GPLGFQILEEALPREVHLSHINISKNRGGIRTAHFISRLILQAPNLVSVNAGSNLLPPES  592

Query  428  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  252
            L +I + L      L  LDL GN    +SA     S+++ +G+ +++          YD 
Sbjct  593  LEVICNALKQTTCNLVRLDLMGNVHL-SSAIFPAASEFKKHGEPILVVPSQPGACATYDA  651

Query  251  DP  246
            DP
Sbjct  652  DP  653



>emb|CDP21849.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = -3

Query  692  YLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDT  513
            YL S+IGA +GKF+SKG+ SLDIDDI LG  GF KAQ+EI+ DLK++ INISKN GGI+T
Sbjct  7    YLFSKIGALLGKFLSKGLQSLDIDDIDLGPPGFQKAQDEIMGDLKLVYINISKNYGGIET  66

Query  512  AKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNASCENSADA  336
            A F+SKL S APEL AI+A  N MP ESL+II S L A  GK+E LDL GN S    ADA
Sbjct  67   ANFLSKLISCAPELAAIDARCNSMPVESLSIICSTLKAMRGKVEHLDLRGNTSLIRFADA  126

Query  335  SVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            S+L + ++N K ++    S  P+ PYD DP
Sbjct  127  SLLDELKMNRKSILKLDSSYDPDAPYDQDP  156



>ref|XP_010540943.1| PREDICTED: protein NLRC3 isoform X2 [Tarenaya hassleriana]
Length=560

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D +   +A ++MPN E+LDLSDNPIEDDG+RSLI+Y     EY   +  L L
Sbjct  361  RGNDLNKSDAENLAHALVHMPNLETLDLSDNPIEDDGIRSLISYFTNHPEYP--LANLNL  418

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL+ LS+LEKP  SLSI  N LGS +  +IG F++  I SL+I  +GL
Sbjct  419  ENCELSCDGVIDLLDSLSLLEKPLKSLSIADNALGSGVADAIGDFLASPIQSLNISGMGL  478

Query  608  GSSGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            GS GF + Q +IV++L ++  INISKNRGG++ A+F+SKL   AP+L++ +  +NLMP+E
Sbjct  479  GSIGFLELQRKIVKELMMLLNINISKNRGGLEAARFLSKLIPLAPKLLSADTSYNLMPSE  538

Query  431  SLAIIGSGLAAN  396
            SL+++ + L + 
Sbjct  539  SLSLLCTSLKST  550



>gb|ERN15812.1| hypothetical protein AMTR_s00039p00144340 [Amborella trichopoda]
Length=647

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 143/243 (59%), Gaps = 6/243 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N    +  +C +Y  I+ P  +SLD+S+NPI DDG+  L+       E  C +V++++
Sbjct  405  RGNNLGTEHAECLKYLLIHTPQLQSLDISENPIGDDGIGILVPSFKEASERPCPLVDIKV  464

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKG-ILSLDIDDIG  612
            +NC+L+  G    L+  S      T+LSI  NYLGS     +G F+    I  LDI+ IG
Sbjct  465  DNCDLSSVGATQFLDIFSTSCGHLTALSIAYNYLGSRAVIPLGNFLEASCIRRLDIEAIG  524

Query  611  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  432
            L  SG +   + +  +L++  IN+SKNRGGI T+ F+S+L   +P+L++++A +N +P E
Sbjct  525  LDCSGLTDFAKALPSNLELAHINLSKNRGGIGTSTFVSQLILRSPDLLSVDASYNFVPQE  584

Query  431  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  255
            SL +I + L  + GKL+ LDL+GN     S  AS+  +++  G+ V++   S  P V YD
Sbjct  585  SLPLIHAALRQSKGKLKRLDLTGNPGLCQSKIASMFDEFQNMGEPVVLFPSSPIPRVSYD  644

Query  254  DDP  246
            DDP
Sbjct  645  DDP  647



>ref|XP_011627038.1| PREDICTED: uncharacterized protein LOC18444105, partial [Amborella 
trichopoda]
Length=616

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 144/244 (59%), Gaps = 7/244 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGV-RSLITYL----EYSCKIVELR  792
            R N    +  +C +Y  I+ P  +SLD+S+NPI DDG+ R L+       E  C +V+++
Sbjct  373  RGNNLGTEHAECLKYLLIHTPQLQSLDISENPIGDDGIGRILVPSFKEASERPCPLVDIK  432

Query  791  LENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKG-ILSLDIDDI  615
            ++NC+L+  G    L+  S      T+LSI  NYLGS     +G F+    I  LDI+ I
Sbjct  433  VDNCDLSSVGATQFLDIFSTSCGHLTALSIAYNYLGSRAVIPLGNFLEASCIRRLDIEAI  492

Query  614  GLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  435
            GL  SG +   + +  +L++  IN+SKNRGGI T+ F+S+L   +P+L++++A +N +P 
Sbjct  493  GLDCSGLTDFAKALPSNLELAHINLSKNRGGIGTSTFVSQLILRSPDLLSVDASYNFVPQ  552

Query  434  ESLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPY  258
            ESL +I + L  + GKL+ LDL+GN     S  AS+  +++  G+ V++   S  P V Y
Sbjct  553  ESLPLIHAALRQSKGKLKRLDLTGNPGLCQSKIASMFDEFQNMGEPVVLFPSSPIPRVSY  612

Query  257  DDDP  246
            DDDP
Sbjct  613  DDDP  616



>gb|EMT06714.1| Protein NLRC3 [Aegilops tauschii]
Length=693

 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 131/241 (54%), Gaps = 25/241 (10%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  Q+ D++        M N  SLD+SDNPI D+G+R LI + E + +    I +LR 
Sbjct  474  RGNNLQEGDMEVVCNILAKMSNLRSLDISDNPITDEGIRYLIPFFELALQRGNPIRKLRA  533

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LLECL+ + KP   LSI  N+LGS + A++ KF+   +  L+++DIGL
Sbjct  534  ENCDLSSIGVTKLLECLAPINKPLDMLSIADNHLGSSVAATLVKFLGSHVRELNVEDIGL  593

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF   +E +   + +  INISKNRGG+ TA F+S+L   AP L+++NA  NL+P ES
Sbjct  594  GPIGFQILEEALPRKVNLSHINISKNRGGMGTAHFVSRLILQAPNLISVNAGSNLLPPES  653

Query  428  LAIIGSGLAANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDD  249
            L +I + L      E                     ++  GK +++         PYD D
Sbjct  654  LEVICNALKQTTFFE---------------------FKKRGKPILLVPSQQGSCAPYDAD  692

Query  248  P  246
            P
Sbjct  693  P  693



>gb|EMS58433.1| Protein NLRC3 [Triticum urartu]
Length=628

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 119/196 (61%), Gaps = 4/196 (2%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  Q+ D++      + M N  SLD+SDNPI D+G+R LI + E + +    I +LR 
Sbjct  379  RGNNLQEGDMEVVCNILVKMSNLRSLDISDNPITDEGIRYLIPFFELALQRGNPIRKLRA  438

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENC+L+  GV  LLECL+ + K    LSI  N+LGS + A++ KF+   +  L+++DIGL
Sbjct  439  ENCDLSSVGVTKLLECLTSINKLLDMLSIADNHLGSSVAATLVKFLGSHVRELNVEDIGL  498

Query  608  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  429
            G  GF   +E +   + +  INISKNRGG+ TA FIS+L   AP LV+++A  NL+P ES
Sbjct  499  GPIGFQILEEALPRKVNLSHINISKNRGGMGTAHFISRLIVQAPNLVSVDAGSNLLPPES  558

Query  428  LAIIGSGLAANGKLEL  381
            L +I + L      E 
Sbjct  559  LEVICNALKQTTLFEF  574



>gb|KDO65821.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
Length=295

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = -3

Query  683  SEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKF  504
            S I AS+GKF    +  L+I  IGLGSSGF   Q+ + ++LK++ INISKNRGG++TAKF
Sbjct  149  SHIAASLGKFFGTSVQVLNIGAIGLGSSGFRVLQDGVTKELKLVNINISKNRGGVETAKF  208

Query  503  ISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNASCENSADASVL  327
            +SKL   APELV +NA +NLMP ESL II S L  A G L+ LDL+GN      +  S+L
Sbjct  209  LSKLMPLAPELVEVNAGYNLMPLESLTIICSALKVAKGHLQRLDLTGNNWELQPSHVSML  268

Query  326  SKYEINGKLVIIDLPS-SAPNVPYDDDP  246
            S++  NG L I+ LP+  A +VPYDD+P
Sbjct  269  SEFRHNG-LPILILPTLQALDVPYDDEP  295



>ref|XP_006480175.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X5 [Citrus sinensis]
Length=507

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = -3

Query  683  SEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKF  504
            S I AS+GKF    +  L+I  IGLGSSGF   Q+ + ++LK++ INISKNRGG++TAKF
Sbjct  361  SHIAASLGKFFGTSVQVLNIGAIGLGSSGFRVLQDGVTKELKLVNINISKNRGGVETAKF  420

Query  503  ISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNASCENSADASVL  327
            +SKL S AP+LV +NA +NLMP ESL II S L  A G L+ LDL+GN      +  S+L
Sbjct  421  LSKLMSLAPDLVEVNAGYNLMPLESLTIICSALKVAKGHLQRLDLTGNNWELQPSHVSML  480

Query  326  SKYEINGKLVIIDLPS-SAPNVPYDDDP  246
            S++  NG L I+ LP+  A +VPYDD+P
Sbjct  481  SEFRHNG-LPILILPTLQALDVPYDDEP  507



>ref|XP_007151779.1| hypothetical protein PHAVU_004G074200g, partial [Phaseolus vulgaris]
 gb|ESW23773.1| hypothetical protein PHAVU_004G074200g, partial [Phaseolus vulgaris]
Length=170

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 103/166 (62%), Gaps = 9/166 (5%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLSI  702
            L++SDN IE     +  T+   SC    L+LENC+L+  GV  LL  LS  + P   L I
Sbjct  2    LNISDNSIEMKE-SAFDTFFSISC----LKLENCDLSYVGVNHLLHVLSSFKGPLKFLFI  56

Query  701  GSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGG  522
              NYLG +    I  F+   I  LDI  IGLGS GF + Q  I E+LK++ INISKNRGG
Sbjct  57   ADNYLG-KFHWEI--FLVPTIEVLDIGGIGLGSYGFQELQNLIKEELKLVKINISKNRGG  113

Query  521  IDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLA-ANGKL  387
            I+TAKF+SKL S AP+LV +NA  NLMP ESLAI+ S L  A G L
Sbjct  114  IETAKFLSKLLSQAPQLVEVNAASNLMPIESLAIVYSALKFAKGML  159



>ref|XP_011659160.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5 isoform 
X2 [Cucumis sativus]
Length=506

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E +C   +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDMSDNPIEDDGIRNLIPYFIEASERNCPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINI  540
            G  GF    E +     I+ INI
Sbjct  483  GPCGFQDLVEGVTAGSNIVNINI  505



>ref|XP_010652450.1| PREDICTED: uncharacterized protein LOC100261775 isoform X3 [Vitis 
vinifera]
Length=517

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   KDD D  +YA IYMPN E LDLSDNPIEDDG+ SLI Y     E    + +L L
Sbjct  379  RGNNLCKDDADSLKYALIYMPNLEILDLSDNPIEDDGISSLIPYFVEASERHSPLADLSL  438

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
             +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGL
Sbjct  439  GDCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGL  498

Query  608  GSSGFSKAQEEIVEDLK  558
            GSSGF K QE++ E+ K
Sbjct  499  GSSGFLKLQEDMPEEQK  515



>ref|XP_008461991.1| PREDICTED: leucine-rich repeat-containing protein 16A isoform 
X2 [Cucumis melo]
Length=506

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E S    +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDISDNPIEDDGIRNLIPYFIEASERSFPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  608  GSSGFSKAQEEIVEDLKIICINI  540
            G  GF    E + E   I+ INI
Sbjct  483  GPCGFQDLVEGVTEGSNIVNINI  505



>gb|KJB42372.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=502

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 4/141 (3%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLEN  783
            N  QKDD    RY  + MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L +
Sbjct  293  NNLQKDDAGNLRYVLVQMPSLEILDLSDNPIEDDGIRSLIPYFAEASKSCSPLTDLNLGS  352

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGS  603
            CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG 
Sbjct  353  CELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLGP  412

Query  602  SGFSKAQEEIVEDLKIICINI  540
            SGF K ++  +E+LK++ +NI
Sbjct  413  SGFRKLRDIRMENLKLVKLNI  433



>ref|XP_008652837.1| PREDICTED: uncharacterized protein LOC103632898 [Zea mays]
Length=149

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 0/134 (0%)
 Frame = -3

Query  806  IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLD  627
            ++ L +ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+
Sbjct  9    LLRLTVENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVQALN  68

Query  626  IDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFN  447
               IGLG+ GF   +E +  ++ +  INISKNRGGI  A F+SKL   AP LV+INA  N
Sbjct  69   ATYIGLGTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSKLICQAPNLVSINATGN  128

Query  446  LMPAESLAIIGSGL  405
            L+P ESL +I + L
Sbjct  129  LLPPESLEVICNSL  142



>gb|EYU17964.1| hypothetical protein MIMGU_mgv1a0245892mg, partial [Erythranthe 
guttata]
Length=372

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 89/132 (67%), Gaps = 9/132 (7%)
 Frame = -3

Query  935  DDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVK  756
            DD +C + A ++MPN E+LDLSDN IE  G R L           +L+LENCELT   V 
Sbjct  250  DDANCLKQALLHMPNLENLDLSDNYIEG-GFREL--------PFADLKLENCELTCDQVI  300

Query  755  CLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEE  576
             LL  LS ++KP   LSI  N LGS+IG S+G+++  G+ ++DI+DIGLGSSGF +A +E
Sbjct  301  ELLGVLSTMKKPLNLLSIKGNRLGSKIGVSLGEYLRSGVCAVDIEDIGLGSSGFREALKE  360

Query  575  IVEDLKIICINI  540
            I ++LKI+ INI
Sbjct  361  ISKELKIVYINI  372



>tpg|DAA54821.1| TPA: hypothetical protein ZEAMMB73_341952 [Zea mays]
Length=166

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRL  789
            R N  QKDDV       I MPN   LD+S NP+ D+G+RSLI ++ +S +    ++ L +
Sbjct  10   RENNLQKDDVVDLHKILIKMPNLRDLDISGNPVMDEGIRSLIPFISWSIQKENPLLRLTV  69

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  70   ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  129

Query  608  GSSGFSKAQEEIVEDLKIICINI  540
            G+ GF   +E +  ++ +  INI
Sbjct  130  GTVGFQILEETLPTEVALSHINI  152



>ref|XP_008673554.1| PREDICTED: uncharacterized protein LOC103649591 [Zea mays]
Length=151

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -3

Query  806  IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLD  627
            ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+
Sbjct  11   LLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALN  70

Query  626  IDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFN  447
              DIGLG+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  N
Sbjct  71   ATDIGLGTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNLVSVNAAGN  130

Query  446  LMPAESLAIIG  414
            L    ++ +IG
Sbjct  131  LWTLCNMCMIG  141



>ref|XP_008664178.1| PREDICTED: uncharacterized protein LOC103642767 [Zea mays]
Length=231

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = -3

Query  800  ELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDID  621
            +L +ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  
Sbjct  9    QLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNAT  68

Query  620  DIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLM  441
            DIGLG+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA +NL 
Sbjct  69   DIGLGTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNLVSVNAAWNLW  128



>gb|EYU17965.1| hypothetical protein MIMGU_mgv1a0245891mg, partial [Erythranthe 
guttata]
Length=99

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = -3

Query  533  NRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNAS  357
            N+GGI+ A+FIS L ++A ++ AI+A +NLMP ESL++I +GL A+ G LE LDLSGN+ 
Sbjct  2    NQGGIEAARFISSLVTHAHKITAIDARYNLMPTESLSVISAGLRASKGTLEHLDLSGNSL  61

Query  356  CENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  246
            C+   D ASVL+++ I+G   +    S+APNVPYD+DP
Sbjct  62   CDQLVDEASVLAEFRIHGHCPLNISLSAAPNVPYDNDP  99



>ref|XP_011659161.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5 isoform 
X3 [Cucumis sativus]
Length=474

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E +C   +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDMSDNPIEDDGIRNLIPYFIEASERNCPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKF  654
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS    S G+F
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSR---SFGRF  464



>ref|XP_008664260.1| PREDICTED: uncharacterized protein LOC103642868 [Zea mays]
Length=125

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -3

Query  806  IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLD  627
            ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+
Sbjct  11   LLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALN  70

Query  626  IDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPEL  471
              DIGLG+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP L
Sbjct  71   ATDIGLGTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNL  122



>ref|XP_008461992.1| PREDICTED: uncharacterized protein LOC103500467 isoform X3 [Cucumis 
melo]
Length=488

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 75/129 (58%), Gaps = 10/129 (8%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E S    +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDISDNPIEDDGIRNLIPYFIEASERSFPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  609
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS    S G+F  +   + +     L
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSR---SFGRFHGEIHSNTECRRHWL  479

Query  608  GS---SGFS  591
            GS   SGFS
Sbjct  480  GSMRVSGFS  488



>emb|CDP20991.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            RNN  Q+DDVD  +YA + MP  ESLDLSDNPIEDDG+++++ Y     E    +++L+L
Sbjct  382  RNNNLQRDDVDFLKYALVCMPKLESLDLSDNPIEDDGIKNMMPYFVEMSEKPFSLIDLKL  441

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM  651
              CELT + V  LL  LS  +KP  SLSIG N LG  +G +   F+
Sbjct  442  GQCELTFNSVSQLLNVLSRWKKPLISLSIGENNLGRFVGMNFHAFI  487



>ref|XP_008461993.1| PREDICTED: uncharacterized protein LOC103500467 isoform X4 [Cucumis 
melo]
Length=487

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E S    +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDISDNPIEDDGIRNLIPYFIEASERSFPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMS  648
            ENCEL+  GV  LL  LS L KP  SLS+  N LG   G   G+  S
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGRSFGRFHGEIHS  469



>ref|XP_008461994.1| PREDICTED: uncharacterized protein LOC103500467 isoform X5 [Cucumis 
melo]
Length=458

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N  +KDD D  RYA  ++PN E LD+SDNPIEDDG+R+LI Y     E S    +L L
Sbjct  363  RGNGLKKDDADNLRYALFHIPNLEFLDISDNPIEDDGIRNLIPYFIEASERSFPFADLNL  422

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLG  684
            ENCEL+  GV  LL  LS L KP  SLS+  N LG
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLG  457



>ref|XP_001751929.1| predicted protein [Physcomitrella patens]
 gb|EDQ83364.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 24/235 (10%)
 Frame = -3

Query  899  MPNXESLDLSDNPIEDDGVRSLITYLEYS-CKIVELRLENCELTGHGVKCLLECLSVLEK  723
            MP+ + LD+SDNP+ED G+R L+ Y+  S   + EL L +C++T      +L  LS  + 
Sbjct  57   MPSLQQLDVSDNPLEDAGIRLLVPYISNSLTALKELSLASCQMTATSAIVMLNALSNSQT  116

Query  722  PPTSLSIGSNYLGSEIGASIGKFMSKGIL-SLDIDDIGLGSSGFSKA-QEEIVEDLKIIC  549
                LS+  N LGS +  S+ +F+ K  L +LD+ DI LG +G S   +E ++ +  ++ 
Sbjct  117  TLRRLSLAGNSLGSTVVQSLAQFLRKCPLENLDVSDIDLGPTGCSDVLKETLITNGTLLH  176

Query  548  INISKNR-GGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLA-------ANG  393
            I+ISKNR  G+      S + +    L +INA  NL+ +ES+  I   +        + G
Sbjct  177  IDISKNRICGLGAVMLASIISAGTSRLTSINASANLLSSESIQHIAKNIQNSKTYVESTG  236

Query  392  KLELLDLSGNASCENSADASVLSKYE-INGK-----LVIIDLPSSAPNVPYDDDP  246
            +   LDL  N         S L K   ++G+     +++ D      +V +DDDP
Sbjct  237  RSISLDLRNNP-------GSFLCKLAGLHGRVGACTVLLSDSSCETHSVLHDDDP  284



>gb|KDO65823.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
 gb|KDO65824.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
 gb|KDO65825.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
 gb|KDO65826.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
 gb|KDO65827.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
Length=250

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL----EYSCKIVELRL  789
            R N   K D      A +++PN E LD+SDN IEDDG+RSLI Y     E    +VEL L
Sbjct  149  RGNNLCKADARDLGSALVHIPNLEILDISDNTIEDDGIRSLIPYFVQASERCNPLVELYL  208

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLG  684
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LG
Sbjct  209  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLG  243



>ref|XP_009405738.1| PREDICTED: protein NLRC3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=523

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 84/144 (58%), Gaps = 8/144 (6%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITY----LEYSCKIVELRL  789
            R N  QK+D +      ++MP   SLD+SDN I DDG+RSLI Y    +E S  + +++L
Sbjct  382  RGNNFQKEDAEDLHNILVHMPVLSSLDISDNAIMDDGIRSLIPYFVWAVEKSYPLSDIKL  441

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  612
             NC L+  GV  LL  L  L+    S S+  N LGS I A + KF+ S  +  L+I+D+ 
Sbjct  442  NNCNLSCTGVAELLRSLPTLKG---SFSVAENNLGSSIAAPLAKFLASSSVRKLNIEDVE  498

Query  611  LGSSGFSKAQEEIVEDLKIICINI  540
            LG+ GF + +++I + + +  INI
Sbjct  499  LGTLGFQQLEDQIPKKMALQSINI  522



>ref|XP_002964411.1| hypothetical protein SELMODRAFT_405633 [Selaginella moellendorffii]
 gb|EFJ34744.1| hypothetical protein SELMODRAFT_405633 [Selaginella moellendorffii]
Length=572

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 122/227 (54%), Gaps = 11/227 (5%)
 Frame = -3

Query  899  MPNXESLDLSDNPIEDDGVRSLITYLEYSCK-IVELRLENCELTGHGVKCLLECLSVLEK  723
            +P+  +L+LSDNP+ D+G++S+   L+ S   ++EL +  CEL+ +G+  LL+ L     
Sbjct  348  LPHLHTLNLSDNPVADEGIKSVACCLQTSLSALMELNVAGCELSWNGLSSLLDSLVSTNH  407

Query  722  PPTSLSIGSNYLGSEIGASIGKFMSK-GILSLDIDDIGLGSSGF-SKAQEEIVEDLKIIC  549
               SLS+  N  G    A + K++ K  +  LDI +IGLGS G  S+    ++++  +  
Sbjct  408  RLRSLSVADNSFGRSGSAVLAKYLQKSAVKELDISEIGLGSLGCSSELASALIQNQTLEH  467

Query  548  INISKNRGGIDTAKFISKLFSYAPELVA-INAEFNLMPAESLAIIGSGL----AANGKLE  384
            +NISKNR     A+ +  + S    ++  INA FNL+  E++  + S L    A  G+++
Sbjct  468  LNISKNRIAFPGAELLHAVISKGQGVLTDINASFNLLNVEAMKRLASALQTKAALGGRMK  527

Query  383  LLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP-YDDDP  246
             LDL GN        A++   +   G   I+ L SS   VP +DDDP
Sbjct  528  RLDLLGNPGIP-PPGANLFGSFS-EGPDAIVLLSSSQFYVPLHDDDP  572



>ref|XP_008661204.1| PREDICTED: uncharacterized protein LOC103640392 [Zea mays]
Length=156

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 75/125 (60%), Gaps = 6/125 (5%)
 Frame = -3

Query  878  DLSDNP--IEDDGVRSLITYLEYSCK----IVELRLENCELTGHGVKCLLECLSVLEKPP  717
            DL++ P    +D  RSLI ++ +S +    ++ L +ENCEL+  GV  LLECL+ +++  
Sbjct  30   DLTEYPSVFYNDQYRSLIPFISWSIQKENPLLRLTVENCELSSIGVITLLECLTNVKQLL  89

Query  716  TSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINIS  537
              LSI  N+LGS + A++ +F+   + +L   DIGLG  GF   +E +  ++ +  INIS
Sbjct  90   DVLSIADNHLGSSMAAALARFLGSHVRALTATDIGLGIVGFQTLEETLPTEVALSHINIS  149

Query  536  KNRGG  522
            KN  G
Sbjct  150  KNLVG  154



>gb|KJB42371.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=393

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLEN  783
            N  QKDD    RY  + MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L +
Sbjct  293  NNLQKDDAGNLRYVLVQMPSLEILDLSDNPIEDDGIRSLIPYFAEASKSCSPLTDLNLGS  352

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIG  660
            CEL+  GV  LL+ LS L +P  SLS+  N LG  +   + 
Sbjct  353  CELSSDGVILLLDVLSTLARPLNSLSLADNGLGRFVWTVLA  393



>gb|KJB42370.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=465

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -3

Query  950  NXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCK----IVELRLEN  783
            N  QKDD    RY  + MP+ E LDLSDNPIEDDG+RSLI Y   + K    + +L L +
Sbjct  365  NNLQKDDAGNLRYVLVQMPSLEILDLSDNPIEDDGIRSLIPYFAEASKSCSPLTDLNLGS  424

Query  782  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIG  660
            CEL+  GV  LL+ LS L +P  SLS+  N LG  +   + 
Sbjct  425  CELSSDGVILLLDVLSTLARPLNSLSLADNGLGRFVWTVLA  465



>ref|XP_010069681.1| PREDICTED: uncharacterized protein LOC104456563 isoform X2 [Eucalyptus 
grandis]
Length=470

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = -3

Query  956  RNNXXQKDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYL-EYSCK---IVELRL  789
            R N   K+D D  R+A  +MP    LDLSDNPIEDDG+R LI +L E S K   + +L L
Sbjct  362  RGNNLHKEDADNLRHALAHMPALRKLDLSDNPIEDDGLRHLIPFLVEASGKGFTLADLSL  421

Query  788  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIG  672
            ENCEL+ +GV   L  LS  + P +SLSI  N LG  +G
Sbjct  422  ENCELSSNGVIEFLTTLSTSDIPLSSLSISDNSLGRSLG  460



>gb|AFW59093.1| hypothetical protein ZEAMMB73_800081 [Zea mays]
Length=821

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = -3

Query  854  DDGVRSLITYLEYSCK----IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYL  687
            D+G+RSLI ++ +S +    ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+L
Sbjct  408  DEGIRSLIPFMSWSIQKENPLLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHL  467

Query  686  GSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAK  507
            GS + A++ +F+   + +L+  DIGLG+ GF   +E +  ++ +  INISK    +DT K
Sbjct  468  GSPVAAALARFLGSHVRALNATDIGLGTVGFQILEETLPTEVALSHINISK----VDTLK  523



>tpg|DAA52872.1| TPA: putative RNA helicase family protein [Zea mays]
Length=911

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  854  DDGVRSLITYLEYSCK----IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYL  687
            D+G+RSLI ++ +S +    ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+L
Sbjct  111  DEGIRSLIPFMSWSIQKENPLLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHL  170

Query  686  GSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRG  525
            GS + A++ +F+   + +L+  DIGLG+ GF   +E +  ++ +  INIS + G
Sbjct  171  GSPVAAALARFLGSHVRALNATDIGLGTVGFQILEETLPTEVALSHINISVSLG  224



>tpg|DAA52871.1| TPA: putative RNA helicase family protein [Zea mays]
Length=484

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  854  DDGVRSLITYLEYSCK----IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYL  687
            D+G+RSLI ++ +S +    ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+L
Sbjct  111  DEGIRSLIPFMSWSIQKENPLLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHL  170

Query  686  GSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRG  525
            GS + A++ +F+   + +L+  DIGLG+ GF   +E +  ++ +  INIS + G
Sbjct  171  GSPVAAALARFLGSHVRALNATDIGLGTVGFQILEETLPTEVALSHINISVSLG  224



>tpg|DAA52873.1| TPA: putative RNA helicase family protein [Zea mays]
Length=940

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  854  DDGVRSLITYLEYSCK----IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYL  687
            D+G+RSLI ++ +S +    ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+L
Sbjct  111  DEGIRSLIPFMSWSIQKENPLLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHL  170

Query  686  GSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRG  525
            GS + A++ +F+   + +L+  DIGLG+ GF   +E +  ++ +  INIS + G
Sbjct  171  GSPVAAALARFLGSHVRALNATDIGLGTVGFQILEETLPTEVALSHINISVSLG  224



>gb|AFW59095.1| hypothetical protein ZEAMMB73_800081 [Zea mays]
Length=404

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -3

Query  806  IVELRLENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLD  627
            ++ L +ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+
Sbjct  11   LLRLTVENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALN  70

Query  626  IDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAK  507
              DIGLG+ GF   +E +  ++ +  INISK    +DT K
Sbjct  71   ATDIGLGTVGFQILEETLPTEVALSHINISK----VDTLK  106



>emb|CCW67258.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=726

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 102/195 (52%), Gaps = 19/195 (10%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS-  705
            LDLSDN + DDGV+S+   L+ +  IV + L + +++  GV       S LE   T +S 
Sbjct  167  LDLSDNYLRDDGVKSIGELLQVNRTIVHVGLSSNDMSYKGV---FAIASALEDNKTVISL  223

Query  704  -------IGSNYLGSEIGASIGKFM--SKGILSLDIDDIGLGSSGFSKAQEEIVEDLKII  552
                   + +N++GS+   ++GK +  +K +  L++   GLG+SG S  Q  ++++  + 
Sbjct  224  DLGAKSGVNANHIGSQGAEALGKLLKVNKVLSRLNLGSNGLGASGLSFFQSSLIDNTTLT  283

Query  551  CINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAA---NGK--L  387
             +N++ N  G D A+ ++++      LV ++ E N +      II   + +   NG+  L
Sbjct  284  HLNLNSNNLGRDGARILAEILE-CGRLVHLSLERNALTDIGGHIIIQAIHSAIRNGECLL  342

Query  386  ELLDLSGNASCENSA  342
            E LDL  N   E+SA
Sbjct  343  EHLDLKNNGLGEHSA  357



>ref|XP_010887134.1| PREDICTED: protein NLRC3 isoform X2 [Esox lucius]
Length=1133

 Score = 63.9 bits (154),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 51/206 (25%), Positives = 100/206 (49%), Gaps = 4/206 (2%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            S++L +N IE++G R+L   L   CK+V L ++   +   G K L E L    +  T L 
Sbjct  794  SINLQNNLIEEEGARALADVLLSKCKLVSLNVQKNCIGPDGAKRLAEALKT-NRTLTELI  852

Query  704  IGSNYLGSEIGASIGKFMS--KGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
            + SN LG +  A++ + ++    +LSL +    + + G +   + +  +  +IC+N+ +N
Sbjct  853  LCSNQLGDKGTAALAQALTVNHSLLSLHLQSNSISNKGMTALTKALRLNRGLICLNLREN  912

Query  530  RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCE  351
              G++ AK +++       L  ++   NL+  E +  I   +  N  L  L L  N   +
Sbjct  913  SIGVEGAKDMARALQENSTLQDLDLTANLLHDEGVKAIAGAVKVNRALTSLHLQWNF-IK  971

Query  350  NSADASVLSKYEINGKLVIIDLPSSA  273
            ++A  ++      N  + ++DL  +A
Sbjct  972  STATKALAHALLTNATMKLLDLQENA  997



>ref|XP_010887131.1| PREDICTED: protein NLRC3 isoform X1 [Esox lucius]
 ref|XP_010887132.1| PREDICTED: protein NLRC3 isoform X1 [Esox lucius]
 ref|XP_010887133.1| PREDICTED: protein NLRC3 isoform X1 [Esox lucius]
Length=1134

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 51/206 (25%), Positives = 100/206 (49%), Gaps = 4/206 (2%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            S++L +N IE++G R+L   L   CK+V L ++   +   G K L E L    +  T L 
Sbjct  795  SINLQNNLIEEEGARALADVLLSKCKLVSLNVQKNCIGPDGAKRLAEALKT-NRTLTELI  853

Query  704  IGSNYLGSEIGASIGKFMS--KGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
            + SN LG +  A++ + ++    +LSL +    + + G +   + +  +  +IC+N+ +N
Sbjct  854  LCSNQLGDKGTAALAQALTVNHSLLSLHLQSNSISNKGMTALTKALRLNRGLICLNLREN  913

Query  530  RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCE  351
              G++ AK +++       L  ++   NL+  E +  I   +  N  L  L L  N   +
Sbjct  914  SIGVEGAKDMARALQENSTLQDLDLTANLLHDEGVKAIAGAVKVNRALTSLHLQWNF-IK  972

Query  350  NSADASVLSKYEINGKLVIIDLPSSA  273
            ++A  ++      N  + ++DL  +A
Sbjct  973  STATKALAHALLTNATMKLLDLQENA  998



>gb|EPS66692.1| hypothetical protein M569_08084, partial [Genlisea aurea]
Length=270

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 9/85 (11%)
 Frame = -3

Query  938  KDDVDCFRYAQIYMPNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGV  759
            KDD+ C ++A   +P+ ESLDLS N +ED G+R            ++L+LENC+LT   V
Sbjct  195  KDDIYCLKHALHCLPDLESLDLSRNVVED-GIRDR--------PFLDLKLENCDLTCDHV  245

Query  758  KCLLECLSVLEKPPTSLSIGSNYLG  684
              LLE L+ L+KP   LS+  N LG
Sbjct  246  VELLEVLTKLKKPLNRLSLNGNRLG  270



>gb|KFH74161.1| hypothetical protein MVEG_01374 [Mortierella verticillata NRRL 
6337]
Length=522

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 109/235 (46%), Gaps = 34/235 (14%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            +L+L+DN I  DG ++L   L+ +  +  L LE+ E+   G + L E L       T+L+
Sbjct  252  TLNLADNEIGSDGAQALSEALKTNSTLTTLNLEDNEIGSDGAQALSEALKT-NSTLTTLN  310

Query  704  IGSNYLGS------------------------EIGASIGKFMSK------GILSLDIDDI  615
            +  N +GS                        EIG++  + +S+       +++L+++D 
Sbjct  311  LEDNEIGSDGAQALSEALKTNSTLTALILEDNEIGSNGAQVLSEALKTNSALITLNLEDN  370

Query  614  GLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  435
             +GS+G     E +  +  +I +N+ +N  G D A+ +S+       L  +N E N + +
Sbjct  371  SIGSNGAQALSEALKTNSTLISLNLEENEIGSDGAQALSEALKTNSTLTTLNLEENDIGS  430

Query  434  ESLAIIGSGLAANGKLELLDLSGNASCENSADASVLSK-YEINGKLVIIDLPSSA  273
            +   ++   L  N  L  L+L  N+   N A A  LS+  + N  L  +DL S++
Sbjct  431  DGAQVLSEALKTNSALITLNLEDNSIGSNGAQA--LSEILKTNLTLSTLDLRSNS  483



>ref|WP_010302754.1| hypothetical protein [Candidatus Odyssella thessalonicensis]
Length=301

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 94/209 (45%), Gaps = 3/209 (1%)
 Frame = -3

Query  896  PNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPP  717
            P+  SLDLSDNP+  + ++ L  Y++ +  +  L+L +  LT  G+K LLE L   +   
Sbjct  36   PSLRSLDLSDNPLSLESIKGLAAYIKSNKNLKTLKLNSVSLTPEGLKILLEALKETQS-L  94

Query  716  TSLSIGSNYLGSEIGASIGK-FMSKGIL-SLDIDDIGLGSSGFSKAQEEIVEDLKIICIN  543
              LS+  N LG E     G+ F     L  L++    +G  G     E       +  ++
Sbjct  95   RHLSLKCNTLGPEGIKVFGESFTGSTFLERLNLASNNIGPEGIKVFVESFTGITFLKHLS  154

Query  542  ISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGN  363
            ++ N+ G +  K ++ L    P L  ++   N +  + +  + + L  N KL+ L+L+ N
Sbjct  155  LASNKIGPEGIKSLADLLMNNPSLTRLDVSMNKLQYKGMPSLATALKVNTKLQYLNLATN  214

Query  362  ASCENSADASVLSKYEINGKLVIIDLPSS  276
               +      +      N  L  +DL S+
Sbjct  215  NIYDEGVKILIQQGLTDNFTLTYLDLSSN  243



>ref|XP_004346272.1| hypothetical protein CAOG_05599 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95110.1| hypothetical protein CAOG_005599 [Capsaspora owczarzaki ATCC 
30864]
Length=370

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 94/206 (46%), Gaps = 9/206 (4%)
 Frame = -3

Query  935  DDVDCFRYAQIYM--PNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHG  762
            DD D    A+     PN E L+L  N I D G R++   L+ +  + ELRL   ++   G
Sbjct  11   DDADAQAIAEGLKGNPNVEKLNLGWNQIGDAGARAIAETLKLNMTVTELRLTKNQIGDAG  70

Query  761  VKCLLECLSVLEKPPTSLSIGSNYLGSEIGA---SIGKFMSKGILSLDIDDIGLGSSGFS  591
             + + E L V     T L +  N +G + GA   S    ++K ++ +D++   +G +G  
Sbjct  71   ARAIAETLRV-NTTVTDLGLWKNQIG-DAGAHALSAALKVNKTLIKIDLNGNQVGDAGAQ  128

Query  590  KAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGS  411
               E +  +  +  +++  N+ G   A  I+++      L ++  ++N +       +  
Sbjct  129  AIAEMLRVNTTVTRLSLYNNKLGDAGATTIAEMLQVNKILTSLGLDYNQIGDAGANAVAE  188

Query  410  GLAANGKLELLDLS--GNASCENSAD  339
             L  N  L+ LDL   GNA+ +  A+
Sbjct  189  ALKVNTSLQALDLGKIGNAAAQTMAE  214



>emb|CCW59765.1| unnamed protein product [Phytomonas sp. isolate EM1]
Length=728

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 100/197 (51%), Gaps = 19/197 (10%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS-  705
            LDLSDN + D+G +S+   L  +  +V + L + +++  G   +    S LE   T +S 
Sbjct  168  LDLSDNYLRDEGAQSIGELLRVNRTLVHVGLSSNDISHKGASAIA---SALEDNKTVVSL  224

Query  704  -------IGSNYLGSEIGASIGKFMS-KGILS-LDIDDIGLGSSGFSKAQEEIVEDLKII  552
                   + +N++GS+   ++GK +    +LS LD+   GLG SG S     ++E+  + 
Sbjct  225  DLGARSGVNANHIGSQGAEALGKLLKVNQVLSKLDLGSNGLGPSGLSFLASSLIENNTLT  284

Query  551  CINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAA---NGK--L  387
             +N+S N  G D A+ ++K+      LV ++ E N +      +I   + +   NG+  L
Sbjct  285  HLNLSSNNLGRDGARILAKILECC-RLVHLSLERNALTDVGGHLIIQAIHSAMRNGESLL  343

Query  386  ELLDLSGNASCENSADA  336
            + LDL  N+  E+SA A
Sbjct  344  KYLDLKNNSLGEHSAKA  360



>ref|XP_005535850.1| probable Ran GTPase activating protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79564.1| probable Ran GTPase activating protein [Cyanidioschyzon merolae 
strain 10D]
Length=489

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 6/106 (6%)
 Frame = -3

Query  896  PNXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPP  717
            P    LD++DN I  DG ++L   LE    + EL L +C LT  G +C+LE L    + P
Sbjct  249  PTLRRLDMTDNVIGKDGAKALAQLLEQQTHLEELYLRDCLLTDAGARCILEALMRQTEQP  308

Query  716  TSLSI---GSNYLGSEIGASIGKFM---SKGILSLDIDDIGLGSSG  597
                +   G+  +G+  G+ +GKF+   +  +  L +D+  LG  G
Sbjct  309  RLRVLDLSGNELIGAATGSLLGKFLEHCAPTLTHLRLDENELGDGG  354



>ref|XP_006782761.1| PREDICTED: leucine-rich repeat-containing protein 16C-like [Neolamprologus 
brichardi]
Length=1815

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 102/209 (49%), Gaps = 27/209 (13%)
 Frame = -3

Query  887  ESLDLSDNPIEDDGVRSLITYLEYSCK-IVELRLENCELTGHGVKCLLECLSVLEKPPTS  711
            +S++LS NPIED GV +L   LE   K +  L L    +T  G+ CL + LS  ++  TS
Sbjct  234  QSINLSGNPIEDKGVIALSQNLENLEKGLKRLSLSRVSMTARGLGCLSQVLSSSQRFSTS  293

Query  710  -----LSIGSNYLGSEIGASIGKFMS--KGILSLDIDDIGLGSSGFSKAQEEIVEDL---  561
                 LS  ++ L +E    + KF+S    +  LD+ D        S   + +   L   
Sbjct  294  LTHLDLSGNTSSLVTEEATFLFKFLSSTNSLSYLDLSDT-------SCPLDTLFVSLSAG  346

Query  560  ---KIICINISKN----RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLA  402
               K++ +N+++N    R   +  + I + FS + EL  +      +P ++L ++  GLA
Sbjct  347  CCYKLVHLNLARNPFSHRKVQEVTRSIQEFFSQSCELKYVGLSATKLPPQALRLLLQGLA  406

Query  401  ANGKLELLDLSGNASCE-NSADASVLSKY  318
             N +L  L+L   +SCE  SA A V+ ++
Sbjct  407  TNKRLFGLELD-LSSCELRSAGAQVIQEH  434



>emb|CDQ58729.1| unnamed protein product [Oncorhynchus mykiss]
Length=1135

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 49/207 (24%), Positives = 97/207 (47%), Gaps = 6/207 (3%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            S++  +N IE++G R+L   L  + K+V L ++   +   G K + E L    +  T L 
Sbjct  796  SINFQNNLIEEEGARALAEVLLSNRKLVSLNVQKNCIGADGAKRIAEALKT-NRTLTELI  854

Query  704  IGSNYLGSEIGASIGKFMS--KGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
            + SN LG +  A++ + ++    + SL +    + + G +   + +  +  +IC+N+ +N
Sbjct  855  LSSNQLGDKGTAALAQALTVNHSLHSLHLQSNSISNKGMTALTKALRLNRGLICLNLREN  914

Query  530  RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGN-ASC  354
              G++ AK +++       L  ++   NL+  E +  I   +  N  L  L L  N   C
Sbjct  915  SIGVEGAKDMARALQENSSLRHLDLTANLLHDEGVKAIAGAVKVNRALTTLRLQWNFIKC  974

Query  353  ENSADASVLSKYEINGKLVIIDLPSSA  273
              +A  S+      N  + ++DL  +A
Sbjct  975  --TATKSLAHALLTNSTMQLLDLQENA  999



>gb|KFH62941.1| hypothetical protein MVEG_10979 [Mortierella verticillata NRRL 
6337]
Length=625

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/202 (24%), Positives = 90/202 (45%), Gaps = 4/202 (2%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            +LDL +N I D G   L   L+ +  +  L L+N  +  +G + L E L       T+L+
Sbjct  28   TLDLKNNSIRDSGAHVLSETLKTNSTLTTLDLQNNSIGSNGAQALSEALKT-NSTLTTLN  86

Query  704  IGSNYLGSEIGASIGKFMSKG--ILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
            +GSN +G     ++ + +     + +L+I+   +  +GF    + +  +  +  +N+  N
Sbjct  87   LGSNSIGDNGAQALSEALQTNSTLTALNIEWGSIKDNGFQMLSDALKTNSTLTTLNLRSN  146

Query  530  RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCE  351
                + A+ +S+      +L ++N E NL+       +   L  N  L  L L  N   +
Sbjct  147  SISDNGAQALSEALKINSDLTSLNLENNLIRDNGTQALSKALKTNSTLTTLILGSNPIGD  206

Query  350  NSADASVLSKYEINGKLVIIDL  285
            N A A +    +IN  L  +D 
Sbjct  207  NGAQA-LSDALQINSTLTTLDF  227



>ref|XP_004556391.1| PREDICTED: leucine-rich repeat-containing protein 16B-like [Maylandia 
zebra]
Length=616

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 103/211 (49%), Gaps = 27/211 (13%)
 Frame = -3

Query  893  NXESLDLSDNPIEDDGVRSLITYLEYSCK-IVELRLENCELTGHGVKCLLECLSVLEKPP  717
            N +S++LS NPIED GV +L   LE   K +  L L    +T  G+ CL + LS  ++  
Sbjct  275  NLQSINLSGNPIEDKGVIALSQNLENLEKGLKRLSLSRVSMTARGLGCLSQVLSSSQRFS  334

Query  716  TSLSI-----GSNYLGSEIGASIGKFMSK--GILSLDIDDIGLGSSGFSKAQEEIVEDL-  561
            TSL+       ++ L +E    + KF+S    +  LD+ D        S   + +   L 
Sbjct  335  TSLTHLDLSGNTSSLVTEEATFLFKFLSSTNSLSYLDLSDT-------SCPLDTLFVSLS  387

Query  560  -----KIICINISKN----RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSG  408
                 K++ +N+++N    R   +  + I + FS + EL  +      +P ++L ++  G
Sbjct  388  AGCCYKLVHLNLARNPFSHRKVQEVTRSIQEFFSQSCELKYVGLSATKLPPQALRLLLQG  447

Query  407  LAANGKLELLDLSGNASCE-NSADASVLSKY  318
            LA N +L  L+L   +SCE  SA A V+ ++
Sbjct  448  LATNKRLFGLELDL-SSCELRSAGAQVIQEH  477



>ref|WP_032112569.1| hypothetical protein [Candidatus Paracaedibacter symbiosus]
Length=1008

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 94/207 (45%), Gaps = 5/207 (2%)
 Frame = -3

Query  893  NXESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPT  714
            N +SL+L+ N + D G+  ++  +  +  + +L L +C+LT H      E LS  E    
Sbjct  578  NIQSLNLAYNSLADSGMSDVVRLVRDNTSLKKLNLTHCDLTHHASDYAQELLSQ-EAAIN  636

Query  713  SLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQ---EEIVEDLKIICIN  543
            SL++  N L   I    G+ ++  +  L+++   +G   FS      +   E   +  +N
Sbjct  637  SLNLSDNKLDERIIGCFGRGLNTTLKDLNLEKNNIGKGNFSALYFHFQAFKESSTLSILN  696

Query  542  ISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGN  363
            ++ N    + A  I+        L  +N   N++  E   +I   L  N  L  LDLS N
Sbjct  697  LAYNYLTNEGANVIASFLKENKCLTHLNLANNIIGDEGTELIALSLKYNTSLVELDLSNN  756

Query  362  ASCENSA-DASVLSKYEINGKLVIIDL  285
               +N A + S + K ++N KLV + L
Sbjct  757  KITDNGAQEFSRIFKRKLNTKLVNLQL  783



>ref|XP_005454339.1| PREDICTED: leucine-rich repeat-containing protein 16B-like [Oreochromis 
niloticus]
Length=530

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 102/209 (49%), Gaps = 27/209 (13%)
 Frame = -3

Query  887  ESLDLSDNPIEDDGVRSLITYLEYSCK-IVELRLENCELTGHGVKCLLECLSVLEKPPTS  711
            +S++LS NPIED GV +L   LE   K +  L L    +T  G+ CL + LS  ++  TS
Sbjct  277  QSINLSGNPIEDKGVIALSQNLENLEKGLKRLSLSRVSMTARGLGCLSQVLSSSQRFSTS  336

Query  710  LSI-----GSNYLGSEIGASIGKFMSK--GILSLDIDDIGLGSSGFSKAQEEIVEDL---  561
            L+       ++ L +E    + KF+S    +  LD+ D        S   + +   L   
Sbjct  337  LTHLDLSGNTSSLVTEEATFLFKFLSSTNSLSYLDLSDT-------SCPLDTLFVSLSAG  389

Query  560  ---KIICINISKN----RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLA  402
               K++ +N+++N    R   +  + I + FS + EL  +      +P ++L ++  GLA
Sbjct  390  CCYKLVHLNLARNPFSHRKVQEVTRSIQEFFSQSCELKYVGLSATKLPPQALRLLLQGLA  449

Query  401  ANGKLELLDLSGNASCE-NSADASVLSKY  318
             N +L  L+L   +SCE  SA A V+ ++
Sbjct  450  TNKRLFGLELDL-SSCELRSAGAQVIQEH  477



>gb|KFH65222.1| hypothetical protein MVEG_08703 [Mortierella verticillata NRRL 
6337]
Length=750

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 97/206 (47%), Gaps = 4/206 (2%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            +L+L +N I D+G ++L   LE +  +  L L+N  +  +G + L E L       T L+
Sbjct  86   TLNLQNNRIGDNGAQALGEALETNSTLATLILQNNRIGDNGGQALGEALKTNSTLAT-LN  144

Query  704  IGSNYLGSEIGASIGKFM--SKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
            + SN +G + G ++G+ +  + G+ +LD  +  +G +G     E +  +  +  ++++ N
Sbjct  145  LQSNSIGEKGGQALGEALKTNSGLATLDWYNNSIGDNGAQALGEALKTNSTLTTLDLNNN  204

Query  530  RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCE  351
              G + A+ + +       L  +N + N +       +G  L  N  L  L+L  N   +
Sbjct  205  SIGDNGAQALGETLKTNSTLATLNLQSNSIGENGAQALGEALKTNSTLATLNLQNNRIGD  264

Query  350  NSADASVLSKYEINGKLVIIDLPSSA  273
            N + A +    E N  L  + L S++
Sbjct  265  NGSQA-LGEALETNSTLATLILHSNS  289



>ref|WP_044881576.1| hypothetical protein, partial [Neochlamydia sp. EPS4]
Length=486

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 81/175 (46%), Gaps = 3/175 (2%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLSI  702
            L+L +N I  +G  SL   LE +  + EL L   E+   G   L + L       T L++
Sbjct  134  LELYNNRIGKEGASSLAKALETNTSLTELDLSGNEIGYEGTSALSKALET-NISLTKLNL  192

Query  701  GSNYLGSEIGASIGKFM--SKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNR  528
             SN +G E   ++ K +  +  +  L++ + G+G  G S   + +  +  +  +++S+N+
Sbjct  193  SSNKIGYEGTRALSKALETNTSLTELELSENGIGYEGTSALSKALKTNNSLTALSLSRNK  252

Query  527  GGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGN  363
             G +    +SK       L A++   N +  E  + +   L  N  L  LDLSGN
Sbjct  253  IGYEGTSALSKALETNASLTALSLSRNEIGYEGTSALSKALETNTSLTELDLSGN  307



>ref|XP_009311228.1| putative leucine-richprotein [Trypanosoma grayi]
 gb|KEG10538.1| putative leucine-richprotein [Trypanosoma grayi]
Length=386

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 88/185 (48%), Gaps = 11/185 (6%)
 Frame = -3

Query  887  ESLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSL  708
            ESLDL+  P+   G  +L   L  +  I  L L  C +T  G   + + LS + +  T+L
Sbjct  92   ESLDLNFFPLGKKGSAALAAALRVNPYIKNLSLVGCHITPAGGMEIAQALSEM-RNVTTL  150

Query  707  SIGSNYLGSEI-------GASIGKFMSKG--ILSLDIDDIGLGSSGFSKAQEEIVEDLKI  555
             +  N LG+         GA + + +  G  + +L + D GL     S   E  V++ ++
Sbjct  151  DLSQNMLGARDPGDDVRGGAVVLELIKPGNVLKTLSLRDNGLSDQHTSDFVEAAVDNTEL  210

Query  554  ICINISKNRGGIDTAKFISKLFSYAPELVAINAEFN-LMPAESLAIIGSGLAANGKLELL  378
             C+++S NR G   A  ++++ S   +L  +N E+N      S  I+G GL  N  ++  
Sbjct  211  NCLDLSFNRIGYLGAMDLAQILSRNADLREVNLEWNQFQTMGSRHILGEGLLLNNTIKRF  270

Query  377  DLSGN  363
            +LS +
Sbjct  271  NLSSD  275



>ref|XP_006117873.1| PREDICTED: uncharacterized protein C14orf166B homolog [Pelodiscus 
sinensis]
Length=517

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 103/214 (48%), Gaps = 17/214 (8%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLS----VLEKPPT  714
            ++L+ + +   G +++   L  +  I+ L LE+  +   GV CL++ L     + E    
Sbjct  89   MNLNHHGLGPKGAKAIAIALVSNTTIIHLELEDNWILAEGVMCLVQMLRENCYIQE----  144

Query  713  SLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSK--AQ---EEIVEDLKIIC  549
             L+I +N+L +E   +I +     I SL    + L  + F +  AQ   E ++ + ++  
Sbjct  145  -LNISNNHLDTEGAEAISRIFLDNISSLRA--VQLSGNNFREETAQFFAEALLGNYRVKE  201

Query  548  INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLS  369
            +++S N       + + +L +    L  +N  +N +  +    +G+GL ANG L++LDLS
Sbjct  202  LDLSHNEFSEKGGEHLGQLLANNEILEFLNLSWNHLRLKGAVALGAGLRANGTLKILDLS  261

Query  368  GNASCENSADASVLSKYEINGKLVIIDLPSSAPN  267
             N    N    ++    + N  LV++D+ S+  N
Sbjct  262  WNGFG-NEGAVALGEALKQNNTLVLLDISSNHIN  294



>ref|XP_008659073.1| PREDICTED: protein NLRC3 isoform X2 [Zea mays]
Length=487

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            +LDLS NPI  DGV++L   L++  KI  L+L  C++   G +C+ +CL       ++L 
Sbjct  337  TLDLSYNPIGSDGVKALCDVLKFHGKIQTLKLGWCQIGMEGAECIADCLKY-NTTLSTLD  395

Query  704  IGSNYLGSEIG---ASIGKFMSKGILSLDIDDIGLGSSG-FSKAQE-EIVEDLKIICINI  540
            + +N LG++     A   K +++ + SLD+    +   G F+ AQ  +  EDL +  +N+
Sbjct  396  LRANGLGNDGAICLARSFKIINESLTSLDLGFNEIRDDGAFALAQALKANEDLAVTSLNL  455

Query  539  SKN  531
            + N
Sbjct  456  ANN  458



>gb|KFH66485.1| hypothetical protein MVEG_07010 [Mortierella verticillata NRRL 
6337]
Length=1328

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 93/205 (45%), Gaps = 3/205 (1%)
 Frame = -3

Query  881  LDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLSI  702
            LDL DN I D+  R+L   L+ +  +  L L N  +  +G + L + L        +LS+
Sbjct  390  LDLHDNSIGDNRARALAEALKSNTTLTALDLRNNSIGENGAQALAKALMTNTTFLATLSL  449

Query  701  GSNYLGSEIGASIGKFMSKG--ILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNR  528
             +N +G     ++ + +     + +LD+ +  +G +G     E +  +  +  +++  N 
Sbjct  450  QNNSIGDNGTQALAEALKTNSTLTALDLQNNSIGDNGALVLAEALKSNTTLAALSLRNNS  509

Query  527  GGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCEN  348
                 A  +++       L  +N E+NL+ ++   ++   L  N  L  LDL  N+  +N
Sbjct  510  IEDSGALALAEALRTNSTLATLNLEWNLISSKGALVLAKALKTNSILTTLDLQNNSIGDN  569

Query  347  SADASVLSKYEINGKLVIIDLPSSA  273
             A A +    + N  L  +DL +++
Sbjct  570  GAQA-LAEALKTNSILTALDLQNNS  593



>gb|AFW85195.1| hypothetical protein ZEAMMB73_319583 [Zea mays]
Length=615

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 68/123 (55%), Gaps = 6/123 (5%)
 Frame = -3

Query  884  SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
            +LDLS NPI  DGV++L   L++  KI  L+L  C++   G +C+ +CL       ++L 
Sbjct  465  TLDLSYNPIGSDGVKALCDVLKFHGKIQTLKLGWCQIGMEGAECIADCLKY-NTTLSTLD  523

Query  704  IGSNYLGSEIG---ASIGKFMSKGILSLDIDDIGLGSSG-FSKAQE-EIVEDLKIICINI  540
            + +N LG++     A   K +++ + SLD+    +   G F+ AQ  +  EDL +  +N+
Sbjct  524  LRANGLGNDGAICLARSFKIINESLTSLDLGFNEIRDDGAFALAQALKANEDLAVTSLNL  583

Query  539  SKN  531
            + N
Sbjct  584  ANN  586



>gb|KFH68944.1| hypothetical protein MVEG_05746 [Mortierella verticillata NRRL 
6337]
Length=1237

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 92/206 (45%), Gaps = 4/206 (2%)
 Frame = -3

Query  884   SLDLSDNPIEDDGVRSLITYLEYSCKIVELRLENCELTGHGVKCLLECLSVLEKPPTSLS  705
             +LDL +N I D+G + L   L+ +  +  L L    +  +G + L E L       T+L 
Sbjct  1008  TLDLQENSIRDNGAQELSEALKANLTLTTLHLSYNAIRDNGAQALAEALKT-NSTLTTLE  1066

Query  704   IGSNYLGSEIGASIGKFM--SKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKN  531
             +  N +G     ++ + +  +  +++LD+ D  +GS G     E +  +  +  +++  N
Sbjct  1067  LTGNSIGDNGAQALAEALKINSTLITLDLRDHSIGSIGIQALSEALKTNSTLTTLDLRDN  1126

Query  530   RGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAANGKLELLDLSGNASCE  351
               G   A+ +S+       L  ++ + N +       +   L  N  L  LDL+GN+  +
Sbjct  1127  SIGSIGAQALSEALKINSTLTTLDLQENSIGDSGAQALSEALKTNSTLTTLDLTGNSIGD  1186

Query  350   NSADASVLSKYEINGKLVIIDLPSSA  273
             + A A +    + N  L  + L S++
Sbjct  1187  DGAQA-LYEALKTNSTLTALSLRSNS  1211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2323260538540