BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6460

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606258.1|  PREDICTED: polygalacturonase QRT2-like             157   2e-42   
ref|XP_009767751.1|  PREDICTED: polygalacturonase QRT2-like             152   4e-41   Nicotiana sylvestris
ref|XP_006345284.1|  PREDICTED: polygalacturonase QRT2-like             132   3e-33   Solanum tuberosum [potatoes]
ref|XP_004252072.1|  PREDICTED: polygalacturonase QRT2                  129   2e-32   Solanum lycopersicum
gb|EYU23048.1|  hypothetical protein MIMGU_mgv1a026845mg                128   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_011078321.1|  PREDICTED: polygalacturonase QRT2-like isofo...    129   3e-32   Sesamum indicum [beniseed]
gb|KDO45206.1|  hypothetical protein CISIN_1g047411mg                   124   9e-32   Citrus sinensis [apfelsine]
ref|XP_003540568.1|  PREDICTED: probable polygalacturonase At3g15...    127   1e-31   Glycine max [soybeans]
ref|XP_003545181.1|  PREDICTED: probable polygalacturonase At3g15...    125   5e-31   
ref|XP_006465486.1|  PREDICTED: probable polygalacturonase At3g15...    127   9e-31   
gb|KHG17941.1|  hypothetical protein F383_07844                         124   1e-30   Gossypium arboreum [tree cotton]
gb|KJB70601.1|  hypothetical protein B456_011G082400                    124   2e-30   Gossypium raimondii
ref|XP_006427258.1|  hypothetical protein CICLE_v10026919mg             123   3e-30   
ref|XP_006845770.1|  PREDICTED: probable polygalacturonase At1g80170    123   3e-30   
ref|XP_011093565.1|  PREDICTED: probable polygalacturonase At1g80170    123   3e-30   Sesamum indicum [beniseed]
ref|XP_003607885.1|  hypothetical protein MTR_4g084050                  120   3e-29   Medicago truncatula
ref|XP_010254486.1|  PREDICTED: polygalacturonase ADPG1-like            119   7e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004502362.1|  PREDICTED: probable polygalacturonase At3g15...    119   8e-29   Cicer arietinum [garbanzo]
ref|XP_004486675.1|  PREDICTED: probable polygalacturonase At3g15...    119   8e-29   
ref|XP_003597886.1|  Polygalacturonase                                  118   1e-28   Medicago truncatula
ref|XP_010318778.1|  PREDICTED: probable polygalacturonase At3g15720    118   2e-28   Solanum lycopersicum
ref|XP_006364236.1|  PREDICTED: probable polygalacturonase At3g15...    118   2e-28   
gb|KJB70599.1|  hypothetical protein B456_011G082200                    117   3e-28   Gossypium raimondii
gb|KHG01626.1|  hypothetical protein F383_22075                         117   3e-28   Gossypium arboreum [tree cotton]
ref|XP_010254483.1|  PREDICTED: probable polygalacturonase At3g15720    117   3e-28   Nelumbo nucifera [Indian lotus]
gb|KJB70598.1|  hypothetical protein B456_011G082200                    117   3e-28   Gossypium raimondii
gb|ABK26513.1|  unknown                                                 117   4e-28   Picea sitchensis
ref|XP_002526714.1|  Polygalacturonase precursor, putative              114   4e-28   
ref|XP_003601689.1|  hypothetical protein MTR_3g084360                  117   4e-28   
ref|XP_010494537.1|  PREDICTED: probable polygalacturonase At3g15720    116   7e-28   
ref|XP_011014845.1|  PREDICTED: probable polygalacturonase At1g80...    117   7e-28   Populus euphratica
ref|XP_011014846.1|  PREDICTED: probable polygalacturonase At1g80...    117   7e-28   Populus euphratica
ref|XP_010671219.1|  PREDICTED: probable polygalacturonase At3g15720    116   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007150743.1|  hypothetical protein PHAVU_005G177000g             115   1e-27   Phaseolus vulgaris [French bean]
ref|XP_009355877.1|  PREDICTED: probable polygalacturonase At3g15720    115   1e-27   
ref|XP_011078326.1|  PREDICTED: polygalacturonase QRT2-like isofo...    115   2e-27   
ref|XP_011459852.1|  PREDICTED: probable polygalacturonase At3g15720    115   2e-27   Fragaria vesca subsp. vesca
ref|XP_004516611.1|  PREDICTED: probable polygalacturonase At3g15...    115   3e-27   Cicer arietinum [garbanzo]
ref|XP_009355876.1|  PREDICTED: probable polygalacturonase At3g15720    115   3e-27   
gb|KHG17940.1|  hypothetical protein F383_07843                         115   3e-27   Gossypium arboreum [tree cotton]
gb|AES71940.2|  polygalacturonase/glycoside hydrolase family protein    115   3e-27   Medicago truncatula
ref|XP_011035676.1|  PREDICTED: probable polygalacturonase At1g80...    115   3e-27   Populus euphratica
ref|XP_008365049.1|  PREDICTED: probable polygalacturonase At1g80170    115   3e-27   Malus domestica [apple tree]
ref|XP_011035674.1|  PREDICTED: probable polygalacturonase At1g80...    115   3e-27   Populus euphratica
ref|XP_007018009.1|  Pectin lyase-like superfamily protein, putative    114   4e-27   
ref|XP_008337131.1|  PREDICTED: probable polygalacturonase At3g15720    114   5e-27   
ref|XP_003588754.1|  PGN                                                114   6e-27   
emb|CDO98133.1|  unnamed protein product                                114   6e-27   Coffea canephora [robusta coffee]
gb|KHN44172.1|  Putative polygalacturonase                              114   7e-27   Glycine soja [wild soybean]
ref|XP_004497875.1|  PREDICTED: probable polygalacturonase At3g15...    114   7e-27   Cicer arietinum [garbanzo]
gb|KHN39536.1|  Putative polygalacturonase                              113   7e-27   Glycine soja [wild soybean]
ref|XP_010061913.1|  PREDICTED: probable polygalacturonase At3g15720    114   7e-27   Eucalyptus grandis [rose gum]
ref|XP_007227584.1|  hypothetical protein PRUPE_ppa015678mg             113   9e-27   
ref|XP_004302967.1|  PREDICTED: probable polygalacturonase At1g80170    113   1e-26   Fragaria vesca subsp. vesca
ref|XP_006465356.1|  PREDICTED: probable polygalacturonase At1g80...    113   1e-26   Citrus sinensis [apfelsine]
ref|XP_011081272.1|  PREDICTED: probable polygalacturonase At1g80170    113   1e-26   Sesamum indicum [beniseed]
ref|XP_002324855.2|  hypothetical protein POPTR_0018s01610g             112   2e-26   
ref|XP_009362523.1|  PREDICTED: probable polygalacturonase At1g80170    113   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008337125.1|  PREDICTED: probable polygalacturonase At3g15720    112   2e-26   
gb|ABD28723.1|  Glycoside hydrolase, family 28                          112   2e-26   Medicago truncatula
ref|XP_006595163.1|  PREDICTED: probable polygalacturonase At3g15...    112   2e-26   Glycine max [soybeans]
ref|XP_008243707.1|  PREDICTED: probable polygalacturonase At1g80170    112   2e-26   Prunus mume [ume]
ref|XP_006427250.1|  hypothetical protein CICLE_v10027074mg             112   2e-26   
emb|CDP21684.1|  unnamed protein product                                108   2e-26   Coffea canephora [robusta coffee]
ref|XP_010047836.1|  PREDICTED: probable polygalacturonase At1g80170    112   3e-26   
gb|KJB70600.1|  hypothetical protein B456_011G082300                    111   3e-26   Gossypium raimondii
gb|KCW68966.1|  hypothetical protein EUGRSUZ_F02531                     111   4e-26   Eucalyptus grandis [rose gum]
ref|XP_006845768.2|  PREDICTED: probable polygalacturonase At1g80170    112   4e-26   Amborella trichopoda
ref|XP_008242767.1|  PREDICTED: probable polygalacturonase At1g80170    111   5e-26   Prunus mume [ume]
ref|XP_009338342.1|  PREDICTED: probable polygalacturonase At1g80170    111   5e-26   Pyrus x bretschneideri [bai li]
ref|XP_007023162.1|  JHL06P13.4 protein, putative                       111   6e-26   
ref|XP_004489698.1|  PREDICTED: probable polygalacturonase At3g15...    111   6e-26   Cicer arietinum [garbanzo]
ref|XP_006427256.1|  hypothetical protein CICLE_v10027137mg             111   6e-26   
ref|XP_007013436.1|  F18B13.22 protein isoform 1                        111   7e-26   
ref|XP_010450754.1|  PREDICTED: probable polygalacturonase At1g80170    111   7e-26   
gb|KCW81411.1|  hypothetical protein EUGRSUZ_C02788                     111   7e-26   Eucalyptus grandis [rose gum]
ref|XP_009360500.1|  PREDICTED: probable polygalacturonase At3g15720    111   7e-26   
gb|ACN40008.1|  unknown                                                 111   8e-26   Picea sitchensis
ref|XP_010445667.1|  PREDICTED: probable polygalacturonase At1g80170    110   8e-26   
ref|NP_001234200.2|  polygalacturonase precursor                        110   8e-26   Solanum lycopersicum
ref|XP_004498018.1|  PREDICTED: probable polygalacturonase At3g15...    110   8e-26   Cicer arietinum [garbanzo]
ref|XP_003546050.2|  PREDICTED: probable polygalacturonase At1g80...    110   9e-26   
ref|XP_004498026.1|  PREDICTED: probable polygalacturonase At3g15...    110   9e-26   Cicer arietinum [garbanzo]
ref|XP_010494002.1|  PREDICTED: probable polygalacturonase At3g15720    110   9e-26   
ref|XP_009595646.1|  PREDICTED: probable polygalacturonase At3g15...    110   9e-26   Nicotiana tomentosiformis
ref|XP_010435969.1|  PREDICTED: probable polygalacturonase At1g80170    110   9e-26   
gb|KHN22454.1|  Putative polygalacturonase                              110   1e-25   Glycine soja [wild soybean]
ref|XP_012073216.1|  PREDICTED: probable polygalacturonase At1g80...    110   1e-25   
ref|XP_009619865.1|  PREDICTED: probable polygalacturonase At3g15720    110   1e-25   Nicotiana tomentosiformis
gb|AAY21049.1|  PGN                                                     110   1e-25   Glycine max [soybeans]
ref|XP_009362540.1|  PREDICTED: probable polygalacturonase At1g80170    110   1e-25   Pyrus x bretschneideri [bai li]
gb|ABK23977.1|  unknown                                                 110   1e-25   Picea sitchensis
ref|XP_010431134.1|  PREDICTED: probable polygalacturonase At3g15720    110   1e-25   
ref|XP_006356262.1|  PREDICTED: probable polygalacturonase At1g80...    110   1e-25   Solanum tuberosum [potatoes]
ref|XP_010537985.1|  PREDICTED: probable polygalacturonase At1g80...    110   2e-25   
ref|XP_002299601.2|  hypothetical protein POPTR_0001s17180g             110   2e-25   
dbj|BAJ53225.1|  JHL06P13.4                                             110   2e-25   Jatropha curcas
ref|XP_007013438.1|  F18B13.22 protein isoform 3                        108   2e-25   
dbj|BAJ53238.1|  JHL06P13.19                                            110   2e-25   Jatropha curcas
ref|XP_006845766.2|  PREDICTED: probable polygalacturonase At1g80170    110   2e-25   Amborella trichopoda
gb|KCW81410.1|  hypothetical protein EUGRSUZ_C02787                     109   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010051184.1|  PREDICTED: probable polygalacturonase At3g15720    110   2e-25   Eucalyptus grandis [rose gum]
gb|KHN43850.1|  Putative polygalacturonase                              110   2e-25   Glycine soja [wild soybean]
ref|XP_012073215.1|  PREDICTED: probable polygalacturonase At1g80...    110   2e-25   Jatropha curcas
ref|XP_007034396.1|  Pectin lyase superfamily protein, putative i...    109   2e-25   
gb|KDO45234.1|  hypothetical protein CISIN_1g013309mg                   109   2e-25   Citrus sinensis [apfelsine]
emb|CBI36284.3|  unnamed protein product                                110   2e-25   Vitis vinifera
gb|KDO45211.1|  hypothetical protein CISIN_1g041224mg                   109   2e-25   Citrus sinensis [apfelsine]
gb|KDO45207.1|  hypothetical protein CISIN_1g039868mg                   109   2e-25   Citrus sinensis [apfelsine]
ref|NP_001275837.1|  polygalacturonase precursor                        109   3e-25   Citrus sinensis [apfelsine]
gb|KDO45233.1|  hypothetical protein CISIN_1g013309mg                   109   3e-25   Citrus sinensis [apfelsine]
ref|XP_006427234.1|  hypothetical protein CICLE_v10027523mg             109   3e-25   
ref|XP_012082168.1|  PREDICTED: probable polygalacturonase At3g15720    109   3e-25   Jatropha curcas
ref|XP_007163810.1|  hypothetical protein PHAVU_001G266200g             108   3e-25   Phaseolus vulgaris [French bean]
ref|XP_007013437.1|  F18B13.22 protein isoform 2                        108   3e-25   
ref|XP_008454473.1|  PREDICTED: probable polygalacturonase At3g15720    108   3e-25   Cucumis melo [Oriental melon]
gb|KDO45212.1|  hypothetical protein CISIN_1g047738mg                   108   4e-25   Citrus sinensis [apfelsine]
ref|XP_007034395.1|  Pectin lyase superfamily protein, putative i...    109   4e-25   
ref|XP_007216032.1|  hypothetical protein PRUPE_ppa014982mg             109   4e-25   
ref|XP_006285343.1|  hypothetical protein CARUB_v10006733mg             108   4e-25   
emb|CDY69377.1|  BnaCnng63250D                                          108   4e-25   Brassica napus [oilseed rape]
ref|XP_002321662.2|  hypothetical protein POPTR_0015s10000g             108   5e-25   
ref|XP_009802084.1|  PREDICTED: probable polygalacturonase At1g80170    108   6e-25   Nicotiana sylvestris
ref|XP_002515527.1|  polygalacturonase, putative                        108   6e-25   
ref|XP_007203411.1|  hypothetical protein PRUPE_ppa021427mg             108   7e-25   
emb|CDY39404.1|  BnaAnng05350D                                          108   7e-25   Brassica napus [oilseed rape]
gb|KEH25592.1|  polygalacturonase                                       108   7e-25   Medicago truncatula
gb|EPS66872.1|  polygalacturonase                                       107   7e-25   Genlisea aurea
ref|XP_006364199.1|  PREDICTED: probable polygalacturonase At1g80...    108   8e-25   Solanum tuberosum [potatoes]
gb|AFK43754.1|  unknown                                                 108   8e-25   Medicago truncatula
ref|XP_012073436.1|  PREDICTED: probable polygalacturonase At1g80170    110   8e-25   
gb|AHG12641.1|  polygalacturonase                                       108   1e-24   Nicotiana tabacum [American tobacco]
ref|XP_010533165.1|  PREDICTED: probable polygalacturonase At3g15...    107   1e-24   Tarenaya hassleriana [spider flower]
gb|KCW81409.1|  hypothetical protein EUGRSUZ_C02785                     107   1e-24   Eucalyptus grandis [rose gum]
ref|XP_006465488.1|  PREDICTED: uncharacterized protein LOC102623476    110   1e-24   
ref|XP_010533164.1|  PREDICTED: probable polygalacturonase At3g15...    107   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_003613981.1|  Polygalacturonase                                  107   1e-24   
ref|XP_002515526.1|  Polygalacturonase-2 precursor, putative            107   2e-24   
ref|XP_009765216.1|  PREDICTED: probable polygalacturonase At3g15720    108   2e-24   Nicotiana sylvestris
emb|CDX73440.1|  BnaC08g25630D                                          106   2e-24   
ref|XP_010051182.1|  PREDICTED: probable polygalacturonase At3g15720    107   3e-24   
emb|CBI36303.3|  unnamed protein product                                106   3e-24   Vitis vinifera
ref|XP_002281827.2|  PREDICTED: probable polygalacturonase At1g80170    106   3e-24   Vitis vinifera
gb|ABR18059.1|  unknown                                                 107   3e-24   Picea sitchensis
ref|XP_006398123.1|  hypothetical protein EUTSA_v10001153mg             106   3e-24   
gb|KFK33181.1|  hypothetical protein AALP_AA6G340800                    109   3e-24   Arabis alpina [alpine rockcress]
ref|XP_010445851.1|  PREDICTED: probable polygalacturonase At3g15720    102   3e-24   
ref|XP_004241700.1|  PREDICTED: probable polygalacturonase At1g80170    106   4e-24   Solanum lycopersicum
ref|XP_010654934.1|  PREDICTED: probable polygalacturonase At3g15720    106   4e-24   
ref|XP_009594191.1|  PREDICTED: probable polygalacturonase At1g80170    106   4e-24   Nicotiana tomentosiformis
ref|XP_009139940.1|  PREDICTED: polygalacturonase QRT2                  106   4e-24   
ref|XP_003546932.1|  PREDICTED: probable polygalacturonase At1g80...    105   5e-24   
ref|XP_002309621.2|  hypothetical protein POPTR_0006s26920g             105   6e-24   
ref|XP_007023876.1|  Pectin lyase-like superfamily protein              105   6e-24   
ref|XP_006597127.1|  PREDICTED: probable polygalacturonase At1g80...    105   6e-24   
ref|XP_004305261.1|  PREDICTED: probable polygalacturonase At3g15720    105   6e-24   Fragaria vesca subsp. vesca
ref|XP_006597125.1|  PREDICTED: probable polygalacturonase At1g80...    105   7e-24   
ref|XP_010250371.1|  PREDICTED: probable polygalacturonase At1g80170    105   7e-24   
ref|XP_011459190.1|  PREDICTED: probable polygalacturonase At3g15720    105   9e-24   Fragaria vesca subsp. vesca
ref|XP_006427249.1|  hypothetical protein CICLE_v10027366mg             105   9e-24   
ref|XP_007212964.1|  hypothetical protein PRUPE_ppa021095mg             107   1e-23   
ref|XP_007226190.1|  hypothetical protein PRUPE_ppa015822mg             104   1e-23   
ref|XP_010250372.1|  PREDICTED: polygalacturonase ADPG1-like            105   1e-23   
ref|XP_010429999.1|  PREDICTED: probable polygalacturonase At1g80170    105   1e-23   Camelina sativa [gold-of-pleasure]
gb|KHN22462.1|  Putative polygalacturonase                              106   1e-23   Glycine soja [wild soybean]
ref|XP_007204868.1|  hypothetical protein PRUPE_ppa018519mg             104   1e-23   
ref|XP_007151017.1|  hypothetical protein PHAVU_004G011800g             104   1e-23   Phaseolus vulgaris [French bean]
gb|KDP37098.1|  hypothetical protein JCGZ_06154                         105   2e-23   Jatropha curcas
ref|XP_002874366.1|  glycoside hydrolase family 28 protein              104   2e-23   
ref|XP_010417741.1|  PREDICTED: probable polygalacturonase At1g80170    104   2e-23   Camelina sativa [gold-of-pleasure]
emb|CAN62658.1|  hypothetical protein VITISV_039094                     104   2e-23   Vitis vinifera
ref|XP_010254365.1|  PREDICTED: probable polygalacturonase At1g80170    104   2e-23   Nelumbo nucifera [Indian lotus]
gb|KHG21768.1|  hypothetical protein F383_04238                         104   2e-23   Gossypium arboreum [tree cotton]
emb|CBI36306.3|  unnamed protein product                                104   2e-23   Vitis vinifera
gb|KEH24801.1|  polygalacturonase                                       103   3e-23   Medicago truncatula
ref|XP_009629677.1|  PREDICTED: probable polygalacturonase At1g80170    104   3e-23   Nicotiana tomentosiformis
ref|XP_011654334.1|  PREDICTED: probable polygalacturonase At3g15720    103   3e-23   Cucumis sativus [cucumbers]
ref|XP_003601691.1|  Polygalacturonase                                  103   3e-23   
ref|NP_198807.1|  pectin lyase-like superfamily protein                 103   3e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY56952.1|  BnaC04g56090D                                          103   3e-23   Brassica napus [oilseed rape]
gb|AFK47772.1|  unknown                                                 103   4e-23   Medicago truncatula
dbj|BAB10216.1|  polygalacturonase-like protein                         103   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405582.1|  hypothetical protein EUTSA_v10028331mg             103   4e-23   
ref|XP_003618193.1|  Polygalacturonase                                  103   4e-23   Medicago truncatula
ref|XP_006291145.1|  hypothetical protein CARUB_v10017263mg             103   5e-23   Capsella rubella
gb|KGN52445.1|  hypothetical protein Csa_5G635400                       102   6e-23   Cucumis sativus [cucumbers]
ref|XP_002517603.1|  Polygalacturonase precursor, putative              102   6e-23   
ref|XP_009799918.1|  PREDICTED: probable polygalacturonase At1g80170    103   7e-23   Nicotiana sylvestris
ref|XP_006400250.1|  hypothetical protein EUTSA_v10013641mg             102   7e-23   Eutrema salsugineum [saltwater cress]
ref|XP_009790843.1|  PREDICTED: probable polygalacturonase At3g15720    102   7e-23   Nicotiana sylvestris
gb|EYU35886.1|  hypothetical protein MIMGU_mgv1a018285mg                102   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_010654779.1|  PREDICTED: probable polygalacturonase At3g15720    102   7e-23   Vitis vinifera
ref|NP_198105.2|  pectin lyase-like superfamily protein                 103   8e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ACN29115.1|  unknown                                                 100   8e-23   Zea mays [maize]
ref|XP_011078892.1|  PREDICTED: polygalacturonase                       102   8e-23   Sesamum indicum [beniseed]
ref|NP_199297.1|  glycoside hydrolase family 28 protein / polygal...    102   9e-23   
ref|XP_004498711.1|  PREDICTED: probable polygalacturonase At3g15...    102   9e-23   
emb|CDY39399.1|  BnaAnng05300D                                          102   9e-23   Brassica napus [oilseed rape]
gb|KGN52885.1|  hypothetical protein Csa_4G004940                       102   9e-23   
ref|XP_010545770.1|  PREDICTED: probable polygalacturonase At3g15...    102   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_008368928.1|  PREDICTED: probable polygalacturonase At3g15720    102   1e-22   
ref|XP_010472976.1|  PREDICTED: probable polygalacturonase At1g80170    102   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010545769.1|  PREDICTED: probable polygalacturonase At3g15...    102   1e-22   Tarenaya hassleriana [spider flower]
ref|NP_001234256.1|  polygalacturonase                                  102   1e-22   Solanum lycopersicum
ref|NP_195292.2|  pectin lyase-like superfamily protein                 101   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135455.1|  PREDICTED: probable polygalacturonase At3g15720    102   1e-22   Brassica rapa
emb|CDX74418.1|  BnaA04g09710D                                          102   1e-22   
ref|XP_008779497.1|  PREDICTED: polygalacturonase ADPG1-like          99.8    2e-22   Phoenix dactylifera
ref|XP_010259191.1|  PREDICTED: polygalacturonase-like                  101   2e-22   
ref|XP_010551909.1|  PREDICTED: polygalacturonase At1g48100 isofo...    102   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_002887842.1|  hypothetical protein ARALYDRAFT_477239             102   2e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010250040.1|  PREDICTED: probable polygalacturonase At1g80170    102   2e-22   Nelumbo nucifera [Indian lotus]
emb|CAA20037.1|  putative polygalacturonase                             101   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010688006.1|  PREDICTED: probable polygalacturonase At1g80170    101   2e-22   
ref|XP_010551910.1|  PREDICTED: polygalacturonase At1g48100 isofo...    102   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_004486686.1|  PREDICTED: probable polygalacturonase At1g80...    101   2e-22   Cicer arietinum [garbanzo]
ref|XP_004486687.1|  PREDICTED: probable polygalacturonase At1g80...    101   2e-22   Cicer arietinum [garbanzo]
gb|AES71942.2|  polygalacturonase/glycoside hydrolase family protein    101   2e-22   Medicago truncatula
ref|XP_008792138.1|  PREDICTED: probable polygalacturonase At1g80170    103   2e-22   
gb|KHN23520.1|  Polygalacturonase                                       101   2e-22   Glycine soja [wild soybean]
ref|XP_002868688.1|  predicted protein                                  101   2e-22   
gb|AAD55489.1|AC009322_29  Similar to polygalacturonases                101   2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14857.1|  unnamed protein product                                101   2e-22   Coffea canephora [robusta coffee]
ref|NP_565232.1|  putative polygalacturonase                            101   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238091.1|  polygalacturonase PG1 precursor                    101   2e-22   Glycine max [soybeans]
gb|ACU24545.1|  unknown                                                 101   2e-22   Glycine max [soybeans]
gb|KDO61713.1|  hypothetical protein CISIN_1g037736mg                   100   2e-22   Citrus sinensis [apfelsine]
ref|XP_009101636.1|  PREDICTED: probable polygalacturonase At3g15720    100   2e-22   Brassica rapa
ref|XP_010436249.1|  PREDICTED: probable polygalacturonase At3g15720    100   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011007737.1|  PREDICTED: probable polygalacturonase At1g80170    100   3e-22   Populus euphratica
ref|XP_004297904.1|  PREDICTED: probable polygalacturonase At3g15720    101   3e-22   Fragaria vesca subsp. vesca
ref|NP_001056198.1|  Os05g0542800                                       100   3e-22   
ref|XP_002863541.1|  glycoside hydrolase family 28 protein              100   3e-22   
ref|XP_006483708.1|  PREDICTED: probable polygalacturonase At3g15...    101   3e-22   
ref|XP_010468193.1|  PREDICTED: probable polygalacturonase At3g15720  99.0    3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007150725.1|  hypothetical protein PHAVU_005G175800g             101   3e-22   Phaseolus vulgaris [French bean]
gb|AAU43991.1|  unknown protein                                         100   3e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDY47032.1|  BnaAnng08200D                                          100   3e-22   Brassica napus [oilseed rape]
gb|KFK42419.1|  hypothetical protein AALP_AA2G253800                    100   4e-22   Arabis alpina [alpine rockcress]
ref|NP_001168667.1|  hypothetical protein precursor                   99.4    4e-22   
ref|XP_004504535.1|  PREDICTED: probable polygalacturonase At3g15...    100   4e-22   Cicer arietinum [garbanzo]
ref|XP_008385626.1|  PREDICTED: probable polygalacturonase At3g15720    100   4e-22   
emb|CDY30105.1|  BnaC05g37570D                                          100   4e-22   Brassica napus [oilseed rape]
gb|EPS70858.1|  polygalacturonase                                     97.4    4e-22   Genlisea aurea
ref|XP_007011881.1|  Pectin lyase-like superfamily protein, putative    100   4e-22   
ref|XP_002521450.1|  Polygalacturonase precursor, putative              100   4e-22   
ref|XP_008337027.1|  PREDICTED: probable polygalacturonase At3g15720    100   5e-22   
gb|KJB68125.1|  hypothetical protein B456_010G226900                    100   5e-22   Gossypium raimondii
ref|XP_010663872.1|  PREDICTED: probable polygalacturonase At3g15720    100   5e-22   
emb|CDX72553.1|  BnaC07g45750D                                          100   5e-22   
emb|CBI15273.3|  unnamed protein product                                100   5e-22   Vitis vinifera
ref|XP_011072232.1|  PREDICTED: probable polygalacturonase At1g80...    100   5e-22   Sesamum indicum [beniseed]
ref|XP_008240992.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    100   6e-22   
gb|EMT11104.1|  Putative polygalacturonase                            96.7    6e-22   
ref|XP_009413595.1|  PREDICTED: polygalacturonase-like                  100   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007203070.1|  hypothetical protein PRUPE_ppa023489mg             100   6e-22   
ref|XP_009345603.1|  PREDICTED: probable polygalacturonase At3g15720    100   6e-22   
ref|XP_006450449.1|  hypothetical protein CICLE_v10010440mg             100   6e-22   
ref|XP_010086670.1|  putative polygalacturonase                       99.0    6e-22   
ref|XP_011072231.1|  PREDICTED: probable polygalacturonase At1g80...    100   7e-22   Sesamum indicum [beniseed]
gb|ACR38523.1|  unknown                                               99.8    7e-22   Zea mays [maize]
ref|XP_009146202.1|  PREDICTED: probable polygalacturonase At3g15...    100   7e-22   Brassica rapa
gb|ACF88280.1|  unknown                                               99.8    7e-22   Zea mays [maize]
ref|XP_008787364.1|  PREDICTED: probable polygalacturonase At3g15720  99.4    7e-22   
ref|XP_009146201.1|  PREDICTED: probable polygalacturonase At3g15...    100   7e-22   Brassica rapa
emb|CDX85471.1|  BnaA02g03420D                                        99.8    8e-22   
ref|XP_007207616.1|  hypothetical protein PRUPE_ppa019727mg           99.8    8e-22   
gb|ACF80870.1|  unknown                                               99.8    8e-22   Zea mays [maize]
ref|XP_008231375.1|  PREDICTED: probable polygalacturonase At3g15720    100   8e-22   Prunus mume [ume]
ref|XP_004502247.1|  PREDICTED: probable polygalacturonase At3g15...  99.8    8e-22   Cicer arietinum [garbanzo]
ref|XP_011026643.1|  PREDICTED: probable polygalacturonase At3g15720    100   9e-22   Populus euphratica
emb|CDY58462.1|  BnaA03g57500D                                          100   9e-22   Brassica napus [oilseed rape]
ref|XP_006377005.1|  glycoside hydrolase family 28 family protein     99.4    9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009126168.1|  PREDICTED: probable polygalacturonase At3g15720  99.4    1e-21   Brassica rapa
emb|CBI15274.3|  unnamed protein product                              99.0    1e-21   Vitis vinifera
ref|XP_004287324.1|  PREDICTED: probable polygalacturonase At1g80...  99.0    1e-21   Fragaria vesca subsp. vesca
gb|AAC79138.1|  putative polygalacturonase                            99.0    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011656277.1|  PREDICTED: probable polygalacturonase At1g80170  99.0    1e-21   Cucumis sativus [cucumbers]
ref|XP_009392185.1|  PREDICTED: probable polygalacturonase At1g80...  99.8    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009138385.1|  PREDICTED: probable polygalacturonase At3g15720  99.0    1e-21   
gb|EYU21617.1|  hypothetical protein MIMGU_mgv1a018762mg              99.0    1e-21   
ref|XP_003559272.2|  PREDICTED: polygalacturonase ADPG1-like          99.0    2e-21   
gb|AFW78960.1|  polygalacturonase                                     99.8    2e-21   
ref|XP_009385170.1|  PREDICTED: polygalacturonase QRT2-like           99.0    2e-21   
gb|KHN27445.1|  Polygalacturonase                                     99.0    2e-21   
gb|EMS53068.1|  Polygalacturonase                                     98.6    2e-21   
ref|XP_008243390.1|  PREDICTED: probable polygalacturonase At3g15720  99.4    2e-21   
ref|XP_008226539.1|  PREDICTED: polygalacturonase-like                98.6    2e-21   
emb|CDY57689.1|  BnaA07g38300D                                        99.0    2e-21   
ref|XP_006412075.1|  hypothetical protein EUTSA_v10027457mg           98.2    2e-21   
ref|XP_006655543.1|  PREDICTED: probable polygalacturonase At1g80...  98.6    2e-21   
gb|EEC79626.1|  hypothetical protein OsI_20838                        98.6    2e-21   
emb|CDX75843.1|  BnaC03g39260D                                        98.6    3e-21   
emb|CDY54312.1|  BnaC06g43100D                                        98.6    3e-21   
ref|XP_010527121.1|  PREDICTED: probable polygalacturonase At3g15720  98.2    3e-21   
emb|CAN61695.1|  hypothetical protein VITISV_029441                     101   3e-21   
ref|XP_004502365.1|  PREDICTED: probable polygalacturonase At3g15...  98.2    3e-21   
ref|XP_009104448.1|  PREDICTED: probable polygalacturonase At1g80170  98.6    3e-21   
ref|NP_566524.1|  probable polygalacturonase                          98.6    3e-21   
emb|CDX69569.1|  BnaA10g19180D                                        98.6    3e-21   
emb|CDY02729.1|  BnaC02g07060D                                        98.2    3e-21   
ref|XP_002980174.1|  hypothetical protein SELMODRAFT_112735           98.6    3e-21   
emb|CDX97703.1|  BnaA05g23760D                                        98.6    3e-21   
ref|XP_006286100.1|  hypothetical protein CARUB_v10007643mg           97.8    3e-21   
gb|KEH23656.1|  endo polygalacturonase                                97.8    4e-21   
ref|NP_001078162.1|  probable polygalacturonase                       98.6    4e-21   
ref|NP_001151886.1|  polygalacturonase precursor                      97.8    4e-21   
ref|XP_004489256.1|  PREDICTED: polygalacturonase At1g48100-like      97.8    4e-21   
ref|XP_010921896.1|  PREDICTED: probable polygalacturonase At1g80170  98.2    4e-21   
emb|CDX97704.1|  BnaA05g23750D                                        98.2    4e-21   
ref|XP_004502364.1|  PREDICTED: probable polygalacturonase At3g15...  97.8    4e-21   
ref|XP_003567980.1|  PREDICTED: probable polygalacturonase At1g80170  98.2    4e-21   
ref|XP_002440167.1|  hypothetical protein SORBIDRAFT_09g027150        97.8    4e-21   
emb|CDY09873.1|  BnaC09g42880D                                        98.2    4e-21   
ref|XP_006406925.1|  hypothetical protein EUTSA_v10020740mg           98.2    4e-21   
ref|XP_002963148.1|  hypothetical protein SELMODRAFT_78038            98.2    4e-21   
ref|XP_004305760.2|  PREDICTED: probable polygalacturonase At3g15720  97.4    4e-21   
ref|XP_009146203.1|  PREDICTED: probable polygalacturonase At3g15720  98.2    5e-21   
ref|XP_007214724.1|  hypothetical protein PRUPE_ppa026186mg           97.4    5e-21   
ref|XP_006296610.1|  hypothetical protein CARUB_v10013685mg           98.2    5e-21   
emb|CDY30107.1|  BnaC05g37550D                                        98.2    5e-21   
ref|XP_008787363.1|  PREDICTED: probable polygalacturonase At3g15720  97.1    6e-21   
ref|XP_010266762.1|  PREDICTED: probable polygalacturonase At3g15720  97.8    6e-21   
ref|XP_011659531.1|  PREDICTED: probable polygalacturonase At1g80170  97.4    7e-21   
ref|XP_004961348.1|  PREDICTED: probable polygalacturonase At1g80...  98.2    7e-21   
ref|XP_006389764.1|  hypothetical protein EUTSA_v10018548mg           97.4    8e-21   
emb|CBI36307.3|  unnamed protein product                              97.1    8e-21   
gb|KDO72475.1|  hypothetical protein CISIN_1g041470mg                 96.7    8e-21   
ref|XP_004141101.1|  PREDICTED: polygalacturonase At1g48100           97.8    8e-21   
ref|XP_008461095.1|  PREDICTED: probable polygalacturonase At1g80...  97.4    8e-21   
ref|XP_008443532.1|  PREDICTED: polygalacturonase At1g48100           97.8    9e-21   
ref|XP_010241947.1|  PREDICTED: polygalacturonase ADPG1-like          97.8    9e-21   
ref|XP_008461096.1|  PREDICTED: probable polygalacturonase At1g80...  97.1    9e-21   
ref|XP_010487407.1|  PREDICTED: probable polygalacturonase At3g15...  97.4    9e-21   
ref|XP_006289862.1|  hypothetical protein CARUB_v10003473mg           97.1    9e-21   
ref|XP_002885106.1|  glycoside hydrolase family 28 protein            97.4    1e-20   
ref|XP_002517618.1|  polygalacturonase, putative                      99.0    1e-20   
ref|XP_009121648.1|  PREDICTED: polygalacturonase At1g48100 isofo...  97.1    1e-20   
ref|XP_009121649.1|  PREDICTED: polygalacturonase At1g48100 isofo...  97.1    1e-20   
gb|KJB11522.1|  hypothetical protein B456_001G263400                  97.1    1e-20   
ref|XP_011098761.1|  PREDICTED: polygalacturonase At1g48100           97.1    1e-20   
ref|XP_006399978.1|  hypothetical protein EUTSA_v10013501mg           97.1    1e-20   
ref|XP_010319103.1|  PREDICTED: probable polygalacturonase At3g15720  95.5    1e-20   
ref|XP_008811864.1|  PREDICTED: probable polygalacturonase At1g80170  96.7    2e-20   
ref|XP_009365411.1|  PREDICTED: probable polygalacturonase At3g15720  97.8    2e-20   
gb|KEH27752.1|  polygalacturonase                                     96.3    2e-20   
ref|XP_002266543.3|  PREDICTED: probable polygalacturonase At3g15720  95.5    2e-20   
ref|XP_003552026.1|  PREDICTED: polygalacturonase At1g48100-like ...  97.1    2e-20   
ref|NP_197222.1|  pectin lyase-like superfamily protein               95.9    2e-20   
gb|EMT16221.1|  Putative polygalacturonase                            95.9    2e-20   
ref|XP_003549272.1|  PREDICTED: probable polygalacturonase At3g15...  96.7    2e-20   
ref|XP_009334648.1|  PREDICTED: probable polygalacturonase At3g15720  95.5    2e-20   
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative  95.9    3e-20   
ref|XP_009595648.1|  PREDICTED: probable polygalacturonase At3g15...  95.1    3e-20   
ref|XP_006838303.1|  PREDICTED: polygalacturonase                     96.3    3e-20   
ref|XP_006840713.2|  PREDICTED: probable polygalacturonase At1g80170  95.9    3e-20   
gb|KFK44434.1|  hypothetical protein AALP_AA1G256100                  95.9    3e-20   
gb|ERN02388.1|  hypothetical protein AMTR_s00096p00099360             95.9    3e-20   
ref|XP_008645203.1|  PREDICTED: probable polygalacturonase At1g80170  96.3    3e-20   
ref|XP_006391965.1|  hypothetical protein EUTSA_v10023928mg           95.1    3e-20   
gb|KFK44652.1|  hypothetical protein AALP_AA1G286400                  95.1    3e-20   
ref|XP_006416734.1|  hypothetical protein EUTSA_v10009641mg           95.1    4e-20   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...  95.1    4e-20   
ref|XP_011099731.1|  PREDICTED: probable polygalacturonase At3g15720  95.1    4e-20   
ref|XP_009623533.1|  PREDICTED: putative pentatricopeptide repeat...  97.8    4e-20   
gb|KEH18028.1|  pectin lyase superfamily protein                      94.7    4e-20   
gb|KEH39601.1|  polygalacturonase                                     94.4    4e-20   
gb|AES96173.2|  polygalacturonase                                     96.3    5e-20   
ref|XP_008230581.1|  PREDICTED: polygalacturonase At1g48100           95.9    5e-20   
gb|KEH18030.1|  polygalacturonase                                     94.7    5e-20   
ref|XP_010540961.1|  PREDICTED: probable polygalacturonase At3g15720  94.7    5e-20   
ref|XP_010102536.1|  hypothetical protein L484_018006                 95.5    5e-20   
ref|XP_010667060.1|  PREDICTED: polygalacturonase-like isoform X2     94.4    5e-20   
ref|XP_006367078.1|  PREDICTED: probable polygalacturonase At1g80...  94.7    5e-20   
gb|EYU44763.1|  hypothetical protein MIMGU_mgv1a018728mg              95.1    5e-20   
ref|XP_002873816.1|  glycoside hydrolase family 28 protein            94.7    5e-20   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like             94.7    5e-20   
ref|XP_010420111.1|  PREDICTED: polygalacturonase At1g48100-like      95.1    5e-20   
ref|XP_003531999.2|  PREDICTED: polygalacturonase At1g48100 isofo...  96.3    6e-20   
gb|KHN26888.1|  Polygalacturonase                                     95.9    6e-20   
ref|XP_010552649.1|  PREDICTED: probable polygalacturonase At1g80170  95.1    6e-20   
ref|XP_002869071.1|  glycoside hydrolase family 28 protein            94.4    6e-20   
ref|XP_009595647.1|  PREDICTED: probable polygalacturonase At3g15...  94.0    7e-20   
ref|XP_004959739.1|  PREDICTED: polygalacturonase-like                95.1    7e-20   
ref|XP_010667059.1|  PREDICTED: polygalacturonase-like isoform X1     94.4    7e-20   
gb|EPS62761.1|  hypothetical protein M569_12028                       92.8    8e-20   
gb|KEH41561.1|  endo polygalacturonase                                94.7    8e-20   
ref|XP_011001322.1|  PREDICTED: probable polygalacturonase At3g15720  94.0    8e-20   
ref|XP_006281692.1|  hypothetical protein CARUB_v10027840mg           94.0    8e-20   
ref|XP_010465560.1|  PREDICTED: probable polygalacturonase At3g15...  94.7    8e-20   
dbj|BAH56488.1|  polygalacturonase 1                                  95.1    8e-20   
ref|XP_007217288.1|  hypothetical protein PRUPE_ppa018113mg           95.1    9e-20   
gb|KHG25769.1|  hypothetical protein F383_09976                       94.0    1e-19   
ref|XP_010453903.1|  PREDICTED: probable polygalacturonase At3g15...  94.0    1e-19   
ref|XP_002512560.1|  Polygalacturonase precursor, putative            94.4    1e-19   
dbj|BAK07253.1|  predicted protein                                    94.0    1e-19   
gb|KEH23657.1|  endo polygalacturonase                                94.4    1e-19   
emb|CDY11585.1|  BnaC06g31540D                                        94.4    1e-19   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like             93.6    1e-19   
ref|XP_009105713.1|  PREDICTED: probable polygalacturonase At1g80170  94.4    1e-19   
ref|XP_009769209.1|  PREDICTED: polygalacturonase At1g48100 isofo...  94.0    1e-19   
ref|XP_010324136.1|  PREDICTED: exopolygalacturonase-like             93.2    1e-19   
emb|CDY47139.1|  BnaA08g05440D                                        94.4    1e-19   
ref|XP_004493509.1|  PREDICTED: polygalacturonase-like                94.0    1e-19   
ref|NP_177961.2|  pectin lyase-like superfamily protein               93.6    1e-19   
ref|XP_003597864.1|  hypothetical protein MTR_2g103410                94.0    1e-19   
gb|AAF71796.1|AC013430_5  F3F9.9                                      93.6    1e-19   
emb|CDP18643.1|  unnamed protein product                              94.0    2e-19   
ref|XP_009418868.1|  PREDICTED: polygalacturonase ADPG1-like          93.2    2e-19   
emb|CDP21874.1|  unnamed protein product                              94.4    2e-19   
ref|XP_007153746.1|  hypothetical protein PHAVU_003G061600g           94.4    2e-19   
gb|AAN60351.1|  unknown                                               90.9    2e-19   
emb|CDY54292.1|  BnaC07g48330D                                        93.6    2e-19   
ref|XP_010233146.1|  PREDICTED: uncharacterized protein LOC100829282  95.5    2e-19   
ref|XP_006648280.1|  PREDICTED: probable polygalacturonase At1g80...  94.4    2e-19   
gb|EYU24653.1|  hypothetical protein MIMGU_mgv1a022836mg              93.2    2e-19   
gb|EEC81719.1|  hypothetical protein OsI_25337                        93.2    2e-19   
ref|XP_010682533.1|  PREDICTED: polygalacturonase At1g48100           94.4    2e-19   
ref|NP_001238104.1|  polygalacturonase PG2 precursor                  93.2    2e-19   
ref|XP_008226204.1|  PREDICTED: probable polygalacturonase At3g15720  94.7    2e-19   
ref|XP_003566989.1|  PREDICTED: polygalacturonase-like                93.2    2e-19   
dbj|BAB20805.2|  polygalacturonase                                    93.2    2e-19   
ref|XP_006406924.1|  hypothetical protein EUTSA_v10021935mg           92.4    3e-19   
gb|KJB30152.1|  hypothetical protein B456_005G131300                  92.0    3e-19   
ref|XP_008454242.1|  PREDICTED: probable polygalacturonase At3g15720  92.4    3e-19   
ref|XP_006470302.1|  PREDICTED: polygalacturonase At1g48100-like      93.2    3e-19   
gb|KJB33647.1|  hypothetical protein B456_006G023900                  92.4    4e-19   
gb|KEH33932.1|  polygalacturonase/glycoside hydrolase family protein  92.4    4e-19   
ref|XP_010030771.1|  PREDICTED: probable polygalacturonase At1g80170  92.4    4e-19   
ref|XP_007134324.1|  hypothetical protein PHAVU_010G037800g           91.7    4e-19   
ref|XP_009614195.1|  PREDICTED: probable polygalacturonase At3g15720  92.0    4e-19   
gb|KJB33651.1|  hypothetical protein B456_006G024200                  92.4    4e-19   
gb|KJB33653.1|  hypothetical protein B456_006G024400                  92.0    4e-19   
ref|NP_173760.2|  polygalacturonase                                   92.8    4e-19   
emb|CDY25786.1|  BnaA07g09960D                                        92.4    5e-19   
ref|XP_003566446.1|  PREDICTED: polygalacturonase-like                92.0    5e-19   
ref|XP_011078328.1|  PREDICTED: polygalacturonase-like isoform X3     91.3    5e-19   
gb|KDO82376.1|  hypothetical protein CISIN_1g0424472mg                89.7    5e-19   
ref|XP_009598055.1|  PREDICTED: probable polygalacturonase At3g15720  92.4    5e-19   
ref|XP_009103175.1|  PREDICTED: probable polygalacturonase At1g80...  92.4    6e-19   
ref|XP_010453593.1|  PREDICTED: polygalacturonase At1g48100-like      92.4    6e-19   
emb|CCG48006.1|  polygalacturonase, putative, expressed               92.4    6e-19   
ref|XP_009103174.1|  PREDICTED: probable polygalacturonase At1g80...  92.4    6e-19   
ref|XP_010451040.1|  PREDICTED: probable polygalacturonase At3g15720  91.7    6e-19   
ref|XP_009416030.1|  PREDICTED: polygalacturonase-like                91.7    6e-19   
ref|XP_002448332.1|  hypothetical protein SORBIDRAFT_06g025345        91.7    6e-19   
ref|XP_006391964.1|  hypothetical protein EUTSA_v10023886mg           91.7    6e-19   
ref|XP_003632896.1|  PREDICTED: probable polygalacturonase At3g15720  91.7    6e-19   
ref|XP_010033946.1|  PREDICTED: probable polygalacturonase At1g80...  91.7    7e-19   
ref|XP_006350314.1|  PREDICTED: polygalacturonase At1g48100-like      92.4    7e-19   
ref|XP_006654730.1|  PREDICTED: probable polygalacturonase At1g80...  92.0    7e-19   
ref|XP_010548804.1|  PREDICTED: polygalacturonase QRT2                91.7    7e-19   
gb|KFK35000.1|  hypothetical protein AALP_AA5G221100                  91.7    8e-19   
emb|CAN78059.1|  hypothetical protein VITISV_006092                   91.7    8e-19   
gb|EEE56238.1|  hypothetical protein OsJ_05243                        89.7    8e-19   
ref|XP_006856225.1|  PREDICTED: exopolygalacturonase                  91.3    9e-19   
gb|KHG04134.1|  hypothetical protein F383_30138                       91.7    9e-19   
gb|AAC02763.1|  putative polygalacturonase                            91.7    9e-19   
ref|XP_001755021.1|  predicted protein                                91.7    9e-19   
ref|XP_010659391.1|  PREDICTED: polygalacturonase-like isoform X2     91.7    9e-19   
ref|XP_010251216.1|  PREDICTED: probable polygalacturonase At1g80170  92.0    1e-18   
ref|NP_001151374.1|  polygalacturonase precursor                      91.3    1e-18   
ref|XP_007044684.1|  Pectin lyase-like superfamily protein            92.4    1e-18   
ref|XP_002874953.1|  glycoside hydrolase family 28 protein            92.0    1e-18   
dbj|BAJ99726.1|  predicted protein                                    91.7    1e-18   
emb|CBI24903.3|  unnamed protein product                              91.3    1e-18   
ref|XP_006290192.1|  hypothetical protein CARUB_v10003877mg           91.7    1e-18   
ref|XP_002529089.1|  Polygalacturonase precursor, putative            90.9    1e-18   
ref|XP_011024398.1|  PREDICTED: probable polygalacturonase At1g80170  91.3    1e-18   
ref|XP_006302097.1|  hypothetical protein CARUB_v10020088mg           92.4    1e-18   
ref|NP_196969.1|  pectin lyase-like superfamily protein               91.3    1e-18   
dbj|BAC57279.1|  putative polygalacturonase PG1                       91.3    1e-18   
ref|XP_003633562.2|  PREDICTED: polygalacturonase-like isoform X1     91.7    1e-18   
ref|NP_850359.1|  polygalacturonase ADPG2                             91.3    1e-18   
ref|XP_010937534.1|  PREDICTED: polygalacturonase-like                92.4    1e-18   
ref|XP_004498965.1|  PREDICTED: probable polygalacturonase At3g15...  90.9    1e-18   
ref|XP_011458024.1|  PREDICTED: polygalacturonase-like isoform X2     91.3    1e-18   
gb|AFW83378.1|  hypothetical protein ZEAMMB73_073291                  89.7    1e-18   
gb|AAL84942.1|  At2g41850/T11A7.5                                     91.3    1e-18   
emb|CDY14791.1|  BnaC04g47880D                                        91.3    1e-18   
gb|AFW83380.1|  hypothetical protein ZEAMMB73_073291                  89.7    1e-18   
ref|XP_009765961.1|  PREDICTED: probable polygalacturonase At1g80170  91.3    1e-18   
gb|EPS67779.1|  polygalacturonase                                     91.7    1e-18   
ref|XP_012081934.1|  PREDICTED: polygalacturonase-like                90.5    1e-18   
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative  90.9    1e-18   
ref|XP_010033943.1|  PREDICTED: probable polygalacturonase At1g80...  91.3    2e-18   
ref|XP_010044612.1|  PREDICTED: polygalacturonase At1g48100-like      91.7    2e-18   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  90.5    2e-18   
ref|XP_003559271.2|  PREDICTED: polygalacturonase ADPG1-like          90.5    2e-18   
emb|CDY04709.1|  BnaC05g18800D                                        88.6    2e-18   
ref|XP_006483889.1|  PREDICTED: probable polygalacturonase At1g80...  90.9    2e-18   
gb|EMT24271.1|  Polygalacturonase                                     90.5    2e-18   
ref|XP_009368885.1|  PREDICTED: polygalacturonase-like                90.9    2e-18   
ref|NP_001045783.1|  Os02g0130200                                     91.7    2e-18   
ref|XP_010537987.1|  PREDICTED: probable polygalacturonase At1g80...  90.5    2e-18   
ref|XP_006483888.1|  PREDICTED: probable polygalacturonase At1g80...  91.3    2e-18   
ref|XP_010492279.1|  PREDICTED: polygalacturonase At1g48100-like      91.3    2e-18   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like             90.5    2e-18   
ref|XP_004489829.1|  PREDICTED: polygalacturonase At1g48100-like      91.7    2e-18   
ref|XP_004986167.1|  PREDICTED: polygalacturonase-like                90.9    2e-18   



>ref|XP_009606258.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
 ref|XP_009606259.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana tomentosiformis]
Length=420

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 98/139 (71%), Gaps = 10/139 (7%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVS-------CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            Y+M+  V LFILGL ++SR+S         SFNV+DYGA  DG+TDDSQAFLNAW DACS
Sbjct  8    YTMKTLVLLFILGL-TNSRISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACS  66

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  404
            S     SP+VIIP    FL+ PV F GPC S++I+F++SG +VAP SP  W G D SQWL
Sbjct  67   S--AGGSPEVIIPPNMIFLLSPVTFRGPCNSENIYFVISGRLVAPSSPGIWTGQDASQWL  124

Query  405  SFNGVYGLIVNGGGVIDGQ  461
            +F  V GLIV+G G IDGQ
Sbjct  125  AFRNVSGLIVDGSGTIDGQ  143



>ref|XP_009767751.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
 ref|XP_009767752.1| PREDICTED: polygalacturonase QRT2-like [Nicotiana sylvestris]
Length=418

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 96/138 (70%), Gaps = 8/138 (6%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISS--SRVS----CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            Y+M+  V LFILGL +S  S  S      SFNV+DYGA  DG+TDDSQAFLNAW DACSS
Sbjct  8    YTMKTLVILFILGLRNSGISYASIIGYAGSFNVLDYGAAADGITDDSQAFLNAWNDACSS  67

Query  228  TPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLS  407
                 SP+VIIP    FL+ P+ F GPC S++I+F++SG +VAP SP  W G D SQWL+
Sbjct  68   --AGGSPEVIIPPNMIFLLSPLTFRGPCNSENIYFVISGRLVAPSSPAIWTGEDASQWLA  125

Query  408  FNGVYGLIVNGGGVIDGQ  461
            F  V GLIV+G G IDGQ
Sbjct  126  FRNVSGLIVDGSGTIDGQ  143



>ref|XP_006345284.1| PREDICTED: polygalacturonase QRT2-like [Solanum tuberosum]
Length=439

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 9/138 (7%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSS  227
            ++++ V LFIL  +++SR+   S       FNV+DYGA  DG+TDDSQA LN W DACSS
Sbjct  32   ALKILVLLFILIGLTNSRIYSASIFGYPGSFNVLDYGAAADGITDDSQALLNTWNDACSS  91

Query  228  TPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLS  407
            +    SPQVIIP    FL+ PV   GPC S++++F++SG++V+P SP  W G D+SQWL+
Sbjct  92   SA--GSPQVIIPPNMIFLLSPVTLTGPCNSENLYFVISGSLVSPSSPSVWTGQDSSQWLA  149

Query  408  FNGVYGLIVNGGGVIDGQ  461
            FN V GL+V+G G IDGQ
Sbjct  150  FNNVSGLVVDGSGTIDGQ  167



>ref|XP_004252072.1| PREDICTED: polygalacturonase QRT2 [Solanum lycopersicum]
Length=416

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 96/139 (69%), Gaps = 9/139 (6%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            Y+M+  VFLFIL  +S+SR+   S       FNV+DYGA  DG+TDDSQA LN W DACS
Sbjct  8    YTMKNLVFLFILIGLSNSRIYSASIYGYPGSFNVLDYGAAADGITDDSQALLNTWNDACS  67

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  404
            S+  +  PQVIIP    FL+ P+   GPC SQ+I+F+VSG++V+P SP  W G D+SQWL
Sbjct  68   SSAGY--PQVIIPPNMIFLLSPMTLIGPCNSQNIYFVVSGSLVSPSSPSVWTGQDSSQWL  125

Query  405  SFNGVYGLIVNGGGVIDGQ  461
            +F  V GL+V G G IDGQ
Sbjct  126  AFRNVSGLVVGGSGTIDGQ  144



>gb|EYU23048.1| hypothetical protein MIMGU_mgv1a026845mg, partial [Erythranthe 
guttata]
Length=383

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV+DYGA GDG+TDDSQAFL AW+ AC++  + + P++ +P  STFLV P+ F GPC S
Sbjct  6    FNVMDYGATGDGLTDDSQAFLEAWEAACNA--LVEFPKIYVPEESTFLVNPISFYGPCNS  63

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              I+F +SGT++AP SP  WNG D SQWL F  V GL ++G GV DG+
Sbjct  64   PTINFKISGTIIAPESPDVWNGRDASQWLGFEHVDGLKIDGYGVFDGR  111



>ref|XP_011078321.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078322.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078324.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
 ref|XP_011078325.1| PREDICTED: polygalacturonase QRT2-like isoform X1 [Sesamum indicum]
Length=408

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +F+F     L+++  +   +FNV+DYGA  D +TDDSQAFL AW DACS++   +S +V 
Sbjct  10   IFLFTSATSLLNAHEIDEDNFNVMDYGATSDDLTDDSQAFLEAWDDACSASV--ESSRVY  67

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            +PA  TF+V P+ F+GPC +  I+F +SG ++AP SP  W+G D SQWL F  V GL V+
Sbjct  68   VPAEKTFVVDPITFHGPCYASTINFAISGRIMAPESPSSWDGGDASQWLGFKNVNGLKVD  127

Query  438  --GGGVIDGQ  461
              G G+IDGQ
Sbjct  128  GFGFGLIDGQ  137



>gb|KDO45206.1| hypothetical protein CISIN_1g047411mg [Citrus sinensis]
Length=226

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +3

Query  75   EVFVFLFILGLISSS--RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ++   L+ L LIS++  R++   FNV+D+GA GDG  DDS AF+ AW + CS+T   KSP
Sbjct  4    DLCAILYFLYLISTASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCSATA--KSP  61

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP G TFLV P+ F GPCKS  I  ++SG+++AP  P  W   D S+W     V  L
Sbjct  62   TMVIPKGKTFLVHPITFTGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWFDIQSVDSL  121

Query  429  IVNGGGVIDGQ  461
             ++G G IDG+
Sbjct  122  QIDGSGTIDGR  132



>ref|XP_003540568.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 7/134 (5%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSR-----VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            + +F  L+++   S SR     ++  +FNV+DYGA GDG+TDDSQAFL AW   C+    
Sbjct  5    IAIFFLLYLVSHCSCSRLREAAINLNTFNVMDYGAIGDGLTDDSQAFLKAWSMVCAMK--  62

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
            + +  + +P G TF++KP+QF+GPC    +HF + G VVAP S   W G D+S+W+ F+ 
Sbjct  63   NGAATLKVPPGKTFMLKPLQFSGPCSFSSVHFQLEGDVVAPKSTEAWKGQDSSKWIDFSN  122

Query  417  VYGLIVNGGGVIDG  458
            V GLI++GGG IDG
Sbjct  123  VDGLIIDGGGQIDG  136



>ref|XP_003545181.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=402

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 7/134 (5%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRV-----SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            + +F  L+++   S SR+     +  +FNV+DYGA GDG+TDDSQAFL AW   C+    
Sbjct  5    IAIFFVLYLVSHCSCSRIREAAINLYTFNVMDYGAIGDGLTDDSQAFLKAWSMVCAMK--  62

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
            + +  + +P G TF++KP+QF+GPC    +HF + G VVAP S   W G D+S+W+ F+ 
Sbjct  63   NGAATLKVPPGKTFMLKPLQFSGPCSFSSVHFQLEGDVVAPKSTEAWKGQDSSKWIDFSN  122

Query  417  VYGLIVNGGGVIDG  458
            V GLI++GGG IDG
Sbjct  123  VDGLIIDGGGQIDG  136



>ref|XP_006465486.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=715

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  72   MEVFVFLFILGLISSS--RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
             ++   L+ L LIS++  R++   FNV+D+GA GDG  DDS AF+ AW + CS+T   KS
Sbjct  3    QDLSAILYFLCLISTASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCSATA--KS  60

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P ++IP G TFLV+P+ F GPCKS  I  ++SG+++AP  P  W   D S+W    GV  
Sbjct  61   PTMVIPKGKTFLVRPITFAGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWFEIQGVDS  120

Query  426  LIVNGGGVIDGQ  461
            L ++G G IDG+
Sbjct  121  LQIDGSGTIDGR  132


 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 77/133 (58%), Gaps = 3/133 (2%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            F+ + + + +  LG  S S      +NV+++GA G+G+TDDSQAF+ AW   C  T    
Sbjct  330  FFIISLLMRMATLGW-SRSYPGAMPYNVMNFGAVGNGVTDDSQAFIKAWNAVCGDTS--N  386

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +P + +P G TFL++P  F GPCKS ++   + G ++AP  P  W G D   WL F  V 
Sbjct  387  NPTLQVPQGKTFLLQPTSFQGPCKSSNLQVQIEGNLIAPEGPSSWKGKDRRSWLYFVNVN  446

Query  423  GLIVNGGGVIDGQ  461
            G  VNG G IDGQ
Sbjct  447  GFTVNGNGEIDGQ  459



>gb|KHG17941.1| hypothetical protein F383_07844 [Gossypium arboreum]
Length=402

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (66%), Gaps = 3/131 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S+ +   + ++ L++ S +S K FNV+ YGA G+G+TDDS AF+ AWKD CS      S 
Sbjct  3    SLSISYAICVVSLLTIS-ISAKEFNVLSYGASGNGITDDSLAFMKAWKDTCSEAA--SSA  59

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP G  FLV P+ F GPCKS  I+ ++SGT++AP  P  WN  D S WL+F GV GL
Sbjct  60   SLVIPKGKQFLVHPLIFTGPCKSGTINVMLSGTILAPNGPDQWNASDLSTWLAFEGVNGL  119

Query  429  IVNGGGVIDGQ  461
             ++G G IDG+
Sbjct  120  SISGFGTIDGR  130



>gb|KJB70601.1| hypothetical protein B456_011G082400 [Gossypium raimondii]
Length=402

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S+ +    +++ L++   +S K FNV+ YGA G+G+TDDS AF+ AWKD CS      S 
Sbjct  3    SLSISYAFYVVSLLTIC-ISAKEFNVLSYGASGNGITDDSLAFMKAWKDTCSEAA--SSA  59

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP G  FLV P+ F GPCKS  I+ ++SGT++AP  P  WN  D S WL+F GV GL
Sbjct  60   TLVIPKGKQFLVHPLIFTGPCKSGAINVMLSGTILAPNGPDQWNASDLSTWLAFEGVTGL  119

Query  429  IVNGGGVIDGQ  461
             ++G G IDG+
Sbjct  120  SISGFGTIDGR  130



>ref|XP_006427258.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
 gb|ESR40498.1| hypothetical protein CICLE_v10026919mg, partial [Citrus clementina]
Length=406

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 82/139 (59%), Gaps = 7/139 (5%)
 Frame = +3

Query  60   CFYS-----MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            CF S     + VF F       +S R++   FNV+D+GA GDG  DDS AF+ AW + CS
Sbjct  1    CFNSKLSGLISVFAFCMSSMCYASIRINADEFNVLDFGAAGDGNADDSMAFIKAWNNTCS  60

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  404
            +T   KSP ++IP G TFLV P+ F GPCKS  I  ++SG+++AP  P  W   D S+W 
Sbjct  61   ATA--KSPTMVIPKGKTFLVHPITFTGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWF  118

Query  405  SFNGVYGLIVNGGGVIDGQ  461
                V  L ++G G IDG+
Sbjct  119  DIQSVDSLQIDGSGTIDGR  137



>ref|XP_006845770.1| PREDICTED: probable polygalacturonase At1g80170 [Amborella trichopoda]
 gb|ERN07445.1| hypothetical protein AMTR_s00019p00250890 [Amborella trichopoda]
Length=396

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = +3

Query  108  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  287
            +S S  + KSF+V+DYGAKGDGM DD+ AF  AW  ACS+     SP++IIP+G+ F V 
Sbjct  16   LSDSTSTSKSFDVMDYGAKGDGMKDDTDAFAKAWNAACSA---KGSPEMIIPSGNLFRVG  72

Query  288  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            P+QF GPC+S H+H  V G +V P  P  W G     WL F+ V GLIV+G G IDG 
Sbjct  73   PIQFTGPCESNHVHVTVEGDIVGP-PPSSWKGASKETWLVFSHVNGLIVDGSGKIDGH  129



>ref|XP_011093565.1| PREDICTED: probable polygalacturonase At1g80170 [Sesamum indicum]
Length=406

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 85/137 (62%), Gaps = 9/137 (7%)
 Frame = +3

Query  72   MEVF-VFLFILGLISSSRVSCK------SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            M+ F V LF+ GL S              FNV+DYGA  DG TDDS+AF+ AW  ACS+ 
Sbjct  1    MDTFGVLLFLYGLASLHLTHSNLCTIEDHFNVMDYGATSDGYTDDSRAFVEAWNAACSAP  60

Query  231  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  410
               + P+VI+P   TFLV PV F+GPC +  I+F +SG ++AP SP  W+G D SQWL F
Sbjct  61   T--QYPKVIVPPEKTFLVNPVIFHGPCDASTINFEISGRLMAPKSPSLWDGKDASQWLGF  118

Query  411  NGVYGLIVNGGGVIDGQ  461
              V GL V+G G IDGQ
Sbjct  119  KDVSGLNVDGFGSIDGQ  135



>ref|XP_003607885.1| hypothetical protein MTR_4g084050 [Medicago truncatula]
 gb|ABC75354.1| Glycoside hydrolase, family 28 [Medicago truncatula]
 gb|AES90082.1| polygalacturonase [Medicago truncatula]
Length=394

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 82/129 (64%), Gaps = 5/129 (4%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVII  260
            +F+  L  + +S   C++ FNV+ YGAKGDG TDDS AF NAW+D C ST    +P +II
Sbjct  4    LFVLCLIFVIASPCLCQNYFNVVKYGAKGDGHTDDSNAFTNAWQDVCGST--RDTPTLII  61

Query  261  PAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPG--WNGLDTSQWLSFNGVYGLIV  434
            P G  F+++P+ F GPCKS  I   + GT+ AP S     W+  D   W+ F+ + GLI+
Sbjct  62   PEGQNFMLQPLSFQGPCKSTTISVKIMGTITAPQSNANWKWDDNDGDYWIKFSNINGLII  121

Query  435  NGGGVIDGQ  461
            NGGG +DGQ
Sbjct  122  NGGGTVDGQ  130



>ref|XP_010254486.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=466

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 7/131 (5%)
 Frame = +3

Query  84   VFLFILGLIS-----SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            V LF+LGL S      +     SF+V+DYGA GDG TDDS+AFL AW   CSS      P
Sbjct  14   VLLFVLGLCSMPVCLDAAGDSTSFSVLDYGAAGDGQTDDSKAFLEAWNAMCSSRST-DIP  72

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             +++P G TFLVKPV F GPC +++++  + G+++AP +   W G+D ++W++FN V GL
Sbjct  73   IMVVPEGKTFLVKPVNFYGPCLAKNVNVQIMGSIIAPNTIKEWEGVD-ARWMAFNNVSGL  131

Query  429  IVNGGGVIDGQ  461
             V+G G IDG+
Sbjct  132  SVSGSGTIDGR  142



>ref|XP_004502362.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
 ref|XP_004502363.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=395

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 11/136 (8%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKS-----FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            +F  L +  + S S V   +     FNV  YGAKGDG+ DDS AFL AW+D C++     
Sbjct  4    LFAILLLFFIASPSLVKINAANDLCFNVFQYGAKGDGVADDSNAFLKAWQDVCAA---ED  60

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFN  413
            +P + IP GSTF+++PV F+GPCKS  ++ ++ GT++APGS   W+     +T  W+ F 
Sbjct  61   TPTLFIPDGSTFMLQPVSFSGPCKSATVNVVLEGTLLAPGSVENWDWTTSRNTEAWIQFR  120

Query  414  GVYGLIVNGGGVIDGQ  461
             + GL+V GGG IDGQ
Sbjct  121  HINGLVVYGGGTIDGQ  136



>ref|XP_004486675.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=404

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 86/134 (64%), Gaps = 3/134 (2%)
 Frame = +3

Query  63   FYSMEVF-VFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            F +ME+F   L I+ +I     S  +FNV+ YGA GDG  +DS AF+ AWKD C S    
Sbjct  2    FDTMELFFTVLMIMSMIKPGLSSTTTFNVLQYGAIGDGKNNDSPAFVKAWKDVCQSK--S  59

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
             +  +IIPA  TFL++P+ FNGPC S++I+  +SG +VAP +   ++G   + W+ F+ V
Sbjct  60   DTSHLIIPATKTFLLRPITFNGPCNSKYIYIQISGNIVAPKTKSEYSGSHINTWIGFSFV  119

Query  420  YGLIVNGGGVIDGQ  461
             GLI++G G IDG+
Sbjct  120  NGLIISGKGTIDGR  133



>ref|XP_003597886.1| Polygalacturonase [Medicago truncatula]
 gb|AES68137.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=404

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 86/134 (64%), Gaps = 3/134 (2%)
 Frame = +3

Query  63   FYSMEVF-VFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            F++ME F   L IL +         +FNV+ YGA GDG T+DS AFL AWKD C+S    
Sbjct  2    FHTMEYFFTLLMILSMFKLGLSITTTFNVLQYGAVGDGKTNDSPAFLKAWKDVCNSK--S  59

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
             + ++IIPA  TFL++P+ F GPCKS +I+  +SG ++AP +   ++G   + W+ F+ V
Sbjct  60   GTSRLIIPAAKTFLLRPIAFRGPCKSNYIYIELSGNIIAPKTKSEYSGSPINTWIGFSFV  119

Query  420  YGLIVNGGGVIDGQ  461
             GLI++G G +DG+
Sbjct  120  NGLIISGKGTVDGR  133



>ref|XP_010318778.1| PREDICTED: probable polygalacturonase At3g15720 [Solanum lycopersicum]
Length=407

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 8/134 (6%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            FY +   V L I+  + S+ +  K+FNVID+GA GDG TDD  AFL AW+  C S    +
Sbjct  8    FYLVTFLVLLCIVSSVRSADI--KTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS----E  61

Query  243  SPQVI--IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
            S +VI  IP    FL+KP +F+GPCK   IH  VSG ++AP S   W+G  T+ WL+F  
Sbjct  62   SSRVILVIPKRKKFLLKPSEFDGPCKPSSIHIQVSGNIIAPNSKSAWDGAATNAWLTFAN  121

Query  417  VYGLIVNGGGVIDG  458
            +  L VNG GV DG
Sbjct  122  IDHLTVNGNGVFDG  135



>ref|XP_006364236.1| PREDICTED: probable polygalacturonase At3g15720-like [Solanum 
tuberosum]
Length=407

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 83/135 (61%), Gaps = 8/135 (6%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            FY +   V L ++  + S+ +  K+FNVID+GA GDG TDD  AFL AW+  C S    +
Sbjct  8    FYLVTFLVLLCMVSSVWSADI--KTFNVIDFGAVGDGRTDDLPAFLKAWEAVCQS----E  61

Query  243  SPQVI--IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
            S +VI  IP    FL+KP +F+GPCK   IH  VSG ++AP S   W+G  T+ WL+F  
Sbjct  62   SSRVILVIPKRKKFLLKPSEFDGPCKPSSIHIQVSGNIIAPNSKSAWDGAATNAWLTFAN  121

Query  417  VYGLIVNGGGVIDGQ  461
            +  L VNG GV DGQ
Sbjct  122  INHLTVNGNGVFDGQ  136



>gb|KJB70599.1| hypothetical protein B456_011G082200 [Gossypium raimondii]
Length=362

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   FYSMEVF--VFLFILGLIS-SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  233
              +ME+   VF+ IL +++  +  +   FNV+DYGA GDG TDDS AF  AWK  C+S  
Sbjct  3    LRTMELIFTVFITILYVLTPGASGATNLFNVMDYGAVGDGKTDDSAAFSKAWKATCNSPS  62

Query  234  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  413
              ++P ++IPA   FL+KPV F+GPCKS  IH ++SG +VAP S   W G     WL+F 
Sbjct  63   --RNPILVIPASKIFLLKPVTFSGPCKSTSIHVLMSGNIVAPDSKSAWKGYHLDMWLAFT  120

Query  414  GVYGLIVNGGGVIDGQ  461
             V GL + G G I+G+
Sbjct  121  NVNGLTIIGSGTINGR  136



>gb|KHG01626.1| hypothetical protein F383_22075 [Gossypium arboreum]
Length=401

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 5/133 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            ME+   +FI  L   +R +  +   FNV+DYGA GDG TDDS AF  AWK  C+S    +
Sbjct  1    MELIFSVFITILYVLTRGASGATNLFNVMDYGAVGDGKTDDSPAFSKAWKSTCNSPS--R  58

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +P ++IPA   FL+KPV F+GPCKS  IH ++SG +VAP S   W G     WL+F  V 
Sbjct  59   NPILVIPASKIFLLKPVTFSGPCKSTSIHVLMSGNIVAPDSRSAWKGYHLDMWLAFTNVN  118

Query  423  GLIVNGGGVIDGQ  461
            GL + G G I+G+
Sbjct  119  GLTIIGSGTINGR  131



>ref|XP_010254483.1| PREDICTED: probable polygalacturonase At3g15720 [Nelumbo nucifera]
Length=425

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 84/135 (62%), Gaps = 4/135 (3%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVS--CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            F++  +     IL ++SS   +    SF+V++YGA GDG TDDS+AFLNAW+ AC     
Sbjct  25   FFTTLLITLCAILPVLSSRLAAGASNSFDVVNYGAVGDGRTDDSKAFLNAWEAACGDAS-  83

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
              SP +IIPA  TFL+ PV+F GPCKS +++  V G +++P     W+     +WLSF  
Sbjct  84   -GSPTLIIPAMKTFLLHPVEFIGPCKSNNVYVQVLGNIISPSDKSAWSDSTMGKWLSFAH  142

Query  417  VYGLIVNGGGVIDGQ  461
            V GL +NG G IDGQ
Sbjct  143  VNGLTINGPGYIDGQ  157



>gb|KJB70598.1| hypothetical protein B456_011G082200 [Gossypium raimondii]
Length=406

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   FYSMEVF--VFLFILGLIS-SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTP  233
              +ME+   VF+ IL +++  +  +   FNV+DYGA GDG TDDS AF  AWK  C+S  
Sbjct  3    LRTMELIFTVFITILYVLTPGASGATNLFNVMDYGAVGDGKTDDSAAFSKAWKATCNSPS  62

Query  234  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  413
              ++P ++IPA   FL+KPV F+GPCKS  IH ++SG +VAP S   W G     WL+F 
Sbjct  63   --RNPILVIPASKIFLLKPVTFSGPCKSTSIHVLMSGNIVAPDSKSAWKGYHLDMWLAFT  120

Query  414  GVYGLIVNGGGVIDGQ  461
             V GL + G G I+G+
Sbjct  121  NVNGLTIIGSGTINGR  136



>gb|ABK26513.1| unknown [Picea sitchensis]
 gb|ABR16831.1| unknown [Picea sitchensis]
Length=429

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 74/107 (69%), Gaps = 3/107 (3%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V  YGAKG+G++DDSQAFL AW  AC+S+        ++P G T+LVKP+ FNGPCK+
Sbjct  45   FSVDSYGAKGNGVSDDSQAFLAAWNAACTSS---SDSIFLVPHGKTYLVKPINFNGPCKT  101

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             H+   +SG +VAP  P  WN  + S WL F+ V GL ++GGG+IDG
Sbjct  102  VHLTAQISGKIVAPADPCKWNPKERSVWLQFSNVQGLTIHGGGIIDG  148



>ref|XP_002526714.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF35628.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=226

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 2/128 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +F F      I S+R S    NV+D+GA GDG TDDS AFL AWK  C + P    P ++
Sbjct  10   LFCFAVFSIFIGSARSSV--LNVVDFGATGDGQTDDSMAFLQAWKVLCGAAPAQNVPILM  67

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            +PAG TFL++PV+F+GPC S  +   V G +VAP S   W    +  WLSF+ V  L + 
Sbjct  68   VPAGKTFLLQPVEFSGPCSSSAVSVQVLGNIVAPRSIDAWKFGQSESWLSFSHVLNLTIF  127

Query  438  GGGVIDGQ  461
            G G IDGQ
Sbjct  128  GTGQIDGQ  135



>ref|XP_003601689.1| hypothetical protein MTR_3g084360 [Medicago truncatula]
Length=400

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   FYSMEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
             Y M +FV  +    L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C ST   
Sbjct  7    LYLMSLFVSPISCFRLVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVCGST--Q  64

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP--GWNGLDTSQWLSFN  413
             +P +IIP G  F+++P  F GPCKS  +  ++ GT++AP S     W+  D   W+SF+
Sbjct  65   GTPTLIIPGGKKFMLQPSSFQGPCKSSTVKVMMMGTIIAPQSSGKWKWDSRDDDAWISFS  124

Query  414  GVYGLIVNGGGVIDGQ  461
             + GLI++G G  DGQ
Sbjct  125  HIKGLIISGEGTFDGQ  140



>ref|XP_010494537.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=391

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ +  +F+L L++S  V+ + ++V+ +GAKGDG+TD+S+AF+ AWK  C S    K+ 
Sbjct  1    MEIIIRVVFLLTLLNSVLVNGQIYDVLKFGAKGDGLTDESKAFVEAWKAMCGSGGNPKT-  59

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP+  TFL++P+ F GPCKS  +     G +VAP     W+   +SQW+SF  ++GL
Sbjct  60   -LLIPSNKTFLLQPLLFQGPCKSPSVQVKFDGMIVAPRDKTAWSDYKSSQWISFKKIFGL  118

Query  429  IVNGGGVIDGQ  461
             VNG G IDG+
Sbjct  119  TVNGSGSIDGR  129



>ref|XP_011014845.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Populus 
euphratica]
Length=441

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 89/145 (61%), Gaps = 8/145 (6%)
 Frame = +3

Query  39   SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  206
            +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF  A
Sbjct  15   TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEA  74

Query  207  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  386
            W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75   WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  387  DTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +  +WL F+GV  L V GGG ++G+
Sbjct  131  NRRKWLYFHGVKHLTVEGGGTVNGR  155



>ref|XP_011014846.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Populus 
euphratica]
Length=440

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 89/145 (61%), Gaps = 8/145 (6%)
 Frame = +3

Query  39   SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  206
            +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF  A
Sbjct  15   TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEA  74

Query  207  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  386
            W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75   WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  387  DTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +  +WL F+GV  L V GGG ++G+
Sbjct  131  NRRKWLYFHGVKHLTVEGGGTVNGR  155



>ref|XP_010671219.1| PREDICTED: probable polygalacturonase At3g15720 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 11/149 (7%)
 Frame = +3

Query  42   IFALYCCFYSMEVFVFLFIL-GLISSS---RVSCK-----SFNVIDYGAKGDGMTDDSQA  194
            + A +C  Y +  F+  ++  GL++SS   RV  +     +FNV++YGA GDG  DD+ A
Sbjct  62   VEAYWCQDYLLVFFIVAYVANGLLASSHGARVRVQGNDSPTFNVLNYGAIGDGKQDDTLA  121

Query  195  FLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPG  374
            F  AW D C+S+  + +P +++P G TFLVK + F GPCKS  IH  V G +VAP S   
Sbjct  122  FSKAWSDVCNSS--NDTPTLVVPLGKTFLVKSILFKGPCKSTRIHVEVQGNIVAPDSIDE  179

Query  375  WNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            W    ++ WL F  V  LIV+G GVIDG+
Sbjct  180  WGECQSNTWLQFEYVDNLIVDGQGVIDGR  208



>ref|XP_007150743.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
 gb|ESW22737.1| hypothetical protein PHAVU_005G177000g [Phaseolus vulgaris]
Length=401

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            F  L IL +I+    S  + FNV+ YGA GDG T+DS AFL AWKD C S   H S Q+I
Sbjct  5    FTVLIILSVIAPGLSSTTTTFNVLQYGAVGDGQTNDSPAFLKAWKDVCQSKS-HIS-QLI  62

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IPA  TF++KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ + GLI++
Sbjct  63   IPAKRTFMLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSFIDGLIIS  122

Query  438  GGGVIDGQ  461
            G G IDG+
Sbjct  123  GKGSIDGR  130



>ref|XP_009355877.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=418

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +3

Query  69   SMEVFVFL--FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST-PVH  239
            S+ +++ L  F+LG +  +R +   FNV+DYGA  DG  DDS+AFL AWK+ C +    +
Sbjct  9    SLMLYIALTSFVLGAVDETRSNI--FNVLDYGAFADGQHDDSEAFLKAWKELCEAEGSYY  66

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
              P + IP G TF +KPV F GPCKS+ +     GT++AP    GW G   + WL F+ V
Sbjct  67   GLPMLEIPCGKTFKLKPVHFQGPCKSRSVQIKFFGTIIAPAYISGWTGCVGNSWLLFSNV  126

Query  420  YGLIVNGGGVIDGQ  461
              L++NG G IDGQ
Sbjct  127  DNLMINGSGKIDGQ  140



>ref|XP_011078326.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
 ref|XP_011078327.1| PREDICTED: polygalacturonase QRT2-like isoform X2 [Sesamum indicum]
Length=376

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +3

Query  147  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  326
            +DYGA  D +TDDSQAFL AW DACS++   +S +V +PA  TF+V P+ F+GPC +  I
Sbjct  1    MDYGATSDDLTDDSQAFLEAWDDACSASV--ESSRVYVPAEKTFVVDPITFHGPCYASTI  58

Query  327  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN--GGGVIDGQ  461
            +F +SG ++AP SP  W+G D SQWL F  V GL V+  G G+IDGQ
Sbjct  59   NFAISGRIMAPESPSSWDGGDASQWLGFKNVNGLKVDGFGFGLIDGQ  105



>ref|XP_011459852.1| PREDICTED: probable polygalacturonase At3g15720 [Fragaria vesca 
subsp. vesca]
Length=426

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 1/132 (1%)
 Frame = +3

Query  66   YSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            Y +  F+  +      S  V  ++F+V+DY A GDG TDDSQAF+ AW+  C +   +  
Sbjct  3    YILVSFLIFYTYSSHLSEIVCGQTFSVLDYDAVGDGDTDDSQAFVRAWEAVCGA-ETYDV  61

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P + IP   TFL++P +F GPCKS  +H  V G +VAP +P  W   +T  WL+F  V+ 
Sbjct  62   PTLQIPEEKTFLLQPTKFKGPCKSNRVHVQVLGKLVAPETPEAWKECETDVWLTFTDVHN  121

Query  426  LIVNGGGVIDGQ  461
            L VNG G IDG+
Sbjct  122  LTVNGSGQIDGR  133



>ref|XP_004516611.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=399

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 86/133 (65%), Gaps = 12/133 (9%)
 Frame = +3

Query  90   LFILGLISSSRVSCKS---------FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            L I+GL+    VSC S         FNV+ YGAKGDG++DD+QAF  AWKD C +     
Sbjct  6    LLIIGLLMFCIVSCNSWVGFCQQNTFNVLQYGAKGDGISDDTQAFEKAWKDLCGAQN-KG  64

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +P +++PAG TF V+ + F+GPCKSQ++H  ++G ++AP     W G  + +WL+F  V 
Sbjct  65   NPMLVVPAGHTFFVRQIAFSGPCKSQNLHIRITGNIIAP-KRDSW-GSCSKRWLNFINVK  122

Query  423  GLIVNGGGVIDGQ  461
            G+ V+G GVI+GQ
Sbjct  123  GMTVDGSGVINGQ  135



>ref|XP_009355876.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=399

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  251
            + + +F  +L  +     S K+F+V++Y A GDG  DDS+AF+NAWK  C +  V   P 
Sbjct  6    VSLLIFSIVLSGLIDIGYSEKTFDVLNYRAVGDGEADDSEAFVNAWKALCGADEVGDVPT  65

Query  252  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  431
            ++IP G TFL++P++F GPC+   +H  V G VVAP +   W    ++ WL F  V  L 
Sbjct  66   LVIPKGKTFLLQPIEFEGPCRPTRVHIQVLGNVVAPKTVDAWECPSSNAWLQFTNVANLT  125

Query  432  VNGGGVIDGQ  461
            ++G G IDGQ
Sbjct  126  LDGSGTIDGQ  135



>gb|KHG17940.1| hypothetical protein F383_07843 [Gossypium arboreum]
Length=402

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV+DYGA GDG TDDS AF  AWK  C++    ++P +IIPA   FL+KPV F+GPCK 
Sbjct  27   FNVVDYGAVGDGKTDDSAAFSKAWKAICNAPS--RNPILIIPATKIFLLKPVTFSGPCKP  84

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              IH ++SG +VAP S   W G   ++WL+F  V GL + G G I+G+
Sbjct  85   TSIHVLMSGNIVAPNSKMAWKGFHINRWLAFTHVNGLTIIGSGTINGR  132



>gb|AES71940.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=391

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 84/133 (63%), Gaps = 5/133 (4%)
 Frame = +3

Query  72   MEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            M +FV  +    L++   ++ KSFNV++YGAKGD  TDDS AFL AW++ C ST    +P
Sbjct  1    MSLFVSPISCFRLVNRKPLAQKSFNVVNYGAKGDSNTDDSNAFLKAWQEVCGST--QGTP  58

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP--GWNGLDTSQWLSFNGVY  422
             +IIP G  F+++P  F GPCKS  +  ++ GT++AP S     W+  D   W+SF+ + 
Sbjct  59   TLIIPGGKKFMLQPSSFQGPCKSSTVKVMMMGTIIAPQSSGKWKWDSRDDDAWISFSHIK  118

Query  423  GLIVNGGGVIDGQ  461
            GLI++G G  DGQ
Sbjct  119  GLIISGEGTFDGQ  131



>ref|XP_011035676.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Populus 
euphratica]
Length=440

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 8/145 (6%)
 Frame = +3

Query  39   SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  206
            +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF   
Sbjct  15   TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEV  74

Query  207  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  386
            W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75   WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  387  DTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +  +WL F+GV  L V GGG ++G+
Sbjct  131  NRRKWLYFHGVKHLTVEGGGTVNGR  155



>ref|XP_008365049.1| PREDICTED: probable polygalacturonase At1g80170 [Malus domestica]
Length=462

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 4/109 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            +  +V ++GAKGDG+TDDSQAF NAW+ ACS   +    +++IPAGST+LV PV   GPC
Sbjct  57   RVLSVGEFGAKGDGVTDDSQAFKNAWEIACS---IPARTRILIPAGSTYLVHPVDIAGPC  113

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L + GGG I+G
Sbjct  114  RSR-VTLMISGTVIAPEDPDAWIGLNRRKWLYFHGVNHLTIEGGGTING  161



>ref|XP_011035674.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Populus 
euphratica]
Length=441

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 8/145 (6%)
 Frame = +3

Query  39   SIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNA  206
            +I  L C CF  ++ F  L  L   + SR+   S  V+   D+GAKGDG+++D+QAF   
Sbjct  15   TIRVLICACFVCVQGFDSLLQLPQSAPSRIRPSSKRVLLVGDFGAKGDGLSNDTQAFKEV  74

Query  207  WKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGL  386
            W+ ACS        +++IPAG  FLV PV F GPCKS+ I   +SGT+VAP  P  W GL
Sbjct  75   WEMACS---FRGRTRILIPAGYNFLVHPVDFGGPCKSKVI-LDISGTIVAPEDPAAWKGL  130

Query  387  DTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +  +WL F+GV  L V GGG ++G+
Sbjct  131  NRRKWLYFHGVKHLTVEGGGTVNGR  155



>ref|XP_007018009.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY15234.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=405

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 80/127 (63%), Gaps = 7/127 (6%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVII  260
             +F F LG+      +C+S NV D+GA GDG TDDS AFL AWK  C++T    +P + I
Sbjct  8    MIFSFALGI-----ANCQSLNVTDFGAVGDGKTDDSLAFLKAWKALCAATNT-PNPTLEI  61

Query  261  PAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNG  440
            P+  TFL+K VQF+GPCKS+ IH  V G +VAP +   W   D   WL F+ V GL V+G
Sbjct  62   PSNKTFLLKQVQFSGPCKSKSIHIHVLGNIVAPNNNT-WTKCDNGCWLCFSNVAGLTVDG  120

Query  441  GGVIDGQ  461
             G IDG+
Sbjct  121  PGQIDGK  127



>ref|XP_008337131.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=423

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 81/134 (60%), Gaps = 5/134 (4%)
 Frame = +3

Query  69   SMEVFVFL--FILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST-PVH  239
            S+ +++ L  F+ G +  +R +   FNV+DYGA  DG  DDS+AFL AWK+ C +    +
Sbjct  14   SLMLYIALTSFVFGAVDETRSNI--FNVLDYGAFADGQHDDSEAFLKAWKELCEAEGSYY  71

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
              P + IP G TF +KPV F GPCKS+ +     GT++AP    GW G   + WL F+ V
Sbjct  72   GLPMLEIPCGKTFKLKPVHFQGPCKSRSVQIKFFGTIIAPAYISGWTGCVGNSWLLFSNV  131

Query  420  YGLIVNGGGVIDGQ  461
              L++NG G IDGQ
Sbjct  132  DNLMINGSGKIDGQ  145



>ref|XP_003588754.1| PGN [Medicago truncatula]
 gb|AES59005.1| polygalacturonase [Medicago truncatula]
Length=397

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 12/132 (9%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSF--------NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            LFI GL+  S VSC SF        NV+ YGAKGDG +DD+QAFL AWK  C++     +
Sbjct  4    LFISGLLIFSIVSCNSFVGFSQNTFNVLQYGAKGDGTSDDTQAFLEAWKALCAAN--QGT  61

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P +++PA  TF V+   F GPCKSQ++H  + G ++AP     W G  + +WL F  V+G
Sbjct  62   PTLVVPAEHTFFVRQATFQGPCKSQNLHIQIMGNIIAP-HRDAW-GSCSKRWLYFLNVHG  119

Query  426  LIVNGGGVIDGQ  461
            + V+G GVIDG+
Sbjct  120  MTVDGSGVIDGR  131



>emb|CDO98133.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 22/160 (14%)
 Frame = +3

Query  33   SASIFALYCCFYSMEVFVFLFIL----------------GLISSSRVSCKS--FNVIDYG  158
            +A I ++  CF      +FLF+                 G  +S  VS  S    + D+G
Sbjct  17   TAIISSISLCFVQRASIIFLFLNFTNVSGAKFDPPIQLPGSRTSQYVSNSSTVLYIHDFG  76

Query  159  AKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIV  338
            A+G+GM+DD++AF  AWK ACS   +    ++++PAG  FLV+P+ F+GPC+S  +   +
Sbjct  77   ARGNGMSDDTKAFQKAWKIACS---LSSEAKIVVPAGKKFLVRPIDFSGPCRSG-LTLWI  132

Query  339  SGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            SGT+VAP  P  WNGLD ++WL F+GV  L V GGG +DG
Sbjct  133  SGTIVAPRDPDVWNGLDPNKWLYFHGVNYLTVEGGGTVDG  172



>gb|KHN44172.1| Putative polygalacturonase [Glycine soja]
Length=412

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 6/146 (4%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLN  203
            L+ S + F +   F+++ + + +   GL S++     SFNV+ YGA G+G T+DS AFL 
Sbjct  2    LLKSTAKFDIMEFFFTVLIILSVITPGLSSTT----TSFNVLQYGAVGNGQTNDSPAFLK  57

Query  204  AWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNG  383
            AWK AC S   H S ++IIPA  TFL+KP  F+GPCKS + +  +SG ++AP +   ++G
Sbjct  58   AWKAACQSNS-HIS-RLIIPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIIAPKTKSEYSG  115

Query  384  LDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              T+ WL F+ V GL ++G G IDG+
Sbjct  116  FHTNTWLGFSFVNGLAISGKGTIDGR  141



>ref|XP_004497875.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=403

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 5/111 (5%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  FL++PV F GPCKS
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLRAWQDVCSTR--QSNPILLIPNGKRFLLQPVSFRGPCKS  92

Query  318  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQ
Sbjct  93   SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQ  143



>gb|KHN39536.1| Putative polygalacturonase [Glycine soja]
Length=360

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +3

Query  147  IDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHI  326
            +DYGA GDG+TDDSQAFL AW   C+    + +  + +P G TF++KP+QF+GPC    +
Sbjct  1    MDYGAIGDGLTDDSQAFLKAWSMVCAMK--NGAATLKVPPGKTFMLKPLQFSGPCSFSSV  58

Query  327  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            HF + G VVAP S   W G D+S+W+ F+ V GLI++GGG IDG
Sbjct  59   HFQLEGDVVAPKSTEAWKGQDSSKWIDFSNVDGLIIDGGGQIDG  102



>ref|XP_010061913.1| PREDICTED: probable polygalacturonase At3g15720 [Eucalyptus grandis]
Length=407

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 88/135 (65%), Gaps = 7/135 (5%)
 Frame = +3

Query  72   MEVFV----FLFILGLISS-SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            ME F+    F  +L +++  +  +  SF+V+ YGA GDG TDDS AFL AW  AC S+  
Sbjct  4    MEHFIVCLLFFGVLNMVNCGASTASTSFDVLSYGAVGDGKTDDSPAFLEAWNAACISSS-  62

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
             K   + +PA  TFL+KPV F+GPC+ ++++ +VSG + AP S   ++G  T+ WL+F+ 
Sbjct  63   -KLSILTVPAKKTFLLKPVTFSGPCQPEYMYVLVSGNIAAPNSMTDYSGYQTNSWLAFSN  121

Query  417  VYGLIVNGGGVIDGQ  461
            V GL++ G G+IDG+
Sbjct  122  VSGLMITGTGIIDGK  136



>ref|XP_007227584.1| hypothetical protein PRUPE_ppa015678mg [Prunus persica]
 gb|EMJ28783.1| hypothetical protein PRUPE_ppa015678mg [Prunus persica]
Length=390

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRV----SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
             ++ +  FI  + SS  +    S  +F+V+ +GA GDG TDDS+A +NAWK  C +    
Sbjct  2    QDILISFFIFCIASSQLLGIVYSKTTFDVVKFGAVGDGQTDDSEAIVNAWKALCGAAAAG  61

Query  240  KS-PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
               P + +P G TFL++P +F GPCKS+ +H  VSG ++AP +P  W    +  WLSF  
Sbjct  62   DDVPTLTVPGGKTFLLQPSEFEGPCKSKSVHIQVSGNLMAPKTPDAWKVCPSYSWLSFRN  121

Query  417  VYGLIVNGGGVIDGQ  461
            V  LI++G G IDGQ
Sbjct  122  VDNLILDGSGKIDGQ  136



>ref|XP_004302967.1| PREDICTED: probable polygalacturonase At1g80170 [Fragaria vesca 
subsp. vesca]
Length=455

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 84/131 (64%), Gaps = 7/131 (5%)
 Frame = +3

Query  75   EVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            E F  L  L    S+R   +S  V+    +GAKGDG+TDDS+AF NAW+ ACS   +   
Sbjct  35   EKFDSLLQLPHSGSTRTRLRSKRVLFLGAFGAKGDGITDDSKAFQNAWEVACS---IPTR  91

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
             +++IP+G T+L+ PV   GPC+S+ +  ++SGT++AP SP  W GL+  +W+ F+GV  
Sbjct  92   TRILIPSGRTYLIHPVDIAGPCRSK-VTLMISGTIIAPISPDAWIGLNARKWIYFHGVNH  150

Query  426  LIVNGGGVIDG  458
            L V GGG +DG
Sbjct  151  LTVEGGGTVDG  161



>ref|XP_006465356.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Citrus 
sinensis]
Length=445

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 14/152 (9%)
 Frame = +3

Query  12   IHP*LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTD  182
            IH  + LSAS+        S E F  L  L    S+R   KS  VI   D+GAKGDG  D
Sbjct  17   IHVLVCLSASLV-------STEGFDSLLELPHSGSNRTRSKSKRVIFVGDFGAKGDGFND  69

Query  183  DSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
            D++AF NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP 
Sbjct  70   DTEAFANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLKISGTIVAPK  125

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             P  W GL+  +WL FN V  L V GGG I+G
Sbjct  126  DPDVWKGLNRRRWLYFNRVNHLTVQGGGTING  157



>ref|XP_011081272.1| PREDICTED: probable polygalacturonase At1g80170 [Sesamum indicum]
Length=461

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            +SSR     FN+ D+GAKGDG+ DD++   + WK ACSS+   K   +IIPAG+++LVKP
Sbjct  56   TSSRSKTVLFNIDDFGAKGDGIADDTKIVQDVWKVACSSSSPAK---IIIPAGNSYLVKP  112

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            + F GPC+S ++   VSG +VAP  P  W+GL+  +WL F+GV  L + GGG+IDG+
Sbjct  113  IDFPGPCQS-NVTLRVSGILVAPQDPEVWDGLNVHKWLYFHGVKQLTIEGGGLIDGR  168



>ref|XP_002324855.2| hypothetical protein POPTR_0018s01610g [Populus trichocarpa]
 gb|EEF03420.2| hypothetical protein POPTR_0018s01610g [Populus trichocarpa]
Length=399

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            M+   F F++  I++S        K FNV+D+GA GDG  DD+ AFL+AW+  C      
Sbjct  1    MQDVYFSFLILCIAASSFGIGHGQKVFNVVDFGAIGDGQIDDTNAFLSAWQALCGDDAAQ  60

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
             +P + IP G TFL++PV+F GPCKS  +H  V G ++AP +   WN      W+ F GV
Sbjct  61   GTPSLQIPEGKTFLLQPVKFQGPCKSVFVHVQVQGKIIAPNTIEEWNNCQADYWIGFVGV  120

Query  420  YGLIVNGGGVIDGQ  461
              L + G G+IDGQ
Sbjct  121  ANLNMYGSGLIDGQ  134



>ref|XP_009362523.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IPAGST+L  PV   G
Sbjct  55   SKRVLSVGEFGAKGDGVTDDSQAFKNAWEMACS-IPVRT--RILIPAGSTYLFHPVDIAG  111

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G
Sbjct  112  PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTING  161



>ref|XP_008337125.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=393

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQ  251
            + + +F  +L  +     S ++F+V++Y A GDG  DDS+AF+NAWK  C +  V   P 
Sbjct  6    VSLLIFSIVLSGLIDIGYSERTFDVLNYRAVGDGEADDSEAFVNAWKALCGADEVGDVPT  65

Query  252  VIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-WLSFNGVYGL  428
            ++IP G TFL++P++F GPC+ + +H  V G VVAP +   W    +S  WL F  V  L
Sbjct  66   LVIPKGKTFLLQPIEFEGPCRPKRVHIQVLGNVVAPKTVDAWKECPSSNTWLQFTNVANL  125

Query  429  IVNGGGVIDGQ  461
            I++G G I+GQ
Sbjct  126  ILDGSGTINGQ  136



>gb|ABD28723.1| Glycoside hydrolase, family 28 [Medicago truncatula]
Length=392

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            + + +F LGL  ++     +FNV+ YGA GDG T+DS AFL AWKD C+S     + ++I
Sbjct  1    MILSMFKLGLSITT-----TFNVLQYGAVGDGKTNDSPAFLKAWKDVCNSK--SGTSRLI  53

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IPA  TFL++P+ F GPCKS +I+  +SG ++AP +   ++G   + W+ F+ V GLI++
Sbjct  54   IPAAKTFLLRPIAFRGPCKSNYIYIELSGNIIAPKTKSEYSGSPINTWIGFSFVNGLIIS  113

Query  438  GGGVIDGQ  461
            G G +DG+
Sbjct  114  GKGTVDGR  121



>ref|XP_006595163.1| PREDICTED: probable polygalacturonase At3g15720-like [Glycine 
max]
Length=401

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 3/128 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            F  L IL +I+    S   SFNV+ YGA G+G T+DS AFL AWK AC S   H S ++I
Sbjct  5    FTVLIILSVITPGLSSTTTSFNVLQYGAVGNGQTNDSPAFLKAWKAACQSNS-HIS-RLI  62

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IPA  TFL+KP  F+GPCKS + +  +SG ++AP +   ++G  T+ WL F+ V GL ++
Sbjct  63   IPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIIAPKTKSEYSGFHTNTWLGFSFVNGLAIS  122

Query  438  GGGVIDGQ  461
            G G IDG+
Sbjct  123  GKGTIDGR  130



>ref|XP_008243707.1| PREDICTED: probable polygalacturonase At1g80170 [Prunus mume]
Length=462

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +3

Query  114  SSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  284
            S+R   KS  V+   D+GAKGDG+TDDS+AF NAW+ ACS  P+    +++IP GST+LV
Sbjct  46   STRTRSKSKRVLFVGDFGAKGDGITDDSKAFKNAWEIACS-LPMRM--RIVIPVGSTYLV  102

Query  285  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             PV   GPC+S+ +  ++SGT+VAP  P  W GL+  +WL F+GV  L + GGG I+G
Sbjct  103  HPVDIAGPCRSK-VTLMISGTIVAPKDPDAWIGLNPRKWLYFHGVNHLTLEGGGRING  159



>ref|XP_006427250.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
 gb|ESR40490.1| hypothetical protein CICLE_v10027074mg [Citrus clementina]
Length=400

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            S +VI +GA GDG TDDSQAFL AWK  C S     +P +++PAG TFL+ PV F GPCK
Sbjct  32   SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAPPLLVPAGKTFLLNPVSFQGPCK  89

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+
Sbjct  90   SSSINVQIQGNIVAPHS-SAWDGHDKKKWLLFSNVNGLTVNGNGKIDGK  137



>emb|CDP21684.1| unnamed protein product [Coffea canephora]
Length=171

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = +3

Query  33   SASIFALYCCFYSMEVFVFLFILGLISSSRVS---CKSFNVIDYGAKGDGMTDDSQAFLN  203
            +  IF   C    ++    + ++  I++S +       FNV  +GA GDG+ DD++AF  
Sbjct  5    TTEIFTEICYLGLLQGLQIISLIVCIAASYLDGGLAAVFNVTGFGAIGDGIHDDTEAFSQ  64

Query  204  AWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNG  383
            AW+ ACS+     S  VI+PAG TFL+ PV F GPC S ++HF V G +VAP     W G
Sbjct  65   AWEAACSNGG--GSSSVIVPAGRTFLLSPVNFEGPCYSSNVHFQVLGKIVAPNETDAWKG  122

Query  384  LDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              ++ WL F+ + GL++ G GVIDG+
Sbjct  123  CVSNSWLHFSDIPGLVLEGSGVIDGR  148



>ref|XP_010047836.1| PREDICTED: probable polygalacturonase At1g80170 [Eucalyptus grandis]
Length=406

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V DYGA GDG+TDD+ AFL AW+  CS+    ++P +IIP   TFLV  + F+GPC +
Sbjct  29   FSVCDYGAIGDGVTDDTGAFLEAWQATCSTQ--FENPTMIIPDNYTFLVHQLTFSGPCNA  86

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            Q I F+V G + AP SP  W  LD S W++F+G+  L V+G G IDGQ
Sbjct  87   QKITFLVLGNINAPTSPRAWTDLDPSSWMTFHGIDQLRVSGFGTIDGQ  134



>gb|KJB70600.1| hypothetical protein B456_011G082300 [Gossypium raimondii]
Length=356

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV+ YGA GDG TDDS  F  AWK  C++    ++P + IPA   FL+KPV F+GPCKS
Sbjct  26   FNVVHYGAVGDGKTDDSAVFSKAWKATCNAPA--RNPILSIPAAKIFLLKPVTFSGPCKS  83

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              IH ++SG +VAP S   W G   ++WL+F  V GL + G G I+G+
Sbjct  84   TSIHVLMSGNIVAPNSKMAWKGFHINRWLAFTHVNGLTIIGSGTINGR  131



>gb|KCW68966.1| hypothetical protein EUGRSUZ_F02531 [Eucalyptus grandis]
Length=381

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SF+V+ YGA GDG TDDS AFL AW  AC S+   K   + +PA  TFL+KPV F+GPC+
Sbjct  12   SFDVLSYGAVGDGKTDDSPAFLEAWNAACISSS--KLSILTVPAKKTFLLKPVTFSGPCQ  69

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             ++++ +VSG + AP S   ++G  T+ WL+F+ V GL++ G G+IDG+
Sbjct  70   PEYMYVLVSGNIAAPNSMTDYSGYQTNSWLAFSNVSGLMITGTGIIDGK  118



>ref|XP_006845768.2| PREDICTED: probable polygalacturonase At1g80170 [Amborella trichopoda]
Length=406

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 14/146 (10%)
 Frame = +3

Query  45   FALYCCFYSMEVFVFLFILGL-------ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLN  203
             A Y  FY   +F+   + GL       +S S  + +SF+V+DYGAKGDGM DD+ AF  
Sbjct  1    MAQYTIFY---LFICWGLAGLCGASILPLSDSNSTSQSFDVMDYGAKGDGMEDDTAAFAK  57

Query  204  AWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNG  383
            AW   C +     SP++IIP+G+ F V P++F GPC+S  +H IV G +VAP  P  W  
Sbjct  58   AWGATCHT---KGSPEMIIPSGNLFRVGPIEFLGPCQSNDVHVIVEGDIVAP-PPSLWKD  113

Query  384  LDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             +   WL F+ V GL V+G G IDG 
Sbjct  114  ANLRTWLVFSHVNGLTVDGSGKIDGH  139



>ref|XP_008242767.1| PREDICTED: probable polygalacturonase At1g80170 [Prunus mume]
Length=406

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 88/134 (66%), Gaps = 11/134 (8%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCKS-------FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            F+ LF+  L+S S ++C +       F+V DYGA   G  DDS+AFL AW  AC+S    
Sbjct  7    FLLLFVGPLVSVS-IACSTEHANQTTFDVSDYGAVSGGHIDDSEAFLKAWNAACASET--  63

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGV  419
            ++P +I+P    FL+ P+ F+GPC++++I+F++ G ++AP SP  W  LD SQWL+FNGV
Sbjct  64   ENPTLIVPP-KRFLLNPIVFSGPCRAKNINFLIFGRLLAPDSPGAWKELDPSQWLAFNGV  122

Query  420  YGLIVNGGGVIDGQ  461
             GL + G G I+G+
Sbjct  123  SGLNIAGPGRINGR  136



>ref|XP_009338342.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IP+GST+L  PV   G
Sbjct  55   SKRVLSVGEFGAKGDGVTDDSQAFKNAWEIACS-IPVRT--RILIPSGSTYLFHPVDIAG  111

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G
Sbjct  112  PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTING  161



>ref|XP_007023162.1| JHL06P13.4 protein, putative [Theobroma cacao]
 gb|EOY25784.1| JHL06P13.4 protein, putative [Theobroma cacao]
Length=413

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 74/127 (58%), Gaps = 2/127 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            V   + I+ +  S+      FNV  YGA G+G+TDDS AF+ AWKD C +      P +I
Sbjct  14   VTCLVSIIAICISANAQQNVFNVQSYGAAGNGITDDSLAFMKAWKDTCGAGT--GIPTMI  71

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IP G  FLV P+ F GPCK   I+  +SGT+VAP  P  W   D S WL+F  V GL ++
Sbjct  72   IPKGKIFLVNPITFTGPCKPSIINVKLSGTIVAPNGPDQWKAADLSTWLAFQDVNGLTID  131

Query  438  GGGVIDG  458
            G G +DG
Sbjct  132  GPGTMDG  138



>ref|XP_004489698.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=398

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNV+DYGA G+G  D++QAF++AWKD CS+  +H SP ++IP G TF+++P+ F GPC 
Sbjct  29   SFNVLDYGAVGNGKNDETQAFVDAWKDTCSA--IHDSPTLLIPKGKTFILQPLWFQGPCN  86

Query  315  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  ++  + GT+ AP     W   N  +   W+ F+ + GLI+ G G IDGQ
Sbjct  87   STTVYVKLEGTIKAPNKIEAWKWPNNNEKETWIRFSEINGLIIYGSGQIDGQ  138



>ref|XP_006427256.1| hypothetical protein CICLE_v10027137mg [Citrus clementina]
 gb|ESR40496.1| hypothetical protein CICLE_v10027137mg [Citrus clementina]
Length=390

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 77/133 (58%), Gaps = 3/133 (2%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            F+ + + + +  LG  S S      +NV+++GA G+G+TDDSQAF+ AW   C  T    
Sbjct  5    FFIISLLMCMATLGW-SRSYPGTMPYNVMNFGAVGNGVTDDSQAFIKAWNAVCGDTS--N  61

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +P + +P G TFL++P  F GPCKS ++   + G ++AP  P  W G D   WL F  V 
Sbjct  62   NPTLQVPQGKTFLLQPTSFQGPCKSSNLQVQIEGNLIAPEGPSSWKGKDRRSWLYFANVN  121

Query  423  GLIVNGGGVIDGQ  461
            G  VNG G IDGQ
Sbjct  122  GFTVNGNGEIDGQ  134



>ref|XP_007013436.1| F18B13.22 protein isoform 1 [Theobroma cacao]
 gb|EOY31055.1| F18B13.22 protein isoform 1 [Theobroma cacao]
Length=408

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 84/137 (61%), Gaps = 9/137 (7%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF-------NVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            M++F  + ++  +  S + C +        +V+D+GA G+G  D S+AFL AW   CS  
Sbjct  1    MDIFACIILVLWLFCSNIFCNAVGMKSELVDVLDFGAVGNGKADSSEAFLKAWNFVCSRE  60

Query  231  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSF  410
               +S ++I+P   TFL+ PV F+G CK++ I F++ GT+V+P SP  W GLD  +WL+F
Sbjct  61   T--ESVRLIVPGKHTFLLHPVTFSGQCKAREIKFLIHGTIVSPVSPKAWEGLDQGKWLTF  118

Query  411  NGVYGLIVNGGGVIDGQ  461
             GV GL V G G I+G+
Sbjct  119  YGVSGLKVKGTGEINGR  135



>ref|XP_010450754.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 85/142 (60%), Gaps = 13/142 (9%)
 Frame = +3

Query  69   SMEVFVFLFILGLISS-----SRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            S+  F FL  L L  +     SR +     K FNV+DYGA GDG +DDS+AF +AW+D C
Sbjct  4    SVMFFTFLLSLTLFHTFQFAHSRSTLYNENKIFNVLDYGAIGDGFSDDSKAFKDAWEDTC  63

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT--S  395
            +      + +  IP G TFL++P++F+GPCKS+ I   +SG V+APGSP  W        
Sbjct  64   NYIGSQSTME--IPEGYTFLLQPIEFHGPCKSKKIILSISGYVIAPGSPDEWECKKNHCH  121

Query  396  QWLSFNGVYGLIVNGGGVIDGQ  461
            QW+ F  + GL ++G G +DGQ
Sbjct  122  QWIEFAHINGLHIDGRGTLDGQ  143



>gb|KCW81411.1| hypothetical protein EUGRSUZ_C02788 [Eucalyptus grandis]
Length=406

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 7/140 (5%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCK-------SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            FY +     ++++   +SS  S         ++NV++YGA G G  DDSQAF+ AW+D C
Sbjct  4    FYEVGFVAAIYLVLFAASSTFSSHGIVAASPTYNVVNYGATGSGDDDDSQAFVKAWEDTC  63

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  401
              +    +P + +P G  F + PV F GPCKS  I+  + GT+VAP S  GW G  + +W
Sbjct  64   GDSGEKGTPTLAVPGGKKFRLSPVAFKGPCKSSSINVQIDGTLVAPSSLSGWKGCSSGRW  123

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            L+F  V  L V G G +DGQ
Sbjct  124  LNFQDVANLNVKGSGQVDGQ  143



>ref|XP_009360500.1| PREDICTED: probable polygalacturonase At3g15720 [Pyrus x bretschneideri]
Length=424

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            +NV+DYGA GDG TDDS+AF+ AWK AC +        +I+P   TF ++PV F GPC S
Sbjct  28   YNVLDYGAIGDGQTDDSEAFVKAWKAACRTAEAGDLTTLIVPP-ETFSLQPVIFAGPCTS  86

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            + +HF+V G VVAP +   W    +  WL F GV  LI+NG G IDGQ
Sbjct  87   KTMHFVVLGNVVAPKTLDAWKECPSHGWLEFVGVTNLIINGSGTIDGQ  134



>gb|ACN40008.1| unknown [Picea sitchensis]
Length=440

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = +3

Query  105  LISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  278
            LI SS +  S   F+V  YGAKG+G++DDSQAFL AW  AC+S+        ++P G+++
Sbjct  45   LIKSSDLDPSAAVFSVDSYGAKGNGVSDDSQAFLAAWNAACTSS---SDSIFLVPHGNSY  101

Query  279  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            LVKP+ FNGPC +  +   +SG +VAP  P  WN  D + WL F+ V GL ++GGG+IDG
Sbjct  102  LVKPISFNGPCNTGSLTAQISGRIVAPADPCNWNPEDRTIWLQFSKVQGLTIHGGGIIDG  161



>ref|XP_010445667.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=427

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (63%), Gaps = 8/139 (6%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSC----KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            F+S  + + LF    ++ SR +     K+FNV+DYGA GDG  DDS+AF +AW+D C+  
Sbjct  7    FFSFLLSLTLFHTFQLAQSRSTLYHDNKNFNVLDYGAIGDGFFDDSKAFKDAWEDTCNY-  65

Query  231  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT--SQWL  404
             +     + IP G TFL++P++F+GPCKS+ I   +SG V+APGSP  W        QW+
Sbjct  66   -IGSQSIMEIPEGYTFLLQPIEFHGPCKSKKIILSISGYVIAPGSPDEWECKKNHCHQWI  124

Query  405  SFNGVYGLIVNGGGVIDGQ  461
             F  + GL ++G G++DGQ
Sbjct  125  EFAHINGLHIDGPGILDGQ  143



>ref|NP_001234200.2| polygalacturonase precursor [Solanum lycopersicum]
Length=397

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = +3

Query  75   EVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQV  254
            +  +FL  +      R     F+V  YGA GDG+ DD+QAF   W+ ACS     ++P +
Sbjct  4    QALIFLICITTFLIERSVAGIFDVTCYGAFGDGVHDDTQAFKQVWRAACSD----ENPSI  59

Query  255  IIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIV  434
            +IP+  +FLV P+ F GPCKS +IH  + G++VAP  P  W G +   W+ F GV GL +
Sbjct  60   LIPSEKSFLVGPITFQGPCKSANIHLQLLGSIVAPKDPVAWTGCENVCWIYFTGVAGLFI  119

Query  435  NGGGVIDGQ  461
            NG G I+G 
Sbjct  120  NGSGTINGN  128



>ref|XP_004498018.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  F+++PV F GPC S
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLKAWQDVCSTR--QSNPTLLIPNGKRFMLQPVSFKGPCIS  92

Query  318  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQ
Sbjct  93   SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQ  143



>ref|XP_003546050.2| PREDICTED: probable polygalacturonase At1g80170-like [Glycine 
max]
Length=412

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 85/135 (63%), Gaps = 4/135 (3%)
 Frame = +3

Query  63   FYSMEVF-VFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            F  ME F + L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S   
Sbjct  9    FDIMEFFFIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQSKS-  67

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
                ++IIPA  TFL+KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ 
Sbjct  68   -HIARLIIPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSF  126

Query  417  VYGLIVNGGGVIDGQ  461
            V GL ++G G IDG+
Sbjct  127  VNGLAISGKGTIDGR  141



>ref|XP_004498026.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=402

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV++YGAKGDG TDDS AFL AW+D CS+     +P ++IP G  F+++PV F GPC S
Sbjct  35   FNVLNYGAKGDGQTDDSNAFLKAWQDVCSTR--QSNPTLLIPNGKRFMLQPVSFQGPCIS  92

Query  318  QHIHFIVSGTVVAPGSPPGWN---GLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              ++ ++ GT+ AP S   W+   G     W+ F  + GL++NGGG +DGQ
Sbjct  93   SRVNVVLQGTISAPKSIEEWDWTKGDVGKSWIQFWHINGLVINGGGTVDGQ  143



>ref|XP_010494002.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=396

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 82/130 (63%), Gaps = 3/130 (2%)
 Frame = +3

Query  72   MEVFVFLFIL-GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ + + IL   +    V+ +++NV+D+GAKGDG TDDS AF+ AW   C       + 
Sbjct  1    MEIILHISILITFLYFGLVNGQNYNVLDFGAKGDGQTDDSTAFVQAWNATCRGD--ENNT  58

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP+G TFL++P+ FNGPCKS  I   + G ++AP +   W+   +  W+ F+ ++GL
Sbjct  59   TLLIPSGQTFLLQPIVFNGPCKSTSIKIQLDGVIIAPSNITAWSNPKSQMWIGFSSIFGL  118

Query  429  IVNGGGVIDG  458
            +V+G G IDG
Sbjct  119  VVDGSGKIDG  128



>ref|XP_009595646.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Nicotiana 
tomentosiformis]
Length=406

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  75   EVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQ-------AFLNAWKDACSSTP  233
              F+F+  +      +     F+V  YGA GDGM DD++       AF  AW   CSS  
Sbjct  3    RAFIFVICITPFILDKSLAAIFDVTSYGAVGDGMHDDTKVTQIISIAFKQAWTATCSSKS  62

Query  234  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  413
              ++P ++IP+  +FL++P+ F GPCKS +IH  +SG++VAP  P  W G +   W+ F 
Sbjct  63   --RNPSMLIPSEKSFLIRPITFQGPCKSSNIHLQLSGSIVAPEDPKEWRGCENVSWIYFT  120

Query  414  GVYGLIVNGGGVIDGQ  461
            GV+GL +NG G I+G 
Sbjct  121  GVFGLFINGSGTINGN  136



>ref|XP_010435969.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=426

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 4/112 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            K+FNV+DYGA GDG +DDS+AF +AW+D C+      + +  IP G TFL++P++F+GPC
Sbjct  34   KNFNVLDYGAIGDGFSDDSKAFKDAWEDTCNYIGSQSTME--IPEGYTFLLQPIEFHGPC  91

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDT--SQWLSFNGVYGLIVNGGGVIDGQ  461
            KS+ I   ++G V+APGSP  W        QW+ F  + GL ++G G++DGQ
Sbjct  92   KSKKIILSINGYVIAPGSPDEWECKKNHCHQWIEFAHINGLHIDGRGILDGQ  143



>gb|KHN22454.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +3

Query  81   FVFLFILGLISSSRVSCK-SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            F+ L IL +++    S   +FNV+ YGA G+G T+DS AFL AWK AC S       ++I
Sbjct  29   FIVLMILSVLTPGLSSTIITFNVLQYGAVGNGQTNDSPAFLKAWKAACQSKS--HIARLI  86

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IPA  TFL+KP  F+GPCKS + +  +SG +VAP +   ++G  T+ WL F+ V GL ++
Sbjct  87   IPAKRTFLLKPTTFSGPCKSNYTYIQLSGNIVAPKTKSEYSGFHTNTWLGFSFVNGLAIS  146

Query  438  GGGVIDGQ  461
            G G IDG+
Sbjct  147  GKGTIDGR  154



>ref|XP_012073216.1| PREDICTED: probable polygalacturonase At1g80170 isoform X2 [Jatropha 
curcas]
Length=405

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 9/153 (6%)
 Frame = +3

Query  18   P*LILSASIFALYCC-FYSMEVFVFLFIL---GLISSSRVSCKS-FNVIDYGAKGDGMTD  182
            P LI+   I    C  F   E F  L  L    L++++R   K  F V D+GAKGDG ++
Sbjct  11   PFLIVLIHICVCICTSFVYTEGFDSLLQLPQSELLANTRPRSKRVFFVGDFGAKGDGFSN  70

Query  183  DSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
            D++AF++AW+ ACS        ++IIPAG  FLV PV   GPCKS+ I  I+SGT+ AP 
Sbjct  71   DTKAFIDAWRMACSCPA---RTRIIIPAGFIFLVHPVDLAGPCKSR-ITLIISGTITAPK  126

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P  W GL+  +WL F+GV  L ++GGG I+G 
Sbjct  127  DPAHWKGLNPRKWLYFHGVNHLTIDGGGTINGM  159



>ref|XP_009619865.1| PREDICTED: probable polygalacturonase At3g15720 [Nicotiana tomentosiformis]
Length=411

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 77/130 (59%), Gaps = 8/130 (6%)
 Frame = +3

Query  84   VFLFILGLISS--SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +FL +L + S   S    K+FNV+++GA GDG TDD  AFL AW+  C S    +S +VI
Sbjct  15   IFLVLLCMFSPVWSADDIKTFNVVNFGAVGDGRTDDLPAFLKAWETVCQS----ESSRVI  70

Query  258  --IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  431
              IP    FL+ P  F GPCK   IH  VSG ++AP S  GW+G  T+ WL F  +  L 
Sbjct  71   LVIPEKKKFLLTPSTFEGPCKPSFIHIQVSGNIIAPNSKSGWDGRATNAWLIFENIDHLT  130

Query  432  VNGGGVIDGQ  461
            VNG GV DGQ
Sbjct  131  VNGNGVFDGQ  140



>gb|AAY21049.1| PGN [Glycine max]
Length=402

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++  + +  ++IP   TF+++PV F GPCK
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS--YGTATLLIPKEKTFMLQPVLFRGPCK  86

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQ--WLSFNGVYGLIVNGG--GVIDGQ  461
               +H  + GT++AP     W    +++  W+ F  + GL++ GG  G+IDGQ
Sbjct  87   PPTVHIKLKGTIIAPNKIEAWKLPKSTRMAWIRFRHISGLVIRGGGWGLIDGQ  139



>ref|XP_009362540.1| PREDICTED: probable polygalacturonase At1g80170 [Pyrus x bretschneideri]
Length=462

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S +  +V ++GAKGDG+TDDSQAF NAW+ ACS  PV    +++IP GST+L  PV   G
Sbjct  55   SKRVLSVGEFGAKGDGVTDDSQAFKNAWEMACS-IPVRT--RILIPDGSTYLFHPVDIAG  111

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            PC+S+ +  ++SGTV+AP  P  W GL+  +WL F+GV  L V GGG I+G
Sbjct  112  PCRSK-VTLMISGTVIAPEDPDTWIGLNRRKWLYFHGVNHLTVEGGGTING  161



>gb|ABK23977.1| unknown [Picea sitchensis]
 gb|ABK25238.1| unknown [Picea sitchensis]
 gb|ACN39860.1| unknown [Picea sitchensis]
Length=440

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = +3

Query  105  LISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  278
            LI SS +  S   F+V  YGAKG+G++DDSQAFL AW  AC+S+        ++P G+++
Sbjct  45   LIKSSDLDPSAAVFSVDSYGAKGNGVSDDSQAFLAAWNAACTSS---SDSIFLVPHGNSY  101

Query  279  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            LVKP+ FNGPC +  +   +SG +VAP  P  WN  D + WL F+ V GL ++GGG+IDG
Sbjct  102  LVKPISFNGPCNTGGLTAQISGRIVAPADPCNWNPEDRTIWLQFSKVQGLTIHGGGIIDG  161



>ref|XP_010431134.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=381

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ +  +F+L L++S  V+ + ++V+ +GAKG+G+TD+S+AF+ AWK  C S    K+ 
Sbjct  1    MEIIIRVVFLLTLLNSVLVNGQIYDVLKFGAKGNGLTDESKAFVEAWKAMCGSGGNQKT-  59

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP+  TFL++P+ F GPCKS  +     G +VAP     W+   + +W+SF  + GL
Sbjct  60   -LLIPSNKTFLLQPLVFQGPCKSPSVQVKFDGKIVAPRDKTAWSDYKSLRWVSFKEIIGL  118

Query  429  IVNGGGVIDGQ  461
             VNG G IDG+
Sbjct  119  TVNGSGSIDGR  129



>ref|XP_006356262.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=437

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 88/151 (58%), Gaps = 13/151 (9%)
 Frame = +3

Query  33   SASIFA--LYCCFYSMEVFV-------FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDD  185
            + SIFA  LY   +S  +FV       F+    L  S   S     V ++GAKGDG+TDD
Sbjct  5    NVSIFASLLYSIMFSFLLFVNVNSFDSFIQFPTLKDSRDKSLSLLYVNEFGAKGDGITDD  64

Query  186  SQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGS  365
            ++ F + WK ACSS      P++I+P G +FLV+P+ F GPC+S+ +  I+ G++VAP  
Sbjct  65   TKIFQDVWKKACSS---FLRPKIIVPIGYSFLVRPIDFVGPCRSK-VSLIIEGSIVAPKD  120

Query  366  PPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            P  W+ LD  +WL F  V  L V GGG I+G
Sbjct  121  PKVWDKLDAHKWLYFVKVRHLTVQGGGTING  151



>ref|XP_010537985.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537986.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Tarenaya 
hassleriana]
Length=446

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 88/147 (60%), Gaps = 10/147 (7%)
 Frame = +3

Query  27   ILSASIFALYCCFYSMEVFVFLFILGLISS--SRVSCKSFNVI-DYGAKGDGMTDDSQAF  197
            +LS  IF+      + E F  L  L    S  +R  C+   ++ D+GAKGDG  DD+ AF
Sbjct  19   LLSVLIFSEA---VTAEAFESLLELPRSGSRPTRSKCRRVLLVSDFGAKGDGYNDDTGAF  75

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
            ++AWK ACSST      ++++P   T LV+PV F+GPCK++ +   VSGT++AP  P  W
Sbjct  76   VDAWKRACSSTV---KTRILVPENYTCLVRPVDFSGPCKAK-LTLQVSGTIIAPKDPSAW  131

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             GL+  +WL F GV  L V GGG ++G
Sbjct  132  EGLNPRKWLYFRGVNHLTVEGGGAVNG  158



>ref|XP_002299601.2| hypothetical protein POPTR_0001s17180g [Populus trichocarpa]
 gb|EEE84406.2| hypothetical protein POPTR_0001s17180g [Populus trichocarpa]
Length=447

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 90/153 (59%), Gaps = 14/153 (9%)
 Frame = +3

Query  33   SASIFALYC-CFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA--  194
            + +I  L C CF  ++ F  L  L   + +R+   S  V+   D+GAKGDG+++D+QA  
Sbjct  13   TTTIRVLICACFVCVQGFDSLLQLPQSAPARIRPSSKRVLVVGDFGAKGDGLSNDTQACH  72

Query  195  ----FLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
                F  AW+ ACS        +++IPAG  FLV PV F GPCKS+ +   +SGT+VAP 
Sbjct  73   HYTAFKEAWEMACS---FRGRTRIVIPAGYNFLVHPVDFGGPCKSK-VTLDISGTIVAPE  128

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P  W GL+  +WL F+GV  L V GGG ++G+
Sbjct  129  DPAAWKGLNHRKWLYFHGVKHLTVEGGGTVNGR  161



>dbj|BAJ53225.1| JHL06P13.4 [Jatropha curcas]
Length=380

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = +3

Query  78   VFVFLFILGLIS--SSRVSC--KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            +F  L++L ++S  SS +S     +NV+ YGA GDG  DD+QAF+ AW  AC       +
Sbjct  4    LFTILYVLTILSIMSSVISSPINHYNVLSYGAVGDGNEDDTQAFVEAWNAACHCD--EDT  61

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P++++P   TFLV P+ F GPCKS +I  ++SGT++AP     W   +  +WL+F  V+G
Sbjct  62   PRLVVPEDKTFLVNPINFLGPCKSGNIEVVLSGTIIAPDGSNPWMENNVGRWLAFRDVHG  121

Query  426  LIVNGGGVIDGQ  461
            L + G G++DG+
Sbjct  122  LNITGDGMLDGR  133



>ref|XP_007013438.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
 gb|EOY31057.1| F18B13.22 protein isoform 3, partial [Theobroma cacao]
Length=276

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +3

Query  141  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  320
            +V+D+GA G+G  D S+AFL AW   CS     +S ++I+P   TFL+ PV F+G CK++
Sbjct  7    DVLDFGAVGNGKADSSEAFLKAWNFVCSRET--ESVRLIVPGKHTFLLHPVTFSGQCKAR  64

Query  321  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             I F++ GT+V+P SP  W GLD  +WL+F GV GL V G G I+G+
Sbjct  65   EIKFLIHGTIVSPVSPKAWEGLDQGKWLTFYGVSGLKVKGTGEINGR  111



>dbj|BAJ53238.1| JHL06P13.19 [Jatropha curcas]
Length=443

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 9/153 (6%)
 Frame = +3

Query  18   P*LILSASIFALYCC-FYSMEVFVFLFIL---GLISSSRVSCKS-FNVIDYGAKGDGMTD  182
            P LI+   I    C  F   E F  L  L    L++++R   K  F V D+GAKGDG ++
Sbjct  11   PFLIVLIHICVCICTSFVYTEGFDSLLQLPQSELLANTRPRSKRVFFVGDFGAKGDGFSN  70

Query  183  DSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
            D++AF++AW+ ACS        ++IIPAG  FLV PV   GPCKS+ I  I+SGT+ AP 
Sbjct  71   DTKAFIDAWRMACSCP---ARTRIIIPAGFIFLVHPVDLAGPCKSR-ITLIISGTITAPK  126

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P  W GL+  +WL F+GV  L ++GGG I+G 
Sbjct  127  DPAHWKGLNPRKWLYFHGVNHLTIDGGGTINGM  159



>ref|XP_006845766.2| PREDICTED: probable polygalacturonase At1g80170 [Amborella trichopoda]
Length=397

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 4/108 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V+DYGAKGDGM DD+ AF  AW  ACS+     SP++IIP+G+ F V P+QF GPC+S
Sbjct  26   FDVMDYGAKGDGMKDDTDAFSKAWNAACSA---KGSPEMIIPSGNLFSVGPLQFTGPCES  82

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              +H  V G ++ P  P  W+G     WL F+ + GL +NG G IDG 
Sbjct  83   NDVHVNVEGDILGP-PPSSWDGARKETWLVFSHINGLTINGSGKIDGH  129



>gb|KCW81410.1| hypothetical protein EUGRSUZ_C02787, partial [Eucalyptus grandis]
Length=391

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSR---VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            +++ LF      SS     +  ++NV++YGA G G  DD+QAF+ AW+D C  +    +P
Sbjct  6    IYLVLFAASSTFSSHGIVAASTTYNVVNYGATGSGDDDDAQAFVKAWEDTCGDSGEKGTP  65

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             + +P G  F + PV F GPCKS  I+  + GT+VAP S  GW G  + +WL+F  V  L
Sbjct  66   TLAVPGGKKFRLSPVAFKGPCKSSSINVQIDGTLVAPSSLSGWKGCSSGKWLNFQDVANL  125

Query  429  IVNGGGVIDGQ  461
             V G G +DGQ
Sbjct  126  NVKGSGQVDGQ  136



>ref|XP_010051184.1| PREDICTED: probable polygalacturonase At3g15720 [Eucalyptus grandis]
Length=495

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 0/109 (0%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            ++NV++YGA G G  DDSQAF+ AW+D C  +    +P + +P G  F + PV F GPCK
Sbjct  124  TYNVVNYGATGSGDDDDSQAFVKAWEDTCGDSGEKGTPTLAVPGGKKFRLSPVAFKGPCK  183

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  I+  + GT+VAP S  GW G  + +WL+F  V  L V G G +DGQ
Sbjct  184  SSSINVQIDGTLVAPSSLSGWKGCSSGRWLNFQDVANLNVKGSGQVDGQ  232



>gb|KHN43850.1| Putative polygalacturonase [Glycine soja]
Length=402

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNVIDYGA G+G TDDSQAFL AWKDAC+++  + +  ++IP   TF+++PV F GPCK
Sbjct  29   SFNVIDYGATGNGQTDDSQAFLKAWKDACNAS--YGTATLLIPKEKTFMLQPVLFRGPCK  86

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQ--WLSFNGVYGLIVNGG--GVIDGQ  461
               +H  + GT++AP     W    +++  W+ F  + GL++ GG  G+IDGQ
Sbjct  87   PPIVHIKLKGTIIAPNKIEAWKLPKSTRMAWIRFRHISGLVIRGGGWGLIDGQ  139



>ref|XP_012073215.1| PREDICTED: probable polygalacturonase At1g80170 isoform X1 [Jatropha 
curcas]
 gb|KDP37111.1| hypothetical protein JCGZ_06167 [Jatropha curcas]
Length=445

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 80/120 (67%), Gaps = 5/120 (4%)
 Frame = +3

Query  105  LISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  281
            L++++R   K  F V D+GAKGDG ++D++AF++AW+ ACS        ++IIPAG  FL
Sbjct  44   LLANTRPRSKRVFFVGDFGAKGDGFSNDTKAFIDAWRMACSCP---ARTRIIIPAGFIFL  100

Query  282  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            V PV   GPCKS+ I  I+SGT+ AP  P  W GL+  +WL F+GV  L ++GGG I+G 
Sbjct  101  VHPVDLAGPCKSR-ITLIISGTITAPKDPAHWKGLNPRKWLYFHGVNHLTIDGGGTINGM  159



>ref|XP_007034396.1| Pectin lyase superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY05322.1| Pectin lyase superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=404

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V+DYGA GDG TDDS+AF  AW D CS+    ++  + +P G TFL+KPV F GPCK+
Sbjct  22   FDVVDYGAAGDGQTDDSEAFNKAWTDVCSANTSQEAATLHVPPGKTFLLKPVAFKGPCKA  81

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              IHF + GT++AP     W+G   + W+ F  +  LI++G G IDGQ
Sbjct  82   NSIHFQLRGTLIAPLG-TSWSGDTLNTWIQFAWIDNLILDGDGKIDGQ  128



>gb|KDO45234.1| hypothetical protein CISIN_1g013309mg [Citrus sinensis]
Length=362

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 83/148 (56%), Gaps = 7/148 (5%)
 Frame = +3

Query  24   LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQA  194
            ++L   +  L     S E F  L  L    S+    KS  VI   D+GAKGDG  DD++A
Sbjct  14   IVLIHVLVCLSASLVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEA  73

Query  195  FLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPG  374
            F NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP  P  
Sbjct  74   FANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLEISGTIVAPKDPDV  129

Query  375  WNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            W GL+  +WL FN V  L V GGG I+G
Sbjct  130  WKGLNRRRWLYFNRVNHLTVQGGGTING  157



>emb|CBI36284.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 89/158 (56%), Gaps = 17/158 (11%)
 Frame = +3

Query  27   ILSASIFALYCCFYSMEVFVFLFILGL-------------ISSSRVSCKSFNVIDYGAKG  167
            +L+  +    C   ++ +F+ LF++ +              +  R+  K   V  +GAKG
Sbjct  1    MLTQEVMKSLCLICTVFIFLVLFLINVEGFEPLIQLPHSPAARPRLETKILYVNQFGAKG  60

Query  168  DGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGT  347
            DG+ DD+ AF NAWK AC+S        ++IP    FLV+P+ F GPC+++ +   +SGT
Sbjct  61   DGVQDDTDAFRNAWKIACASI---TKASIVIPHDKKFLVRPISFGGPCRAK-VTVTISGT  116

Query  348  VVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            ++AP  P  W+GL+  +WL F+GV  L V G G+I+G+
Sbjct  117  IIAPKDPDVWHGLNPQKWLYFHGVNHLTVRGSGIINGR  154



>gb|KDO45211.1| hypothetical protein CISIN_1g041224mg [Citrus sinensis]
Length=400

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            S +VI +GA GDG TDDSQAFL AWK  C S     +  +++PAG TFL+ PV F GPCK
Sbjct  32   SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAAPLLVPAGKTFLLNPVSFQGPCK  89

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+
Sbjct  90   SSSINVQIQGNIVAPHS-SAWDGHDKKKWLLFSNVNGLTVNGNGKIDGK  137



>gb|KDO45207.1| hypothetical protein CISIN_1g039868mg [Citrus sinensis]
Length=346

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            +NV+++GA G+G+TDDSQAF+ AW   C  T    +P + +P G TFL++P  F GPCKS
Sbjct  16   YNVMNFGAVGNGVTDDSQAFIKAWNAVCGDTS--NNPTLQVPQGKTFLLQPTSFQGPCKS  73

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             ++   + G ++AP  P  W G D   WL F  V G  VNG G IDGQ
Sbjct  74   SNLQVQIEGNLIAPEGPSSWKGKDRRSWLYFVNVNGFTVNGNGEIDGQ  121



>ref|NP_001275837.1| polygalacturonase precursor [Citrus sinensis]
 gb|ABM67700.1| polygalacturonase [Citrus sinensis]
Length=445

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 14/152 (9%)
 Frame = +3

Query  12   IHP*LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTD  182
            IH  + LSAS+        S E F  L  L    S+    KS  VI   D+GAKGDG  D
Sbjct  17   IHVLVCLSASLV-------STEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFND  69

Query  183  DSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
            D++AF NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP 
Sbjct  70   DTEAFANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLKISGTIVAPK  125

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             P  W GL+  +WL FN V  L V GGG I+G
Sbjct  126  DPDVWKGLNRRRWLYFNRVNHLTVQGGGTING  157



>gb|KDO45233.1| hypothetical protein CISIN_1g013309mg [Citrus sinensis]
Length=445

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 86/152 (57%), Gaps = 14/152 (9%)
 Frame = +3

Query  12   IHP*LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTD  182
            IH  + LSAS+        S E F  L  L    S+    KS  VI   D+GAKGDG  D
Sbjct  17   IHVLVCLSASLV-------STEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFND  69

Query  183  DSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPG  362
            D++AF NAWK ACS     K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP 
Sbjct  70   DTEAFANAWKKACSFPARTK---IVFSAGYTFLIHPIDISGPCKSR-LTLEISGTIVAPK  125

Query  363  SPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             P  W GL+  +WL FN V  L V GGG I+G
Sbjct  126  DPDVWKGLNRRRWLYFNRVNHLTVQGGGTING  157



>ref|XP_006427234.1| hypothetical protein CICLE_v10027523mg [Citrus clementina]
 gb|ESR40474.1| hypothetical protein CICLE_v10027523mg [Citrus clementina]
Length=427

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   FYSMEVFVFLFILGLISSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTP  233
              S E F  L  L    S+    KS  VI   D+GAKGDG  DD++AF NAWK ACS   
Sbjct  9    LVSTEGFDSLLELPHSGSNGTRSKSKRVIFVGDFGAKGDGFNDDTEAFANAWKKACSFPA  68

Query  234  VHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFN  413
              K   ++  AG TFL+ P+  +GPCKS+ +   +SGT+VAP  P  W GL+  +WL FN
Sbjct  69   RTK---IVFSAGYTFLIHPIDISGPCKSR-LTLEISGTIVAPKDPDVWKGLNRRRWLYFN  124

Query  414  GVYGLIVNGGGVIDG  458
             V  L V GGG IDG
Sbjct  125  RVNHLTVQGGGTIDG  139



>ref|XP_012082168.1| PREDICTED: probable polygalacturonase At3g15720 [Jatropha curcas]
 gb|KDP29312.1| hypothetical protein JCGZ_19407 [Jatropha curcas]
Length=398

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNV+DYGA GDG TD+SQA L AW+D C +T    +P +I+PAG TFL+KPV+F GPCK
Sbjct  21   SFNVLDYGAIGDGKTDNSQAVLRAWEDLCGAT--RGTPTLIVPAGGTFLLKPVRFQGPCK  78

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
            S+++H  + GT+VA  +   W G D   WL F+ V GL
Sbjct  79   SKNLHIQIQGTIVASNNINAW-GKDKGSWLQFSDVNGL  115



>ref|XP_007163810.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
 gb|ESW35804.1| hypothetical protein PHAVU_001G266200g [Phaseolus vulgaris]
Length=392

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 5/130 (4%)
 Frame = +3

Query  81   FVFLFILGLISSSRV--SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQV  254
            FV L  + +I+SS    S  +FNV+ YGA G+G TDD+QAFL AWKD C +T      ++
Sbjct  6    FVLLIFVRVIASSTFCPSSLTFNVLSYGATGNGHTDDTQAFLKAWKDVCGAT--RNYVKL  63

Query  255  IIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ-WLSFNGVYGLI  431
            +IP    FL++P+ F GPC    I  ++ GTV AP     W  LD  + W+ F+ + GL+
Sbjct  64   LIPDNKMFLLQPLSFKGPCNPATIEVLLEGTVTAPERVGVWKFLDNRRKWIQFSDISGLV  123

Query  432  VNGGGVIDGQ  461
            + GGG IDGQ
Sbjct  124  MKGGGQIDGQ  133



>ref|XP_007013437.1| F18B13.22 protein isoform 2 [Theobroma cacao]
 gb|EOY31056.1| F18B13.22 protein isoform 2 [Theobroma cacao]
Length=374

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = +3

Query  141  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  320
            +V+D+GA G+G  D S+AFL AW   CS     +S ++I+P   TFL+ PV F+G CK++
Sbjct  7    DVLDFGAVGNGKADSSEAFLKAWNFVCSRET--ESVRLIVPGKHTFLLHPVTFSGQCKAR  64

Query  321  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             I F++ GT+V+P SP  W GLD  +WL+F GV GL V G G I+G+
Sbjct  65   EIKFLIHGTIVSPVSPKAWEGLDQGKWLTFYGVSGLKVKGTGEINGR  111



>ref|XP_008454473.1| PREDICTED: probable polygalacturonase At3g15720 [Cucumis melo]
Length=386

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = +3

Query  84   VFLFILGLISSSRV-SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVII  260
            +  + + ++SS  V S   FNV+DYGA G+G TDDS+AFL AW D C +T    SP + +
Sbjct  8    ILTYSIAILSSRTVLSSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT--QDSPTLHV  65

Query  261  PAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNG  440
            P G T+L+ P++F GPCKS  + F + GT++AP +   W     S+W+ F  V GL V G
Sbjct  66   PDGKTYLLSPLKFQGPCKSNQVIFDLGGTLMAP-TKDEWPNDGKSKWVQFVDVEGLNVQG  124

Query  441  GGVIDGQ  461
            GG  DGQ
Sbjct  125  GGRFDGQ  131



>gb|KDO45212.1| hypothetical protein CISIN_1g047738mg, partial [Citrus sinensis]
Length=391

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = +3

Query  69   SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            SM + + L  L   I+ +     +FNV++YGA G+G +DDS A+  AW DAC +    ++
Sbjct  5    SMCILILLSTLATHINVNADDQNTFNVLNYGAVGNGNSDDSLAYAKAWNDACKANA--QT  62

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P +IIP G TFLV P+ F+GPCKS +I   +SGT+ AP  P  W   +  +W++F  + G
Sbjct  63   PTMIIPKGKTFLVHPITFSGPCKSSNISIQLSGTIKAPDGPSAWTS-EIGRWIAFGNITG  121

Query  426  LIVNGGGVIDGQ  461
            L +NG G+ DG 
Sbjct  122  LNINGRGLFDGN  133



>ref|XP_007034395.1| Pectin lyase superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY05321.1| Pectin lyase superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=480

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V+DYGA GDG TDDS+AF  AW D CS+    ++  + +P G TFL+KPV F GPCK+
Sbjct  22   FDVVDYGAAGDGQTDDSEAFNKAWTDVCSANTSQEAATLHVPPGKTFLLKPVAFKGPCKA  81

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              IHF + GT++AP     W+G   + W+ F  +  LI++G G IDGQ
Sbjct  82   NSIHFQLRGTLIAPLG-TSWSGDTLNTWIQFAWIDNLILDGDGKIDGQ  128



>ref|XP_007216032.1| hypothetical protein PRUPE_ppa014982mg, partial [Prunus persica]
 gb|EMJ17231.1| hypothetical protein PRUPE_ppa014982mg, partial [Prunus persica]
Length=449

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = +3

Query  114  SSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  284
            S+R   KS  V+   D+GAKGDG+TDDS+AF NAW+ ACS  P+    +++IP GST+LV
Sbjct  46   STRTRPKSKRVLFVGDFGAKGDGITDDSKAFKNAWEIACS-LPMRM--RIVIPVGSTYLV  102

Query  285  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             P+   GPC+S+ +  ++SG +VAP  P  W GL+  +WL F+GV  L + GGG I+G
Sbjct  103  HPLDIAGPCRSK-VTLMISGNIVAPKDPDAWIGLNPRKWLYFHGVNHLTLEGGGRING  159



>ref|XP_006285343.1| hypothetical protein CARUB_v10006733mg [Capsella rubella]
 gb|EOA18241.1| hypothetical protein CARUB_v10006733mg [Capsella rubella]
Length=393

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 4/120 (3%)
 Frame = +3

Query  108  ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  287
            I S R   K+FNV+DYGA GDG  DDS+AF +AWK  C+      + +  IP G TFL++
Sbjct  29   IISRRYDRKTFNVLDYGAIGDGSFDDSKAFKDAWKKTCNFFGAQATME--IPQGYTFLLQ  86

Query  288  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLD--TSQWLSFNGVYGLIVNGGGVIDGQ  461
            P++F+GPC S+ I+F ++G ++AP SP  W+  +    QW+ F  + GL ++G G +DGQ
Sbjct  87   PIEFHGPCVSKKINFSINGNLIAPASPDEWDCKNDHCHQWIEFAHIDGLYIDGHGTLDGQ  146



>emb|CDY69377.1| BnaCnng63250D [Brassica napus]
Length=400

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   YSMEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            + ME+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS   +K
Sbjct  8    HRMEIIVRVVFVLTLVNFGFVNGQIYDVLKFGAEGDGTTDDSKAFVEAWKAMCSSGGSNK  67

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +  ++IP+ +TFL++P+ F GPC S  +   + G +VAP +   W+ L + +W+SF+ + 
Sbjct  68   T--LLIPSDNTFLLQPLVFQGPCNSPSVQVQLDGKIVAPLNKAAWSDLKSYEWVSFHKII  125

Query  423  GLIVNGGGVIDGQ  461
            GL V G G I+G+
Sbjct  126  GLTVLGSGTINGR  138



>ref|XP_002321662.2| hypothetical protein POPTR_0015s10000g [Populus trichocarpa]
 gb|EEF05789.2| hypothetical protein POPTR_0015s10000g [Populus trichocarpa]
Length=358

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = +3

Query  111  SSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVK  287
            S S  SC   +NVIDYGA GDG TDD+QAF +AWKD C S+     P + +P+G +FL++
Sbjct  21   SRSLRSCNQVYNVIDYGAVGDGDTDDTQAFKDAWKDVCKSSSC-SVPIIQVPSGKSFLLQ  79

Query  288  PVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLD---TSQWLSFNGVYGLIVNGGGVIDG  458
            P+ FNG CK   I F + GT+ AP  P  W   +     QW++F+ V  L + G G +DG
Sbjct  80   PLTFNGECKPDQIIFQIDGTMKAPSDPSDWKCQEHRYCKQWITFDEVDNLTIRGSGTMDG  139

Query  459  Q  461
            Q
Sbjct  140  Q  140



>ref|XP_009802084.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=455

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (61%), Gaps = 10/147 (7%)
 Frame = +3

Query  36   ASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQAF  197
            AS++ +Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ +F
Sbjct  26   ASLYGIYFVLISANVNGFDSVIQLPTSASLRNTTRKSETLFDVSDFGAVGDGITDDTNSF  85

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
             +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP  P  W
Sbjct  86   KDAWDKACSSASRSK---IVIPGGYSFLVQPLNFAGPCRSK-VSLGIAGTILAPKDPKVW  141

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +GL+  +WL F  V  L + GGG I+G
Sbjct  142  DGLNPRKWLYFRSVKYLTIEGGGAING  168



>ref|XP_002515527.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF46976.1| polygalacturonase, putative [Ricinus communis]
Length=363

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 8/136 (6%)
 Frame = +3

Query  63   FYSMEVFVFLFILG--LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            F+   + VF       +I+  R   ++FN  ++GA GDG TD+S+AFL AW+  C++T V
Sbjct  4    FFLATILVFCVATSNLVIADGR---RNFNAAEFGAIGDGQTDNSEAFLKAWEAVCTAT-V  59

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN-GLDTSQWLSFN  413
              +  + IPAG TFL+ PV+F GPCKS  +H  V G +VAP +   W     +S WL F 
Sbjct  60   RGTATLEIPAG-TFLLNPVKFEGPCKSNKVHLQVLGKIVAPRTIDEWRPRCKSSVWLLFR  118

Query  414  GVYGLIVNGGGVIDGQ  461
            G+ GLIVNG G IDG+
Sbjct  119  GISGLIVNGPGAIDGR  134



>ref|XP_007203411.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
 gb|EMJ04610.1| hypothetical protein PRUPE_ppa021427mg, partial [Prunus persica]
Length=383

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            S+   +  +F+V DYGA   G  DDS+AFL AW  AC+S    ++P +I+P    FL+ P
Sbjct  7    STEHANQTTFDVRDYGAVSGGHIDDSEAFLKAWNAACTSET--ENPTLIVPP-KRFLLNP  63

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            + F+GPC+++ I+F++ G ++AP SP  W  LD SQWL+FNGV GL + G G I+G+
Sbjct  64   IVFSGPCRAKSINFLIFGRLLAPDSPGAWKELDPSQWLAFNGVSGLNIAGPGRINGR  120



>emb|CDY39404.1| BnaAnng05350D [Brassica napus]
Length=399

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            +E+ V  +F+L L++   V+ + ++V+ +GA+GDG TDDS+AF+ AWK  CSS   +K+ 
Sbjct  9    IEIIVRVVFVLTLLNFGFVNSQIYDVLKFGAEGDGTTDDSKAFVAAWKAMCSSGGSNKT-  67

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP+ +TFL++P+ F GPC S  +   + G +VAP +   W+GL + +W+SF+ + GL
Sbjct  68   -LLIPSDNTFLLQPLVFQGPCNSPSVQVQLDGKIVAPLNKAAWSGLKSYEWVSFHKIIGL  126

Query  429  IVNGGGVIDGQ  461
             V G G I+G+
Sbjct  127  TVLGSGTINGR  137



>gb|KEH25592.1| polygalacturonase [Medicago truncatula]
Length=400

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNV+DYGA G+G  D+++AF++AWKD C    +H+S  ++IP G TF+++PV F GPC 
Sbjct  29   SFNVLDYGAVGNGKNDETRAFVDAWKDTC--IAMHESSTLLIPKGKTFMLQPVWFQGPCN  86

Query  315  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S +I+  + GT++AP +   W   N      W+ F  + GLIV GGG+IDG+
Sbjct  87   SSNIYVKLEGTIIAPKNIEAWKWPNDNYKGSWIRFIEISGLIVYGGGIIDGK  138



>gb|EPS66872.1| polygalacturonase, partial [Genlisea aurea]
Length=299

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 70/107 (65%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
             NV D+GA GDG+ DD+Q+  + WK AC   P+    ++++PA ST+L+KP  FNGPC+S
Sbjct  2    LNVDDFGAVGDGINDDTQSLHDVWKKAC---PLPSPAEIVVPAQSTYLIKPTDFNGPCQS  58

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             ++   +SG +VAP  P  W GLD  +WL FN V    V GGG+IDG
Sbjct  59   -NLTLKISGLLVAPEDPTVWEGLDLRKWLYFNRVDNFTVEGGGMIDG  104



>ref|XP_006364199.1| PREDICTED: probable polygalacturonase At1g80170-like [Solanum 
tuberosum]
Length=452

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 94/147 (64%), Gaps = 8/147 (5%)
 Frame = +3

Query  30   LSASIFALYCCFYSMEVFVFLFILGLI-SSSRVSCKS---FNVIDYGAKGDGMTDDSQAF  197
            L AS+++LY    S  V  F  +L L+ +S+ +  KS   F V D+GA GDG+TDD+++F
Sbjct  23   LFASLYSLYFLLISANVSGFESLLQLLPASASLRSKSESLFQVNDFGAAGDGITDDTKSF  82

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
             + W  ACSS P H   +++IPAG +FLV+ + F GPC+S+ +   ++GT++AP  P  W
Sbjct  83   KDVWDMACSS-PSHA--KIVIPAGYSFLVRHINFAGPCRSK-VSIRIAGTILAPKDPEVW  138

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + L+  +WL F  V  L V GGG+I+G
Sbjct  139  DDLNPRKWLYFFRVKHLTVEGGGIING  165



>gb|AFK43754.1| unknown [Medicago truncatula]
Length=400

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            SFNV+DYGA G+G  D+++AF++AWKD C    +H+S  ++IP G TF+++PV F GPC 
Sbjct  29   SFNVLDYGAVGNGKNDETRAFVDAWKDTC--IAMHESSTLLIPKGKTFMLQPVWFQGPCN  86

Query  315  SQHIHFIVSGTVVAPGSPPGW---NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S +I+  + GT++AP +   W   N      W+ F  + GLIV GGG+IDG+
Sbjct  87   SSNIYVKLEGTIIAPKNIEAWKWPNDNYKGSWIRFIEISGLIVYGGGIIDGK  138



>ref|XP_012073436.1| PREDICTED: probable polygalacturonase At1g80170 [Jatropha curcas]
Length=650

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 83/132 (63%), Gaps = 6/132 (5%)
 Frame = +3

Query  78   VFVFLFILGLIS--SSRVSC--KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            +F  L++L ++S  SS +S     +NV+ YGA GDG  DD+QAF+ AW  AC       +
Sbjct  7    LFTILYVLTILSIMSSVISSPINHYNVLSYGAVGDGNEDDTQAFVEAWNAACHCD--EDT  64

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P++++P   TFLV P+ F GPCKS +I  ++SGT++AP     W   +  +WL+F  V+G
Sbjct  65   PRLVVPEDKTFLVNPINFLGPCKSGNIEVVLSGTIIAPDGSNPWMENNVGRWLAFRDVHG  124

Query  426  LIVNGGGVIDGQ  461
            L + G G++DG+
Sbjct  125  LNITGDGMLDGR  136


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +F+ +     + SS+ + +S NV+++GA G+G  DDS AF  A + AC +T       + 
Sbjct  434  IFLLIMCKATLQSSK-ALRSVNVVNFGAVGNGNADDSNAFTKASEAACGAT---GEASLT  489

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAP  359
            +PA  TFL+KPV+F GPCKS  I+ +V G +VAP
Sbjct  490  VPAQKTFLLKPVKFLGPCKSSQINILVQGNIVAP  523



>gb|AHG12641.1| polygalacturonase [Nicotiana tabacum]
Length=455

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (61%), Gaps = 10/147 (7%)
 Frame = +3

Query  36   ASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQAF  197
            AS++ +Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ +F
Sbjct  26   ASLYGIYFVLISANVNGFDSVIQLPTSASLRNTTRKSETLFDVSDFGAVGDGITDDTNSF  85

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
             +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP  P  W
Sbjct  86   KDAWDKACSSASRLK---IVIPGGYSFLVQPLNFAGPCRSK-VSLGIAGTILAPKDPKVW  141

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +GL+  +WL F  V  L + GGG I+G
Sbjct  142  DGLNPRKWLYFRSVKYLTIEGGGAING  168



>ref|XP_010533165.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S     +
Sbjct  15   LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGSL---GN  70

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P ++IP   TFLV P+ F+GPC+S  I   V GTV+AP SP  W G D  +WL F  V G
Sbjct  71   PIMVIPKYMTFLVHPLVFSGPCRSTSITVAVIGTVIAPDSPAAWKGKDPGKWLEFIDVSG  130

Query  426  LIVNGGG  446
            L V G G
Sbjct  131  LTVAGLG  137



>gb|KCW81409.1| hypothetical protein EUGRSUZ_C02785 [Eucalyptus grandis]
Length=395

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            +NVI+YGA G+G+ DD+QAF+ AW D+C  +    +P +++P G  F + PV F GPCKS
Sbjct  31   YNVINYGAIGNGVDDDTQAFVKAWGDSCGDSGARGTPTLVVPGGKKFKLSPVSFKGPCKS  90

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
                  + GT+VAP SP  W G     WL F  V  L V G G +DGQ
Sbjct  91   SSFIVKIDGTLVAPSSPSEWKGCSADSWLVFQDVANLNVKGSGQVDGQ  138



>ref|XP_006465488.1| PREDICTED: uncharacterized protein LOC102623476 [Citrus sinensis]
Length=815

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            S +VI +GA GDG TDDSQAFL AWK  C S     +  +++PAG TFL+ PV F GPCK
Sbjct  447  SVSVIQFGAVGDGETDDSQAFLKAWKSICGSKS--NAAPLLVPAGKTFLLNPVSFQGPCK  504

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  I+  + G +VAP S   W+G D  +WL F+ V GL VNG G IDG+
Sbjct  505  SSSINVQIQGNIVAPHS-SAWDGHDKKKWLLFSNVNGLTVNGNGKIDGK  552


 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = +3

Query  69   SMEVFVFLFILGL-ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            SM + + L  L   I+ +     +FNV++YGA G+G +DDS AF  AW DAC +    ++
Sbjct  13   SMCILILLSTLATRINVNADDQNTFNVLNYGAVGNGNSDDSLAFSKAWNDACKANA--QT  70

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P +IIP G TFLV+P+ F GPCKS +I   +SGT+ AP  P  W   +  +W++F  + G
Sbjct  71   PTMIIPKGKTFLVRPITFYGPCKSSNISIQLSGTIKAPDGPSAWTS-EIGRWIAFGNITG  129

Query  426  LIVNGGGVIDGQ  461
            L +NG G+ DG 
Sbjct  130  LNINGRGLFDGN  141



>ref|XP_010533164.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=424

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            ++ F+  F+L  I SS  S   F  +V+D+GA GDG T+D+QAFL+AW +AC S     +
Sbjct  15   LQEFLAFFVL-FIGSSHFSSAEFYLDVLDFGAVGDGHTNDTQAFLDAWDEACGSL---GN  70

Query  246  PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYG  425
            P ++IP   TFLV P+ F+GPC+S  I   V GTV+AP SP  W G D  +WL F  V G
Sbjct  71   PIMVIPKYMTFLVHPLVFSGPCRSTSITVAVIGTVIAPDSPAAWKGKDPGKWLEFIDVSG  130

Query  426  LIVNGGG  446
            L V G G
Sbjct  131  LTVAGLG  137



>ref|XP_003613981.1| Polygalacturonase [Medicago truncatula]
 gb|AES96939.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=400

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            +FNV+ YGA GDG TDDS AF+ AW D C +T    +P +IIP G TF+++P+ F GPCK
Sbjct  28   NFNVLTYGANGDGNTDDSNAFVKAWNDVCGTT--QGTPTLIIPEGKTFMLQPLSFQGPCK  85

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQ--WLSFNGVYGLIVNGGGVIDGQ  461
            S  I   V GT+ AP     W   D  +  W+ F+ + GL V G G IDGQ
Sbjct  86   STTIQVEVKGTITAPKDIEAWKWKDNKRRSWVQFSKINGLAVYGEGTIDGQ  136



>ref|XP_002515526.1| Polygalacturonase-2 precursor, putative [Ricinus communis]
 gb|EEF46975.1| Polygalacturonase-2 precursor, putative [Ricinus communis]
Length=395

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            + +F F +  I          NV+D+GA GDG T+DS AFL AW   C +T    +P + 
Sbjct  8    LLLFCFAVSTIVVEGARPSILNVVDFGAIGDGQTNDSMAFLQAWNALCEAT---TAPLLR  64

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            +PAG TFL++PV F+GPC S  +   V G++VAP S   W    +  WLSF+ V  L ++
Sbjct  65   VPAGKTFLLQPVIFSGPCSSSRVRIQVLGSIVAPRSRDAWKNGTSESWLSFSQVLNLTIS  124

Query  438  GGGVIDGQ  461
            G G IDGQ
Sbjct  125  GTGQIDGQ  132



>ref|XP_009765216.1| PREDICTED: probable polygalacturonase At3g15720 [Nicotiana sylvestris]
Length=530

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 76/130 (58%), Gaps = 8/130 (6%)
 Frame = +3

Query  84   VFLFILGLISS--SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +FL +L + S   S    K+FNV+++GA GDG  DD  AFL AW+  C S    +S +VI
Sbjct  15   IFLVLLCMFSPVWSADDIKTFNVVNFGAVGDGRNDDLPAFLKAWEAVCQS----ESSRVI  70

Query  258  --IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLI  431
              IP    FL+ P  F GPCK   IH  VSG ++AP S  GW+G  T+ WL F  +  L 
Sbjct  71   LVIPERKKFLLTPSTFEGPCKPSFIHIQVSGNIIAPNSKSGWDGRATNAWLIFENIDHLT  130

Query  432  VNGGGVIDGQ  461
            VNG GV DGQ
Sbjct  131  VNGNGVFDGQ  140


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +3

Query  159  AKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI--IPAGSTFLVKPVQFNGPCKSQHIHF  332
             KG  ++     FL AW+  C S    +S +VI  IP    FL+ P  F GPCK   IH 
Sbjct  161  CKGPTVSIHLNLFLKAWEAVCQS----ESSRVILVIPERKKFLLTPSTFEGPCKPSFIHI  216

Query  333  IVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             VSG ++AP S  GW+G  T+ WL F  +  L VNG GV DGQ
Sbjct  217  QVSGNIIAPNSKSGWDGRATNAWLIFENIDHLTVNGNGVFDGQ  259



>emb|CDX73440.1| BnaC08g25630D [Brassica napus]
Length=400

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ V  +F+L L++   ++ + ++V+ +GAKGDG TDDS+AF+ AWK  CSS   +K+ 
Sbjct  10   MEIIVRVVFVLTLVNFGILNGQVYDVLKFGAKGDGTTDDSEAFVEAWKAMCSSGGSNKT-  68

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             +++P+ +TFL++P+ F GPC S  +   + G +VAP +   W+   + +W+ FN + GL
Sbjct  69   -LLVPSDNTFLLQPLVFQGPCNSLSVQVQLEGKIVAPLNKAAWSDFKSYEWVCFNKIIGL  127

Query  429  IVNGGGVIDGQ  461
             V G G I G 
Sbjct  128  TVRGSGTITGH  138



>ref|XP_010051182.1| PREDICTED: probable polygalacturonase At3g15720 [Eucalyptus grandis]
Length=460

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            +NVI+YGA G+G+ DD+QAF+ AW D+C  +    +P +++P G  F + PV F GPCKS
Sbjct  52   YNVINYGAIGNGVDDDTQAFVKAWGDSCGDSGARGTPTLVVPGGKKFKLSPVSFKGPCKS  111

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
                  + GT+VAP SP  W G     WL F  V  L V G G +DGQ
Sbjct  112  SSFIVKIDGTLVAPSSPSEWKGCSADSWLVFQDVANLNVKGSGQVDGQ  159



>emb|CBI36303.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  278
            +GL     +S  + NV D+GA GDG TDDSQAFL AWK AC     +     II +G  F
Sbjct  9    IGLSDDDELS--TINVRDFGAIGDGTTDDSQAFLKAWKKACGIQAGY--VNFIIESGKAF  64

Query  279  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            L+KP++F GPC++ +I+  V GT+ AP S   W G     WL F  + GLIVNG G I+G
Sbjct  65   LLKPIRFEGPCRASYINIQVLGTITAPKSIYEWGGQSVDNWLIFFRINGLIVNGKGTING  124

Query  459  Q  461
            Q
Sbjct  125  Q  125



>ref|XP_002281827.2| PREDICTED: probable polygalacturonase At1g80170 [Vitis vinifera]
Length=452

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 17/148 (11%)
 Frame = +3

Query  57   CCFYSMEVFVFLFILGL-------------ISSSRVSCKSFNVIDYGAKGDGMTDDSQAF  197
            C   ++ +F+ LF++ +              +  R+  K   V  +GAKGDG+ DD+ AF
Sbjct  22   CLICTVFIFLVLFLINVEGFEPLIQLPHSPAARPRLETKILYVNQFGAKGDGVQDDTDAF  81

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
             NAWK AC+S        ++IP    FLV+P+ F GPC+++ +   +SGT++AP  P  W
Sbjct  82   RNAWKIACASI---TKASIVIPHDKKFLVRPISFGGPCRAK-VTVTISGTIIAPKDPDVW  137

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +GL+  +WL F+GV  L V G G+I+G+
Sbjct  138  HGLNPQKWLYFHGVNHLTVRGSGIINGR  165



>gb|ABR18059.1| unknown [Picea sitchensis]
Length=493

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 72/115 (63%), Gaps = 9/115 (8%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPV  293
            SS V C    V ++GAKGDG  DD++AF NAW  ACSS P       ++P G  +LVKP+
Sbjct  85   SSNVVC----VDEFGAKGDGENDDTKAFNNAWSKACSSAPA----VFLVPHGKKYLVKPI  136

Query  294  QFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +F+GPCKS  +   VSGT++AP  P  W+GL+  QWL F  V  L V GGG+  G
Sbjct  137  KFSGPCKSA-LTMQVSGTIIAPADPRVWDGLNRRQWLRFKEVDDLTVEGGGIFYG  190



>ref|XP_006398123.1| hypothetical protein EUTSA_v10001153mg, partial [Eutrema salsugineum]
 gb|ESQ39576.1| hypothetical protein EUTSA_v10001153mg, partial [Eutrema salsugineum]
Length=438

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 2/128 (2%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +   LF+L LI    V+ + F+V+ YGAKGDG TDDS+AF++AWK  C +   +K+  ++
Sbjct  3    ILRALFVLILIHFGLVNGQIFDVLKYGAKGDGTTDDSKAFVDAWKAVCGNGGNNKT--LL  60

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVN  437
            IP+ +TFL++P+ F GPCKS  +    +G +VAP S   W+      W+ F  + GL V 
Sbjct  61   IPSDNTFLLQPIVFQGPCKSPSVQVQFNGNIVAPKSKAEWSDYKNLSWVGFKDIIGLTVT  120

Query  438  GGGVIDGQ  461
            G G I+G+
Sbjct  121  GSGTINGR  128



>gb|KFK33181.1| hypothetical protein AALP_AA6G340800 [Arabis alpina]
Length=1123

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV +YGA GDG TDD++AF +AW+DAC+   +     + IP G TFL++P++F+GPCKS
Sbjct  142  FNVFNYGAIGDGFTDDTKAFKDAWEDACNY--IGSKSTLTIPQGRTFLLQPIEFHGPCKS  199

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIVNGGGVIDGQ  461
              I F +SG + AP +P  WN  +    +W+ F  + GL ++G G++DGQ
Sbjct  200  DKIVFSISGNLTAPEAPYQWNCENDQCHKWIEFAHINGLYIDGHGILDGQ  249



>ref|XP_010445851.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=134

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  72   MEVFV-FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ +  +F L L++S  V+ + ++V+ +GAKGDG+TD+S+AF+ AWK  C S    K+ 
Sbjct  1    MEIIIRVVFFLTLLNSVLVNGQIYDVLKFGAKGDGLTDESKAFVEAWKAMCGSGGNPKT-  59

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             ++IP+  TFL++P+ F GPCKS  +     G +VAP     W+     +W+SF  + GL
Sbjct  60   -LLIPSNKTFLLQPLVFQGPCKSPSVQIKFDGKIVAPRDKTAWDN-KLLKWVSFKKIIGL  117

Query  429  IVNGGGVIDG  458
             VNG G I G
Sbjct  118  TVNGSGSIMG  127



>ref|XP_004241700.1| PREDICTED: probable polygalacturonase At1g80170 [Solanum lycopersicum]
Length=437

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 13/151 (9%)
 Frame = +3

Query  33   SASIFA--LYCCFYSMEVFV-------FLFILGLISSSRVSCKSFNVIDYGAKGDGMTDD  185
            + SIFA  LY   +S  +FV       F+    L  S   S     V ++GAKGDG+TDD
Sbjct  5    NVSIFASLLYNTIFSFLLFVNVNSFDSFIQFPTLEDSRGKSVSLLYVNEFGAKGDGITDD  64

Query  186  SQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGS  365
            ++ F   WK AC+S      P++I+P G +FLV+P+ F GPC+S+ I  I+ G++VAP  
Sbjct  65   TKIFQYVWKRACAS---FLRPKIIVPIGYSFLVQPIDFVGPCRSK-ISLIIEGSIVAPKD  120

Query  366  PPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            P  W+ LD  +WL F  V  L V GGG I+G
Sbjct  121  PKVWDKLDAHKWLYFVKVRHLTVQGGGTING  151



>ref|XP_010654934.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +3

Query  99   LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTF  278
            +GL     +S  + NV D+GA GDG TDDSQAFL AWK AC     +     II +G  F
Sbjct  9    IGLSDDDELS--TINVRDFGAIGDGTTDDSQAFLKAWKKACGIQAGY--VNFIIESGKAF  64

Query  279  LVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            L+KP++F GPC++ +I+  V GT+ AP S   W G     WL F  + GLIVNG G I+G
Sbjct  65   LLKPIRFEGPCRASYINIQVLGTITAPKSIYEWGGQSVDNWLIFFRINGLIVNGKGTING  124

Query  459  Q  461
            Q
Sbjct  125  Q  125



>ref|XP_009594191.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana tomentosiformis]
Length=454

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 90/149 (60%), Gaps = 10/149 (7%)
 Frame = +3

Query  30   LSASIFALYCCFYSMEVFVFLFILGLISS------SRVSCKSFNVIDYGAKGDGMTDDSQ  191
            L AS++++Y    S  V  F  ++ L +S      +R S   F+V D+GA GDG+TDD+ 
Sbjct  23   LFASLYSIYFVLISANVNGFDSVIQLPTSASVRNTTRKSETLFDVGDFGAIGDGITDDTN  82

Query  192  AFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPP  371
            +F +AW  ACSS    K   ++IP G +FLV+P+ F GPC+S+ +   ++GT++AP    
Sbjct  83   SFKDAWDKACSSASRSK---IVIPGGYSFLVRPLNFAGPCRSK-VSLRIAGTILAPKDLE  138

Query  372  GWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             W+GL+  +WL F  +  L + GGG I+G
Sbjct  139  VWDGLNPRKWLYFRSMKHLTIEGGGTING  167



>ref|XP_009139940.1| PREDICTED: polygalacturonase QRT2 [Brassica rapa]
Length=421

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            SS  V+ K FNV DYGA G+G  DD++AF++AW+D C+   +     + IP G TFL++P
Sbjct  24   SSPDVNSKIFNVFDYGAIGNGYADDTKAFMDAWEDTCNC--IGSKSTMEIPQGRTFLLQP  81

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            V F+GPCKS+ I F +SG + AP +P  W  N     QW+ F  + GL ++G G IDGQ
Sbjct  82   VGFHGPCKSKKIVFSISGNLTAPYAPYQWKCNEDYCHQWIEFAHINGLYIDGPGTIDGQ  140



>ref|XP_003546932.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X1 [Glycine max]
Length=443

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
             +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFLV PV   GPC+S
Sbjct  51   LSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFLVHPVDIGGPCRS  107

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G
Sbjct  108  K-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRING  153



>ref|XP_002309621.2| hypothetical protein POPTR_0006s26920g, partial [Populus trichocarpa]
 gb|EEE93144.2| hypothetical protein POPTR_0006s26920g, partial [Populus trichocarpa]
Length=384

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            K FNV+ +GA GDG TDDS AF  AW   C ++    +P ++IP G  F +KPV+F GPC
Sbjct  3    KPFNVLSFGAVGDGKTDDSPAFTKAWGALCGAS--GGTPTLVIPPGRAFSLKPVKFEGPC  60

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  +H  V+G +VAP +  GW G     WL F+ V GL+++G G IDG+
Sbjct  61   KSNSVHIQVAGNIVAPSTVAGWGGCGILFWLCFSNVNGLVLDGSGHIDGR  110



>ref|XP_007023876.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY26498.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            +  +V D+GAKGD   +D++AF NAWK ACS        +++IPAG T+L+ PV+  GPC
Sbjct  56   RVLSVHDFGAKGDAHHNDTKAFQNAWKMACS---FPARTRILIPAGYTYLIHPVELGGPC  112

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +S+ +  ++SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G
Sbjct  113  ESK-VTLMISGTIVAPEDPDVWDGLNPRKWLYFHGVNHLHVDGGGTING  160



>ref|XP_006597127.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X4 [Glycine max]
Length=436

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
             +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFLV PV   GPC+S
Sbjct  51   LSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFLVHPVDIGGPCRS  107

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G
Sbjct  108  K-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRING  153



>ref|XP_004305261.1| PREDICTED: probable polygalacturonase At3g15720 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 79/135 (59%), Gaps = 6/135 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVS----CKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            M   + L IL  I+SS  S      +FNV+DYGA GDG  DDS+AFL AW  +CS+    
Sbjct  1    MRNALVLLILHTIASSNFSFGHGQTTFNVLDYGAAGDGERDDSKAFLEAWNASCSTYASE  60

Query  240  KSPQVIIPAGSTFLVKPVQFNGPCKSQH-IHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
             +  ++IPA  TFL++P  F+G C S + I   + G +VAP +P  W     S WLSF  
Sbjct  61   GTTTLVIPAEKTFLLQPTTFSGSCNSGNGIRVEIMGKIVAPKNPDEWKECVES-WLSFGN  119

Query  417  VYGLIVNGGGVIDGQ  461
            +  LI+NG G I+GQ
Sbjct  120  LSNLIINGTGEINGQ  134



>ref|XP_006597125.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X2 [Glycine max]
 ref|XP_006597126.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X3 [Glycine max]
Length=458

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
             +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFLV PV   GPC+S
Sbjct  51   LSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFLVHPVDIGGPCRS  107

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G
Sbjct  108  K-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRING  153



>ref|XP_010250371.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=452

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  284
            L+ S+      FNV DYGA GDG TDDSQA L AW   C  TP    P +++P+G TFLV
Sbjct  70   LVCSNANVISYFNVRDYGAAGDGSTDDSQAVLKAWSAMCK-TPT-GIPTMVVPSGKTFLV  127

Query  285  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P+ F+GPC ++ I   + G ++AP     W G D S W+ F  V GL V+G G +DG+
Sbjct  128  NPISFDGPCMAKKISVQIIGNIIAPSKTDAWKGKDQSTWIRFAKVSGLSVSGPGTVDGR  186



>ref|XP_011459190.1| PREDICTED: probable polygalacturonase At3g15720 [Fragaria vesca 
subsp. vesca]
Length=403

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 72/109 (66%), Gaps = 2/109 (2%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            +F+V D+GA G+G+ DDS+AFL+AW+ AC +  V +   + IP G  ++VKPVQF+GPC 
Sbjct  28   TFDVRDFGATGNGLNDDSRAFLDAWQRACGA--VGEIQTLNIPIGRKYMVKPVQFDGPCN  85

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S++I   V G++ AP +   W G +   WL F  V GL + G GVIDG+
Sbjct  86   SKNIVIQVDGSIEAPSTIGEWTGCELGSWLGFQNVKGLTIKGAGVIDGK  134



>ref|XP_006427249.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
 gb|ESR40489.1| hypothetical protein CICLE_v10027366mg [Citrus clementina]
Length=415

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            +FNV++YGA G+G +DDS A+  AW DAC +    ++P +IIP G TFLV P+ F+GPCK
Sbjct  45   TFNVLNYGAVGNGNSDDSLAYAKAWNDACKANA--QTPTMIIPKGKTFLVHPITFSGPCK  102

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S +I   +SGT+ AP  P  W   +  +W+ F  + GL +NG G  DG 
Sbjct  103  SSNISIQLSGTIKAPDGPSAWTS-EIERWIVFGNITGLNINGRGHFDGN  150



>ref|XP_007212964.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
 gb|EMJ14163.1| hypothetical protein PRUPE_ppa021095mg [Prunus persica]
Length=621

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 6/130 (5%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQV  254
            V + +F +G     R    +FNV+DYGA GDG TDDS+AFL AW + C ++   +  P +
Sbjct  6    VLILIFWIGFGHGQR----TFNVLDYGATGDGKTDDSKAFLKAWGELCGAADEPNGMPTL  61

Query  255  IIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT-SQWLSFNGVYGLI  431
            +IP    FL++P++F GPC S  +H  + G +VAP    GW   ++ S WL F  V  L+
Sbjct  62   VIPEMKAFLLQPIKFRGPCNSDGVHVQIMGKLVAPKMLDGWTECESDSDWLQFKDVGNLV  121

Query  432  VNGGGVIDGQ  461
            V+G G IDGQ
Sbjct  122  VDGSGEIDGQ  131



>ref|XP_007226190.1| hypothetical protein PRUPE_ppa015822mg, partial [Prunus persica]
 gb|EMJ27389.1| hypothetical protein PRUPE_ppa015822mg, partial [Prunus persica]
Length=379

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS-PQVIIPAGSTFLVKPVQFNGPC  311
            +F+V+ +GA GDG TDD++AF+ AW   C +       P + IP G TFL++P +F GPC
Sbjct  3    TFDVVKFGAVGDGQTDDTEAFVKAWTALCGAAAGGDDVPTLTIPGGKTFLLQPSEFEGPC  62

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS+ +H  VSG +VAP +P  W       WL F  V  LI++G G IDGQ
Sbjct  63   KSKSVHVQVSGNLVAPKTPDAWKVCPPHSWLVFRKVDNLIIDGSGKIDGQ  112



>ref|XP_010250372.1| PREDICTED: polygalacturonase ADPG1-like [Nelumbo nucifera]
Length=494

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 80/133 (60%), Gaps = 7/133 (5%)
 Frame = +3

Query  78   VFVFLFILGLISS--SRV---SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            +F  + +LGL  S  +RV   +   F+V+ YGA GDG  DD+ AF  AW  AC       
Sbjct  55   IFTIIVVLGLACSVTARVMKDAMTVFDVMSYGAIGDGTADDTYAFSKAWTAACGEAS--G  112

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
             P ++IP G TFL+ P+ F GPCKS+ +   + GT+VAP +P  WNG D   WL+F  V+
Sbjct  113  FPVMVIPEGKTFLLMPILFQGPCKSKTVGVKILGTIVAPENPVMWNGKDIDLWLAFKDVH  172

Query  423  GLIVNGGGVIDGQ  461
            GL ++G G I+G+
Sbjct  173  GLWMDGTGWINGR  185



>ref|XP_010429999.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=446

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +3

Query  153  YGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHF  332
            +GAKG+G TDD+QAF +AWK ACSS       ++++P   T LV+P+  +GPCKS+ +  
Sbjct  56   FGAKGNGFTDDTQAFADAWKAACSS---KAKTRILVPENYTSLVRPIDLSGPCKSR-LTL  111

Query  333  IVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             +SGTV+AP  P  W GL+  +WL F+GV    V GGG ++G
Sbjct  112  QISGTVIAPDDPDAWEGLNRRKWLYFHGVSRFTVEGGGTVNG  153



>gb|KHN22462.1| Putative polygalacturonase [Glycine soja]
Length=587

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
             +V DYGAKGDG+ +D++AFL AWK ACS +       V+ P G TFLV PV   GPC+S
Sbjct  51   LSVGDYGAKGDGLHNDTEAFLEAWKIACSLSGF---ISVVFPYGKTFLVHPVDIGGPCRS  107

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + I   +SGT+VAP  P  W+GL+  +WL F+GV  L V+GGG I+G
Sbjct  108  K-ITLRISGTIVAPQDPVVWHGLNQRKWLYFHGVNHLTVDGGGRING  153



>ref|XP_007204868.1| hypothetical protein PRUPE_ppa018519mg [Prunus persica]
 gb|EMJ06067.1| hypothetical protein PRUPE_ppa018519mg [Prunus persica]
Length=405

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 72/111 (65%), Gaps = 3/111 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS--PQVIIPAGSTFLVKPVQFNGP  308
            +FNV+ + A GDG TDDS+AFL AW+  C +T  + +  P +++PAG TFL++P++F+GP
Sbjct  26   TFNVLQFDAVGDGQTDDSEAFLKAWEALCGATEANDTGTPTLVVPAGKTFLLQPIKFSGP  85

Query  309  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            CKS  +H  + G +VAP +   W       W+SF+ V  L +NG G IDG 
Sbjct  86   CKSNSVHVQILGKIVAPNTLLAWKECK-EFWISFSEVTNLTINGTGEIDGN  135



>ref|XP_007151017.1| hypothetical protein PHAVU_004G011800g [Phaseolus vulgaris]
 gb|ESW23011.1| hypothetical protein PHAVU_004G011800g [Phaseolus vulgaris]
Length=427

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = +3

Query  120  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  299
            + +  +FNV+DYGAKGDG  DD+QAF  AW+  C      +   +++P+GS FLVKPV F
Sbjct  40   KATSATFNVLDYGAKGDGHADDTQAFAEAWEATCKV----EGSTMVVPSGSVFLVKPVSF  95

Query  300  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +GP   Q+I F + G ++AP S   W G  T QWL F+ +  + + G GVIDGQ
Sbjct  96   SGPNCEQNIVFQLDGKIIAPTSSEAW-GSGTLQWLEFSKLKKITIRGKGVIDGQ  148



>gb|KDP37098.1| hypothetical protein JCGZ_06154 [Jatropha curcas]
Length=540

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            +NV+ YGA GDG  DD+QAF+ AW  AC       +P++++P   TFLV P+ F GPCKS
Sbjct  12   YNVLSYGAVGDGNEDDTQAFVEAWNAACHCD--EDTPRLVVPEDKTFLVNPINFLGPCKS  69

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             +I  ++SGT++AP     W   +  +WL+F  V+GL + G G++DG+
Sbjct  70   GNIEVVLSGTIIAPDGSNPWMENNVGRWLAFRDVHGLNITGDGMLDGR  117


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = +3

Query  78   VFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
            +F+ +     + SS+ + +S NV+++GA G+G  DDS AF  A + AC +T       + 
Sbjct  396  IFLLIMCKATLQSSK-ALRSVNVVNFGAVGNGNADDSNAFTKASEAACGAT---GEASLT  451

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAP  359
            +PA  TFL+KPV+F GPCKS  I+ +V G +VAP
Sbjct  452  VPAQKTFLLKPVKFLGPCKSSQINILVQGNIVAP  485



>ref|XP_002874366.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50625.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 82/133 (62%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   YSMEVFVFLFIL-GLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            +S E  + + IL   I    V+ +++NV+ +GAKGDG TDDS AF+ AW   C       
Sbjct  22   WSRETILRISILINFIYFGLVNGQNYNVLKFGAKGDGETDDSNAFIQAWNATCGGEDNIN  81

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +  ++IP+G T+L++P++F GPCKS  I   + G +VAP +   W+   +  W+SF+ V+
Sbjct  82   T--LLIPSGKTYLLQPIEFKGPCKSTSIKIQLDGIIVAPSNIKTWSNPKSQMWISFSSVF  139

Query  423  GLIVNGGGVIDGQ  461
             L+++G G IDG+
Sbjct  140  SLMIDGSGKIDGR  152



>ref|XP_010417741.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=444

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 85/147 (58%), Gaps = 7/147 (5%)
 Frame = +3

Query  24   LILSASIF--ALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAF  197
            LIL A +F  AL     S E  + L      S+   S +  +V  +GAKG+G TDD+QAF
Sbjct  11   LIL-AMVFSVALTANANSFESLLQLPRRQKRSTRPRSERLLHVGHFGAKGNGFTDDTQAF  69

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
             +AWK ACSS       ++++P   T LV+P+  +GPCKS+ +   +SGT++AP  P  W
Sbjct  70   ADAWKAACSS---KAKTRILVPENYTSLVRPIDLSGPCKSR-LTLQISGTIIAPDDPDAW  125

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             GL+  +WL F GV    V GGG ++G
Sbjct  126  EGLNRRKWLYFQGVSRFTVEGGGTVNG  152



>emb|CAN62658.1| hypothetical protein VITISV_039094 [Vitis vinifera]
Length=435

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = +3

Query  66   YSMEVFVFL--FILGLISS--SRVSCK----SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            Y+M+ F  L   IL + SS  S V+      +FNV+D+GA GDG+TDDSQAFL AW   C
Sbjct  23   YAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAFLKAWNAVC  82

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  401
            ++     S  +II    TFL+ P  F+GPCK   IH +V G + AP +   W    +S W
Sbjct  83   TARTT--SAMLIIQRKKTFLLSPTVFSGPCKPPQIHVLVLGDITAPKTRSAWG--RSSYW  138

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            L F  + G I+NG G +DGQ
Sbjct  139  LIFQYIDGFIINGKGTLDGQ  158



>ref|XP_010254365.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=446

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            K  +V +YGAKGDG+ DD++AF +AWK ACS   +   P++ +PAG  +LV P+   GPC
Sbjct  52   KVISVKEYGAKGDGLVDDTRAFKDAWKVACS---LSSRPRIEVPAGRNYLVGPIDLGGPC  108

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +S+ +   V G + AP  P  WNG +  +WL F+G+    V GGG I+G
Sbjct  109  RSR-VTLRVFGNITAPKDPASWNGFNRRKWLYFHGLNRFTVEGGGTING  156



>gb|KHG21768.1| hypothetical protein F383_04238 [Gossypium arboreum]
Length=429

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 10/134 (7%)
 Frame = +3

Query  75   EVFVFLFILGLI---SSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
            E F F  +L L    SS+R+  ++  V+   D+GAKGDG  +D++AF NAW  ACSS   
Sbjct  12   ESFEFDSLLQLPKSGSSARIRPRAKQVLSVSDFGAKGDGYHNDTRAFENAWNVACSSP--  69

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
                +++IPAG T+LV PV+  G CKS+ I  ++SGT+VAP +P  W+GL+  +WL F+ 
Sbjct  70   -GRIRIVIPAGYTYLVHPVELGGHCKSK-ITLMISGTIVAPKNPNVWDGLNPRKWLYFHE  127

Query  417  VYGLIVNGGGVIDG  458
            V  L V GGG I+G
Sbjct  128  VKHLHVVGGGTING  141



>emb|CBI36306.3| unnamed protein product [Vitis vinifera]
Length=495

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = +3

Query  66   YSMEVFVFL--FILGLISS--SRVSCK----SFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            Y+M+ F  L   IL + SS  S V+      +FNV+D+GA GDG+TDDSQAFL AW   C
Sbjct  92   YAMQDFSILICLILSMASSGSSNVALNGRTTTFNVLDFGAIGDGVTDDSQAFLKAWNAVC  151

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  401
            ++     S  +II    TFL+ P  F+GPCK   IH +V G + AP +   W    +S W
Sbjct  152  TARTT--SAMLIIQRKKTFLLSPTVFSGPCKPPQIHVLVLGDITAPKTRSAWG--RSSYW  207

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            L F  + G I+NG G +DGQ
Sbjct  208  LIFQYIDGFIINGKGTLDGQ  227



>gb|KEH24801.1| polygalacturonase [Medicago truncatula]
Length=402

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +3

Query  120  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  299
            + +  +FNV+D+GAKGDG +DD++AF +AW  AC      ++  +++P+GS FLVKP+ F
Sbjct  39   KATSSTFNVLDFGAKGDGHSDDTKAFEDAWAAACK----MEASTMVVPSGSVFLVKPISF  94

Query  300  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +GP    +I F + G ++AP SP  W G  T QWL F  +  + + G GVIDGQ
Sbjct  95   SGPNCEPNIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTKLNKITIKGKGVIDGQ  147



>ref|XP_009629677.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana tomentosiformis]
Length=454

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 97/162 (60%), Gaps = 14/162 (9%)
 Frame = +3

Query  3    YYTIHP*LILSASIFA--LYCCFYSMEVFVFL-----FILGLISSSRVSCKSFNVI---D  152
            Y+T       S SI A  LY   YS  +F  +      I    + + ++ +S  +I   +
Sbjct  8    YFTFSSYYSTSVSILASLLYTTIYSFLLFANVNSYHPVIHQFPTLNNITGRSKTLIYVNE  67

Query  153  YGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHF  332
            +GAKGDG+TDD++ F + WK ACSS P+   P+++IP+G +FLV+P+ F GPC+S+ +  
Sbjct  68   FGAKGDGITDDTKPFQDVWKIACSS-PLR--PKIVIPSGYSFLVRPIDFVGPCRSK-VSL  123

Query  333  IVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             ++G++VAP  P  W+GL+  +WL F  V  L V GGG I+G
Sbjct  124  SIAGSIVAPKDPQVWDGLNPHKWLYFFKVKYLTVEGGGTING  165



>ref|XP_011654334.1| PREDICTED: probable polygalacturonase At3g15720 [Cucumis sativus]
 gb|KGN53196.1| hypothetical protein Csa_4G025750 [Cucumis sativus]
Length=393

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = +3

Query  72   MEVFVFLFILGLISS-SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            +   +FL+ + ++SS + +    FNV+DYGA G+G TDDS+AFL AW D C +T   +SP
Sbjct  4    LSAAIFLYSIAILSSWTVLGSSDFNVLDYGAIGNGKTDDSKAFLKAWNDVCGAT--EESP  61

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
             + +P G T+L+ P++F GPCKS+ +     GT++AP +   W      QW+ F  + GL
Sbjct  62   TLHVPDGKTYLLNPLKFQGPCKSKQL----GGTLMAP-TKDEWISDGKGQWIQFFDIEGL  116

Query  429  IVNGGGVIDGQ  461
             + GGG  DGQ
Sbjct  117  NLQGGGRFDGQ  127



>ref|XP_003601691.1| Polygalacturonase [Medicago truncatula]
Length=404

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 82/140 (59%), Gaps = 13/140 (9%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCK-------SFNVIDYGAKGDGMTDDSQAFLNAWKDACSST  230
            M+    LF+L +I+S  VS +       +F+V+ YGA GDG TDDS AFL  + DAC ++
Sbjct  1    MKGLYVLFML-VIASHSVSSRITPNTGSTFDVLTYGAIGDGQTDDSNAFLKVFNDACGTS  59

Query  231  PVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ---W  401
                +P + IP G TFL++P+ F GPCKS +I   + G + AP     WN     Q   W
Sbjct  60   --ESTPSMTIPEGKTFLLQPLVFKGPCKSTNIIVELKGNITAPKDIESWNFTVEKQRKIW  117

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            + F+ + GL+VNG G IDGQ
Sbjct  118  IQFSKISGLVVNGEGNIDGQ  137



>ref|NP_198807.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AED94490.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=373

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV++YGA GDG +DDS+AF +AW+D C+   +     + IP G+TFL++P++F+GPCKS
Sbjct  36   FNVLNYGAIGDGFSDDSKAFKDAWEDTCNY--IGSESIMEIPEGNTFLLQPIEFHGPCKS  93

Query  318  QHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGGGVI  452
            + I   +SG ++AP SP  W  N  D  QW+ F  + GL ++G G++
Sbjct  94   KKIILSISGNLIAPESPYEWKCNKDDCHQWIEFAHINGLYIDGHGLM  140



>emb|CDY56952.1| BnaC04g56090D [Brassica napus]
Length=421

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            SS  V+ K FNV +YGA G+G  DD++AF++AW+D C+   +     + IP G TFL++P
Sbjct  24   SSPDVNSKIFNVFNYGAIGNGYADDTKAFMDAWEDTCNY--IGSKSTMEIPQGRTFLLQP  81

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            + F+GPCKS+ I F +SG + AP +P  W  N     QW+ F  + GL ++G G IDGQ
Sbjct  82   IGFHGPCKSKKIVFSISGNLTAPYAPYQWKCNEDYCHQWIEFAHINGLYIDGPGTIDGQ  140



>gb|AFK47772.1| unknown [Medicago truncatula]
Length=425

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 13/135 (10%)
 Frame = +3

Query  81   FVFLFILGLISSSR--------VSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPV  236
             V L  L   S++R         +  +FNV+D+GAKGDG +DD++AF +AW  AC     
Sbjct  18   LVLLSCLERCSATRGHSWRKLKATSSTFNVLDFGAKGDGHSDDTKAFEDAWAAACK----  73

Query  237  HKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNG  416
             ++  +++P+GS FLVKP+ F+GP    +I F + G ++AP SP  W G  T QWL F  
Sbjct  74   MEASTMVVPSGSVFLVKPISFSGPNCEPNIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTK  132

Query  417  VYGLIVNGGGVIDGQ  461
            +  + + G GVIDGQ
Sbjct  133  LNKITIKGKGVIDGQ  147



>dbj|BAB10216.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=411

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV++YGA GDG +DDS+AF +AW+D C+   +     + IP G+TFL++P++F+GPCKS
Sbjct  36   FNVLNYGAIGDGFSDDSKAFKDAWEDTCNY--IGSESIMEIPEGNTFLLQPIEFHGPCKS  93

Query  318  QHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGGGVI  452
            + I   +SG ++AP SP  W  N  D  QW+ F  + GL ++G G++
Sbjct  94   KKIILSISGNLIAPESPYEWKCNKDDCHQWIEFAHINGLYIDGHGLM  140



>ref|XP_006405582.1| hypothetical protein EUTSA_v10028331mg [Eutrema salsugineum]
 gb|ESQ47035.1| hypothetical protein EUTSA_v10028331mg [Eutrema salsugineum]
Length=384

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            SS   S K FNV DYGA GDG +DD++AF NAW+D C+   +  +  + IP G TFL++P
Sbjct  27   SSFHHSNKIFNVFDYGAIGDGNSDDTKAFKNAWEDTCNY--IGSNSTMHIPQGRTFLLQP  84

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGG--GVIDG  458
            ++F GPCKS++I F + G + AP  P  W  NG    QW+ F  + GL ++G   G +DG
Sbjct  85   IEFRGPCKSKNIVFSIRGNLTAPEGPDQWKCNGDRCHQWIEFAHINGLYIDGHGQGTLDG  144

Query  459  Q  461
            +
Sbjct  145  K  145



>ref|XP_003618193.1| Polygalacturonase [Medicago truncatula]
 gb|AES74411.1| polygalacturonase [Medicago truncatula]
Length=425

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +3

Query  120  RVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQF  299
            + +  +FNV+D+GAKGDG +DD++AF +AW  AC      ++  +++P+GS FLVKP+ F
Sbjct  39   KATSSTFNVLDFGAKGDGHSDDTKAFEDAWAAACK----MEASTMVVPSGSVFLVKPISF  94

Query  300  NGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +GP    +I F + G ++AP SP  W G  T QWL F  +  + + G GVIDGQ
Sbjct  95   SGPNCEPNIVFQLDGKIIAPTSPSAW-GSGTLQWLEFTKLNKITIKGKGVIDGQ  147



>ref|XP_006291145.1| hypothetical protein CARUB_v10017263mg [Capsella rubella]
 gb|EOA24043.1| hypothetical protein CARUB_v10017263mg [Capsella rubella]
Length=441

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = +3

Query  45   FALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
             AL     S E  + L      S+   S +  +V ++GAKG+G TDD++AF  AWK ACS
Sbjct  18   LALTANANSFESLLQLPRRQWRSTRPRSERVLHVGNFGAKGNGFTDDTKAFEEAWKAACS  77

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWL  404
            S       ++++P   T LV+P+  +GPCK++ +   +SGT++AP  P  W GL+  +WL
Sbjct  78   S---KAKTRILVPENYTSLVRPIDLSGPCKAR-LTLQISGTIIAPDDPDAWEGLNRRKWL  133

Query  405  SFNGVYGLIVNGGGVIDG  458
             F+G+  L V GGG ++G
Sbjct  134  YFHGLSRLTVEGGGTVNG  151



>gb|KGN52445.1| hypothetical protein Csa_5G635400 [Cucumis sativus]
Length=412

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 82/140 (59%), Gaps = 13/140 (9%)
 Frame = +3

Query  72   MEVFVFLFILGL----ISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVH  239
            ME+F  + I+ L    I+SS    K+FNV+DYGA GDG T+D+QAFL+AWK AC S+   
Sbjct  1    MELFFLILIISLQFLQINSSS---KTFNVLDYGAVGDGNTEDTQAFLDAWKAACKSSNSK  57

Query  240  KSPQVIIPAGSTFLVKPVQFNG-PCKSQH---IHFIVSGTVVAPGSPPGW--NGLDTSQW  401
             SP +++P G +FL++P   +G  CKS     I  ++ G ++AP     W   G    QW
Sbjct  58   TSPIMLVPPGKSFLLQPFTLDGYDCKSTKTNIISIVIDGELIAPKDRWAWKYEGKQCRQW  117

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            +    + GL+V G G I+ Q
Sbjct  118  ILLKHMKGLVVKGSGTINAQ  137



>ref|XP_002517603.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF44767.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=424

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = +3

Query  105  LISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  281
            L + +R+  K  F V D+GA GDG  +D+QAF  AW+ ACS        +++IPAG T L
Sbjct  23   LSARTRLRSKRVFFVSDFGAIGDGAANDTQAFKEAWEMACS---FPSRTRIVIPAGYTLL  79

Query  282  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            V PV   GPCKS+ +  I+SGT+VAP  P  W G +  +WL F+GV  L ++GGG I+G
Sbjct  80   VHPVDLGGPCKSK-LTLIISGTIVAPKDPAFWKGSNPRKWLYFHGVNHLTIDGGGTING  137



>ref|XP_009799918.1| PREDICTED: probable polygalacturonase At1g80170 [Nicotiana sylvestris]
Length=451

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 4/105 (4%)
 Frame = +3

Query  144  VIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQH  323
            V ++GAKGDG+TDD+++F + WK ACSS P+   P+++IP+G +FLV+P+ F GPC+S+ 
Sbjct  63   VNEFGAKGDGITDDTKSFHDVWKIACSS-PLR--PKIVIPSGYSFLVRPIDFVGPCRSK-  118

Query  324  IHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +   ++G++VAP  P  W+GL+  +WL F  V  L V GGG ++G
Sbjct  119  VSLSIAGSIVAPKDPQVWDGLNPHKWLYFFKVKYLTVEGGGTVNG  163



>ref|XP_006400250.1| hypothetical protein EUTSA_v10013641mg [Eutrema salsugineum]
 gb|ESQ41703.1| hypothetical protein EUTSA_v10013641mg [Eutrema salsugineum]
Length=424

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            +S +V  +GA GDG TDD++AFL AW+  C+     ++ ++++P G TF++KP+ F GPC
Sbjct  36   RSISVTSFGAVGDGKTDDTKAFLKAWEGVCNGGS-KRNKRLLVPLGKTFMIKPLTFVGPC  94

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  I F++ G +VAPG    W       W+SF+ + GL+V GGG IDG+
Sbjct  95   KSSSISFLIKGNLVAPGYT--WYAGRYPSWISFDSINGLVVTGGGTIDGR  142



>ref|XP_009790843.1| PREDICTED: probable polygalacturonase At3g15720, partial [Nicotiana 
sylvestris]
Length=399

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 3/108 (3%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            F+V DYGA GDG+TDDSQAF  AW D C      ++P + +P+   FL+ P+ F GPC S
Sbjct  23   FDVTDYGAIGDGVTDDSQAFQQAWLDVCYDC---ENPTMNLPSEKLFLLSPILFQGPCNS  79

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              I+  V G + AP +   W G +   WL F G+ GLI+NG G I+GQ
Sbjct  80   TTINIQVLGNITAPQNITEWVGCENDSWLYFTGISGLIINGTGQINGQ  127



>gb|EYU35886.1| hypothetical protein MIMGU_mgv1a018285mg [Erythranthe guttata]
Length=396

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV+DYGA G+G+TDD+ AF NAWK  C+S+    SP + +P+G TF V+P++F+GPC+S
Sbjct  32   FNVLDYGAVGNGLTDDTNAFANAWKATCASSSS-SSPMMHVPSGKTFFVQPLEFDGPCES  90

Query  318  QHIHFIVSGTVVAPGSPPGWN--GLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              I   + G  VAP  P  W+    D   W+SF  V GL V+G G  DG+
Sbjct  91   DTIIVEIEGNFVAPSDPSSWDCGKNDCENWISFRRVDGLRVSGHGSFDGR  140



>ref|XP_010654779.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=414

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            +FNV+D+GA GDG+TDDSQAFL AW   C++     S  +II    TFL+ P  F+GPCK
Sbjct  33   TFNVLDFGAIGDGVTDDSQAFLKAWNAVCTARTT--SAMLIIQRKKTFLLSPTVFSGPCK  90

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
               IH +V G + AP +   W    +S WL F  + G I+NG G +DGQ
Sbjct  91   PPQIHVLVLGDITAPKTRSAWG--RSSYWLIFQYIDGFIINGKGTLDGQ  137



>ref|NP_198105.2| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AED93697.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=458

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 82/148 (55%), Gaps = 19/148 (13%)
 Frame = +3

Query  18   P*LILSASIFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAF  197
            P  IL  SI   + CF            GL++      + +NV+ +GA+GDG TDDS AF
Sbjct  30   PETILRISILINFICF------------GLVNG-----QIYNVLKFGAEGDGQTDDSNAF  72

Query  198  LNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGW  377
            L AW   C          + IP+G T+L++P++F GPCKS  I   + G +VAP +   W
Sbjct  73   LQAWNATCGGE--ENINTLFIPSGKTYLLQPIEFKGPCKSTSIKLQLDGIIVAPSNITSW  130

Query  378  NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +   +  W+SF+GV GL+++G G I+G+
Sbjct  131  SNPKSQTWISFSGVPGLMIDGSGTINGR  158



>gb|ACN29115.1| unknown [Zea mays]
Length=195

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
              + D+G  GDG+ +D+QA L+AW  ACSST   +   + +PAG  + + PVQ +GPCK 
Sbjct  30   LTLDDFGGVGDGIANDTQALLDAWAAACSST---QEAVLAVPAGKVYQIWPVQLSGPCK-  85

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + +  ++SG +VAP SP  W G D  +WL   GV GL V+GGG IDG
Sbjct  86   KRLKLLISGAIVAPSSPDEWAGRDPMKWLYVYGVDGLSVSGGGTIDG  132



>ref|XP_011078892.1| PREDICTED: polygalacturonase [Sesamum indicum]
Length=457

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S K+ NV+ +GAKGDG TDD++AF NAW++ACSS+   ++   I+P   ++L+KP++F+G
Sbjct  83   SIKTINVLSFGAKGDGSTDDTKAFENAWEEACSSS---ENVTFIVPQSRSYLLKPLRFSG  139

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            PC S  I   + GT++A      +   D   WL F+ V  L+V GGG IDG
Sbjct  140  PCNSNIIKMEIGGTLIASDDRSDYKK-DKRHWLRFDSVENLVVEGGGTIDG  189



>ref|NP_199297.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 gb|AAC79137.1| putative polygalacturonase [Arabidopsis thaliana]
 dbj|BAB10865.1| polygalacturonase [Arabidopsis thaliana]
 gb|AED95167.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=381

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 80/131 (61%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ +  +F+L L+ S  V+ + ++V+++GA G+G+TDDS+AF+ AW   C S     S 
Sbjct  1    MEIILRGVFLLTLLHSILVNGQIYDVLEFGADGNGITDDSKAFVKAWSAMCGSGG--NSK  58

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
              IIP+  TFL++P+ F GPCKS  +     G +VAP +   W+     +W+SF  + GL
Sbjct  59   TFIIPSNKTFLLQPLTFQGPCKSPSVQVKFDGKIVAPINKAAWSDYKLFRWVSFKEIIGL  118

Query  429  IVNGGGVIDGQ  461
             VNG G I G+
Sbjct  119  TVNGSGTIHGR  129



>ref|XP_004498711.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=400

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 12/133 (9%)
 Frame = +3

Query  90   LFILGLISSSRVSCKS---------FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            L I+GL+    VSC S         FNV+ YGAKGDG++DD+ AF   W+D C +     
Sbjct  6    LLIIGLLIFCIVSCNSWVGFCQQNTFNVLQYGAKGDGISDDTPAFEKVWEDLCGAQN-KG  64

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +P +++PA  TF V+ + F+GPCKSQ++H  + G ++AP     W G  + +WL F  V 
Sbjct  65   TPMLVVPARYTFFVRQITFSGPCKSQNLHIQIKGNILAP-KRDSW-GTCSKRWLHFINVK  122

Query  423  GLIVNGGGVIDGQ  461
             + V+G GVI+GQ
Sbjct  123  QMTVDGSGVINGQ  135



>emb|CDY39399.1| BnaAnng05300D [Brassica napus]
Length=400

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            ++V+ +GAKGDG TDDS+AF+ AWK  CSS   +K+  ++IP+ +TFL++P+ F GPC S
Sbjct  33   YDVLKFGAKGDGTTDDSEAFVEAWKAMCSSGGSNKT--LLIPSDNTFLLQPLVFQGPCNS  90

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              +   + G +VAP +   W+   + +W+SFN + GL V G G I+G+
Sbjct  91   PSVQVQLEGKIVAPINKAAWSDFKSYEWVSFNKIIGLTVLGSGTINGR  138



>gb|KGN52885.1| hypothetical protein Csa_4G004940 [Cucumis sativus]
Length=414

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 67/111 (60%), Gaps = 5/111 (5%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC-SSTPVHKSPQVIIPAGSTFLVKPVQFNGP  308
            K+ +VI YGA GDG TDDS+AFL AWK  C ++TP      +++P+  TFL+ PVQF GP
Sbjct  46   KAIDVIQYGAAGDGKTDDSRAFLKAWKAVCEANTP----SAMLVPSTKTFLLNPVQFQGP  101

Query  309  CKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            C S  +   + G +VAP     W   D   WL F+ V  L++ G G IDGQ
Sbjct  102  CMSSSVGVQILGKIVAPSDLDAWKVFDAKNWLLFSNVSRLVIQGNGEIDGQ  152



>ref|XP_010545770.1| PREDICTED: probable polygalacturonase At3g15720 isoform X2 [Tarenaya 
hassleriana]
Length=419

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +3

Query  48   ALYCCFYSMEVFVFLFILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            +++  F +  +++ L +  L+      S ++ +V  +GA GDG+TDDSQAFL +W+  C 
Sbjct  4    SIHGLFQAKTLYIILILSALVLRDPTSSSQALDVTRFGALGDGITDDSQAFLRSWETVCK  63

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAP-GSPPGWNGLDTSQW  401
             T      ++I+PA   F+++P++F GPCKS  I+F V G +VAP  +   W G D   W
Sbjct  64   GTGHGTDTELIVPADKIFMLQPLKFLGPCKSGPINFQVYGDIVAPRRNQKKWKG-DNDNW  122

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            + F+ +  LIV G G+IDGQ
Sbjct  123  IVFSDIDDLIVEGDGLIDGQ  142



>ref|XP_008368928.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=432

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = +3

Query  72   MEVFVFLFI-LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS--STPVHK  242
            + + +F F+ L L      S K  ++  YGA GDG TDDS AF+NAWK  C   +  ++ 
Sbjct  8    IHILIFFFLPLPLFIXIAHSQKILDITKYGAVGDGQTDDSPAFVNAWKXLCQGINEAING  67

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
             P + +P G TFL++ ++F GPC ++++H  V G ++AP     W   D+  WLSF+ V 
Sbjct  68   IPTLNVPEGKTFLLQRLKFEGPCNTKNVHLQVLGNLLAPAR-GAWKECDSEDWLSFSNVE  126

Query  423  GLIVNGGGVIDGQ  461
             L+++G G IDGQ
Sbjct  127  NLMLDGSGKIDGQ  139



>ref|XP_010472976.1| PREDICTED: probable polygalacturonase At1g80170 [Camelina sativa]
Length=445

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +3

Query  153  YGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHF  332
            +GAKG+G TDD+QAF +AWK ACSS       ++++P   T LV P+  +GPCKS+ +  
Sbjct  55   FGAKGNGFTDDTQAFADAWKAACSS---KAKTRILVPENYTSLVLPIDLSGPCKSR-LTL  110

Query  333  IVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             +SGT++AP  P  W GL+  +WL F+GV    V GGG ++G
Sbjct  111  QISGTIIAPDDPDAWEGLNRRKWLYFHGVSRFTVEGGGTVNG  152



>ref|XP_010545769.1| PREDICTED: probable polygalacturonase At3g15720 isoform X1 [Tarenaya 
hassleriana]
Length=458

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +3

Query  48   ALYCCFYSMEVFVFLFILGLI-SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACS  224
            +++  F +  +++ L +  L+      S ++ +V  +GA GDG+TDDSQAFL +W+  C 
Sbjct  4    SIHGLFQAKTLYIILILSALVLRDPTSSSQALDVTRFGALGDGITDDSQAFLRSWETVCK  63

Query  225  STPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAP-GSPPGWNGLDTSQW  401
             T      ++I+PA   F+++P++F GPCKS  I+F V G +VAP  +   W G D   W
Sbjct  64   GTGHGTDTELIVPADKIFMLQPLKFLGPCKSGPINFQVYGDIVAPRRNQKKWKG-DNDNW  122

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            + F+ +  LIV G G+IDGQ
Sbjct  123  IVFSDIDDLIVEGDGLIDGQ  142



>ref|NP_001234256.1| polygalacturonase [Solanum lycopersicum]
 gb|AAF61444.1|AF138858_1 polygalacturonase [Solanum lycopersicum]
Length=452

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 81/125 (65%), Gaps = 5/125 (4%)
 Frame = +3

Query  87   FLFILGLISSSRVSCKS-FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIP  263
             L +L   +S R   +S F V D+GA GDG+TDD+++F + W  ACSS P H   +++IP
Sbjct  45   LLQLLPASASLRTKSESLFRVNDFGATGDGITDDTKSFKDVWDMACSS-PSHA--KIVIP  101

Query  264  AGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGG  443
            AG +FLV+ + F GPC+S+ +   ++GT++AP  P  W+ L+  +W+ F  V  L V GG
Sbjct  102  AGYSFLVRQINFAGPCRSK-VSIRIAGTILAPKDPDVWDDLNPRKWIYFFKVKHLTVEGG  160

Query  444  GVIDG  458
            G+IDG
Sbjct  161  GIIDG  165



>ref|NP_195292.2| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AEE86547.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=394

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            K++NV+++ AKGDG TDDS+AFL AW  AC      K+  ++IP+G TFL++P  F GPC
Sbjct  22   KNYNVLNFDAKGDGQTDDSEAFLQAWTAACGGDGDIKT--LLIPSGKTFLLQPTVFQGPC  79

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  I   + GT+VAP     W+   +  W+ F+ V GLI+ G G ID +
Sbjct  80   KSSSIKVQLDGTIVAPSDKFAWSDPISRMWIKFSTVSGLIIVGSGTIDSR  129



>ref|XP_009135455.1| PREDICTED: probable polygalacturonase At3g15720 [Brassica rapa]
Length=453

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 79/124 (64%), Gaps = 9/124 (7%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAG  269
            +F L + +SS    K+ +V  YGA GDG+TDDSQAFL AW+  CS T      Q+I+PAG
Sbjct  12   VFFLHIFTSS----KALDVTQYGANGDGVTDDSQAFLKAWEAVCSGT---GDGQLIVPAG  64

Query  270  STFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGV  449
             TF+++P++F G CKS  I   + G +VA  S   W G D  QW+ F+ + GL+V G GV
Sbjct  65   MTFVLQPLKFQGSCKSTPIVVQILGNMVA-SSRGNWEG-DKDQWILFSDIEGLVVEGNGV  122

Query  450  IDGQ  461
            I+GQ
Sbjct  123  INGQ  126



>emb|CDX74418.1| BnaA04g09710D [Brassica napus]
Length=422

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = +3

Query  111  SSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKP  290
            SS  V+ K FNV +YGA G+G  DD++AF++AW+D C+   +     + IP G  FL++P
Sbjct  25   SSPDVNSKIFNVFNYGAIGNGYADDTKAFMDAWEDTCNY--IGSKSTMEIPQGRAFLLQP  82

Query  291  VQFNGPCKSQHIHFIVSGTVVAPGSPPGW--NGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            + F+GPCKS+ I F +SG + AP +P  W  N     QW+ F  + GL ++G G IDGQ
Sbjct  83   IGFHGPCKSKKIVFSISGNLTAPYAPYQWKCNEDYCHQWIEFAHINGLYIDGPGTIDGQ  141



>ref|XP_008779497.1| PREDICTED: polygalacturonase ADPG1-like, partial [Phoenix dactylifera]
Length=219

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 8/131 (6%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S+  F FL    L +   +S   +NVID GAKGDG TDD+QA  + W  ACS +   K+P
Sbjct  2    SVRAFTFLLFASL-AVGVLSGPIYNVIDKGAKGDGKTDDAQALTDTWNAACSDS---KAP  57

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
              +IP+G TFL   + F GPCKS +I+  V GT++   SP     +  + W+SF G+ G+
Sbjct  58   TFLIPSGYTFLADQLYFRGPCKS-YINVQVDGTIM---SPYKIRAVRENHWISFVGIEGI  113

Query  429  IVNGGGVIDGQ  461
             +NG G IDGQ
Sbjct  114  TINGTGYIDGQ  124



>ref|XP_010259191.1| PREDICTED: polygalacturonase-like [Nelumbo nucifera]
Length=424

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = +3

Query  96   ILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGST  275
            ++G   +S  S  ++NV+D+GA GDG  DDSQAF  AW+ +C S+    SP ++IP G T
Sbjct  17   LIGANKNSNSSNTTYNVLDFGAVGDGSADDSQAFKEAWQASCMSSD--DSPIMLIPNGKT  74

Query  276  FLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDT--SQWLSFNGVYGLIVNG-GG  446
            FL++PV F+G CKS +IH  ++G ++AP     W   +T    W++F  + GL ++G   
Sbjct  75   FLLRPVTFSGGCKSNNIHVQINGNIIAPSEHSQWGCYETDCDHWITFANLDGLYIDGSNA  134

Query  447  VIDGQ  461
            +IDGQ
Sbjct  135  IIDGQ  139



>ref|XP_010551909.1| PREDICTED: polygalacturonase At1g48100 isoform X1 [Tarenaya hassleriana]
Length=460

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  284
            L+++   + K+FNV+DYGAKGDG+TDD++AF  AW+ AC       +  ++ P GSTFLV
Sbjct  42   LVTTQGENSKTFNVLDYGAKGDGITDDTKAFEAAWEAACKVA----ASTLVAPTGSTFLV  97

Query  285  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P+ F G   +++I F + G ++AP S   W G D  QW+ F  + G+ V G G IDGQ
Sbjct  98   GPISFLGTDCAENIAFQLDGKIIAPTSASAW-GSDLLQWIEFKTLKGIAVRGKGTIDGQ  155



>ref|XP_002887842.1| hypothetical protein ARALYDRAFT_477239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64101.1| hypothetical protein ARALYDRAFT_477239 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S E  + L      S+   S +  +V  +GAKG+G TDD++AF +AWK ACSS       
Sbjct  30   SFESLLQLPRRQSRSTRPRSERLLHVGKFGAKGNGFTDDTKAFADAWKTACSS---KVKT  86

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
            ++++P   T L++P+  +GPCK++ +   +SGT++AP  P  W GL+  +WL F+G+  L
Sbjct  87   RILVPENYTCLLRPIDLSGPCKAR-LTLQISGTIIAPNDPDAWEGLNRRKWLYFHGLSRL  145

Query  429  IVNGGGVIDG  458
             V GGG ++G
Sbjct  146  TVEGGGTVNG  155



>ref|XP_010250040.1| PREDICTED: probable polygalacturonase At1g80170 [Nelumbo nucifera]
Length=450

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +3

Query  141  NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQ  320
            +V D+GAKGDG+TDDSQAF +AW  ACS   +   P++ +PAG T+LV P  F+GPC+S 
Sbjct  53   SVKDFGAKGDGLTDDSQAFTDAWTFACS---LPYRPRLEVPAGRTYLVGPTDFSGPCRSS  109

Query  321  HIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             +   VSG + AP +P  W G    +WL F  +    V GGG I+G
Sbjct  110  -LTLRVSGNITAPKNPASWKGFSRRRWLYFYRLNRFTVEGGGTING  154



>emb|CAA20037.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAB80283.1| putative polygalacturonase [Arabidopsis thaliana]
Length=374

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            K++NV+++ AKGDG TDDS+AFL AW  AC      K+  ++IP+G TFL++P  F GPC
Sbjct  12   KNYNVLNFDAKGDGQTDDSEAFLQAWTAACGGDGDIKT--LLIPSGKTFLLQPTVFQGPC  69

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  I   + GT+VAP     W+   +  W+ F+ V GLI+ G G ID +
Sbjct  70   KSSSIKVQLDGTIVAPSDKFAWSDPISRMWIKFSTVSGLIIVGSGTIDSR  119



>ref|XP_010688006.1| PREDICTED: probable polygalacturonase At1g80170 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S   FNV+D+GA  + + D SQAFL+ W+  C S     +  + +P   TFLV P+ F G
Sbjct  11   SSDHFNVLDHGAISNIINDSSQAFLDVWRLVCDSEV--DNTTLFVPRWRTFLVNPIVFTG  68

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            PCK   I+F V G +VAP SP  W   D SQWL+F  V GL V+G GV++GQ
Sbjct  69   PCKPNIINFQVLGEIVAPPSPSAWEKHDPSQWLAFKEVRGLRVSGSGVVNGQ  120



>ref|XP_010551910.1| PREDICTED: polygalacturonase At1g48100 isoform X2 [Tarenaya hassleriana]
Length=458

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = +3

Query  105  LISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLV  284
            L+++   + K+FNV+DYGAKGDG+TDD++AF  AW+ AC       +  ++ P GSTFLV
Sbjct  42   LVTTQGENSKTFNVLDYGAKGDGITDDTKAFEAAWEAACKVA----ASTLVAPTGSTFLV  97

Query  285  KPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
             P+ F G   +++I F + G ++AP S   W G D  QW+ F  + G+ V G G IDGQ
Sbjct  98   GPISFLGTDCAENIAFQLDGKIIAPTSASAW-GSDLLQWIEFKTLKGIAVRGKGTIDGQ  155



>ref|XP_004486686.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X1 [Cicer arietinum]
Length=446

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            + F + D+GAKGDG  +D++AFL  WK ACS +       VI P G  FLV P+   GPC
Sbjct  52   RVFPITDFGAKGDGFHNDTKAFLEVWKIACSLSGF---VNVIFPYGKNFLVYPIDIGGPC  108

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +S+ I   + GT+VAP +P  W GL+  +W+ F+GV  L ++GGG +DG+
Sbjct  109  RSK-ITLRILGTIVAPRNPEAWRGLNKRKWIYFHGVNHLSIDGGGTLDGK  157



>ref|XP_004486687.1| PREDICTED: probable polygalacturonase At1g80170-like isoform 
X2 [Cicer arietinum]
Length=443

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            + F + D+GAKGDG  +D++AFL  WK ACS +       VI P G  FLV P+   GPC
Sbjct  52   RVFPITDFGAKGDGFHNDTKAFLEVWKIACSLSGF---VNVIFPYGKNFLVYPIDIGGPC  108

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +S+ I   + GT+VAP +P  W GL+  +W+ F+GV  L ++GGG +DG+
Sbjct  109  RSK-ITLRILGTIVAPRNPEAWRGLNKRKWIYFHGVNHLSIDGGGTLDGK  157



>gb|AES71942.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=396

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 8/131 (6%)
 Frame = +3

Query  87   FLFILGLISSSRVSCKS---FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI  257
             L I     SSR++  +   F+V+ YGA GDG TDDS AFL  + DAC ++    +P + 
Sbjct  1    MLVIASHSVSSRITPNTGSTFDVLTYGAIGDGQTDDSNAFLKVFNDACGTS--ESTPSMT  58

Query  258  IPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQ---WLSFNGVYGL  428
            IP G TFL++P+ F GPCKS +I   + G + AP     WN     Q   W+ F+ + GL
Sbjct  59   IPEGKTFLLQPLVFKGPCKSTNIIVELKGNITAPKDIESWNFTVEKQRKIWIQFSKISGL  118

Query  429  IVNGGGVIDGQ  461
            +VNG G IDGQ
Sbjct  119  VVNGEGNIDGQ  129



>ref|XP_008792138.1| PREDICTED: probable polygalacturonase At1g80170 [Phoenix dactylifera]
Length=573

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            FNV+D+ A GDG TDD+Q F +AW   C        P +IIPA  TFLV P  F+GPCKS
Sbjct  18   FNVLDFKAVGDGHTDDTQVFKDAWAATCGCET--GRPTMIIPARRTFLVLPTVFDGPCKS  75

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              +   + GT+VAP +   WN  D S+WL F+ V GL   G  +IDG+
Sbjct  76   TSVSVQLQGTIVAPDTLDTWNDKDASEWLRFDSVRGLTFAGSRLIDGR  123



>gb|KHN23520.1| Polygalacturonase [Glycine soja]
Length=438

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S  SFNV+DYGAKGDG  DD++AF +AW  AC      +   +++P+GS FLVKP+ F+G
Sbjct  37   SATSFNVLDYGAKGDGHADDTKAFEDAWAAACKV----EGSTMVVPSGSVFLVKPISFSG  92

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            P    +I F + G ++AP S   W G  T QWL F+ +  + + G GVIDGQ
Sbjct  93   PNCEPNIVFQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQ  143



>ref|XP_002868688.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
            KSFNV++YGA GDG +DDS+AF +AW+D C+      + +  IP G TFL++P++F+GPC
Sbjct  34   KSFNVLNYGAIGDGFSDDSKAFKDAWEDTCNYIGSQSTME--IPEGYTFLLQPIEFHGPC  91

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLD--TSQWLSFNGVYGLIVNGGGVI  452
            KS+ I   +SG ++AP SP  W        +W+ F  + GL +NG G +
Sbjct  92   KSKKIILSISGNLIAPESPYEWECKKDHCHKWIEFGHINGLHINGHGTL  140



>gb|AAD55489.1|AC009322_29 Similar to polygalacturonases [Arabidopsis thaliana]
Length=459

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S E  + L      S+   S +  +V ++GAKG+G+TDD++AF +AWK ACSS       
Sbjct  30   SFESLLQLPRRQSRSTRPRSERLLHVGNFGAKGNGVTDDTKAFADAWKTACSS---KVKT  86

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
            ++++P   T L++P+  +GPCK++ +   +SGT++AP  P  W GL+  +WL F+G+  L
Sbjct  87   RILVPENYTCLLRPIDLSGPCKAR-LTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRL  145

Query  429  IVNGGGVIDG  458
             V GGG ++G
Sbjct  146  TVEGGGTVNG  155



>emb|CDP14857.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +3

Query  72   MEVFVFLFILGLISSSRVSCKSF--NVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKS  245
            M VF+ +     +  S V  +SF  NV+DYGA GDG  DD+ AF +AW+ AC+STP   S
Sbjct  1    MGVFIPILFAAFVLPSSVVAQSFVYNVLDYGAVGDGYNDDTNAFKHAWEAACTSTPDSSS  60

Query  246  --PQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN--GLDTSQWLSFN  413
              P + IP+ ++F ++PV F GPC+S  I+  +SG ++AP +P  W   G     W+ F 
Sbjct  61   SAPTMQIPSNTSFFIQPVIFRGPCRSPIINVEISGELLAPVNPTDWRCIGGYCGMWIHFK  120

Query  414  GVYGLIVNGGGVIDGQ  461
             + GL + GGG I G+
Sbjct  121  SLRGLRLYGGGRIHGR  136



>ref|NP_565232.1| putative polygalacturonase [Arabidopsis thaliana]
 sp|Q94AJ5.1|PGLR5_ARATH RecName: Full=Probable polygalacturonase At1g80170; Short=PG; 
AltName: Full=Pectinase At1g80170; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK76676.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAN13206.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE36366.1| putative polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  69   SMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            S E  + L      S+   S +  +V ++GAKG+G+TDD++AF +AWK ACSS       
Sbjct  30   SFESLLQLPRRQSRSTRPRSERLLHVGNFGAKGNGVTDDTKAFADAWKTACSS---KVKT  86

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
            ++++P   T L++P+  +GPCK++ +   +SGT++AP  P  W GL+  +WL F+G+  L
Sbjct  87   RILVPENYTCLLRPIDLSGPCKAR-LTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRL  145

Query  429  IVNGGGVIDG  458
             V GGG ++G
Sbjct  146  TVEGGGTVNG  155



>ref|NP_001238091.1| polygalacturonase PG1 precursor [Glycine max]
 gb|AAD46483.1| polygalacturonase PG1 [Glycine max]
Length=443

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S  SFNV+DYGAKGDG  DD++AF +AW  AC      +   +++P+GS FLVKP+ F+G
Sbjct  42   SATSFNVLDYGAKGDGHADDTKAFEDAWAAACKV----EGSTMVVPSGSVFLVKPISFSG  97

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            P    +I F + G ++AP S   W G  T QWL F+ +  + + G GVIDGQ
Sbjct  98   PNCEPNIVFQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQ  148



>gb|ACU24545.1| unknown [Glycine max]
Length=443

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S  SFNV+DYGAKGDG  DD++AF +AW  AC      +   +++P+GS FLVKP+ F+G
Sbjct  42   SATSFNVLDYGAKGDGHADDTKAFEDAWAAACKV----EGSTMVVPSGSVFLVKPISFSG  97

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            P    +I F + G ++AP S   W G  T QWL F+ +  + + G GVIDGQ
Sbjct  98   PNCEPNIVFQLDGKIIAPTSSEAW-GSGTLQWLEFSKLNTITIRGKGVIDGQ  148



>gb|KDO61713.1| hypothetical protein CISIN_1g037736mg [Citrus sinensis]
Length=377

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
             +FNV+D+GA GDG TDDS AF  AW D CS+T    S  + IPA   FL+K   F GPC
Sbjct  15   NTFNVVDFGAIGDGKTDDSDAFAKAWTDFCSATG--DSATLEIPANKAFLLKSTTFRGPC  72

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  ++  VSGT+VAP S   W    +  WLS   V GL ++G G IDG 
Sbjct  73   KSNSVNIQVSGTIVAPDSKS-WKQCGSQCWLSLYDVQGLSIDGSGTIDGN  121



>ref|XP_009101636.1| PREDICTED: probable polygalacturonase At3g15720 [Brassica rapa]
Length=391

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
            ++V+ +GAKGDG T+DS+AF+ AWK  CSS   +K+  ++IP+ +TFL++P+ F GPC S
Sbjct  24   YDVLKFGAKGDGTTNDSEAFVEAWKAMCSSGGSNKT--LLIPSDNTFLLQPLVFQGPCNS  81

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
              +   + G +VAP +   W+   + +W+SFN + GL V G G I+G+
Sbjct  82   PSVQVKLEGKIVAPLNKAAWSDFKSYEWVSFNKIIGLTVLGSGTINGR  129



>ref|XP_010436249.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=406

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   YSMEVFVFLFI-LGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHK  242
            ++ME  + ++I +  + S  V+ +++NV++YGAKGDG TDDS+ F  AW D C      K
Sbjct  8    FTMETTLRVWIWINFLCSVLVNGQNYNVLNYGAKGDGQTDDSEGFEQAWNDTCGGDGDIK  67

Query  243  SPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVY  422
            +  ++IP+  TFL++P  F GPCKS  I   + G +VAP     W+   +  W+ F+ V 
Sbjct  68   T--LLIPSDKTFLLQPTVFQGPCKSSSIKVQLDGVIVAPIDKGAWSNPTSKMWIKFSYVS  125

Query  423  GLIVNGGGVIDGQ  461
            GL++ G G I+G+
Sbjct  126  GLMIVGSGTINGR  138



>ref|XP_011007737.1| PREDICTED: probable polygalacturonase At1g80170 [Populus euphratica]
Length=406

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
             FNVI+YGA G+G+T+DS AFL  W + C++     +  +IIP G TF + P+ FNGPCK
Sbjct  34   EFNVINYGASGNGITNDSLAFLRTWNNTCNAP---GTSTMIIPKGKTFFLNPLTFNGPCK  90

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +  I  +  G V+AP  P  W   D S WL F  +  L V+G  ++DG+
Sbjct  91   ANKISVMFYGRVIAPDGPNNWKERDLSTWLRFKDIAWLTVSGSRLLDGR  139



>ref|XP_004297904.1| PREDICTED: probable polygalacturonase At3g15720 [Fragaria vesca 
subsp. vesca]
Length=431

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            + +V+D+GA GDG+ DD+QAF+NAW   CS++ + K     IPAG TF+VKP +  GPCK
Sbjct  51   TLSVLDFGAHGDGVADDTQAFINAWNKLCSTSQLLK-----IPAGKTFVVKPFELLGPCK  105

Query  315  SQHIHFIVSGTVVAPGSPPGWNGL-DTSQWLSFNGVYGLIVNGGGVIDGQ  461
               +   + G +VAP +  GW  +     WL F  V GLI+ GGG+I+G+
Sbjct  106  FSSVILQIDGNIVAPSTRKGWGDVCKLGCWLCFRNVKGLIIKGGGLINGK  155



>ref|NP_001056198.1| Os05g0542800 [Oryza sativa Japonica Group]
 gb|AAU43992.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18112.1| Os05g0542800 [Oryza sativa Japonica Group]
Length=408

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +3

Query  150  DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHI  326
            D+GA GDG+T+D+QAFL+AW  AC+ST     P V+ +PAG T+ + PV+  GPCK + +
Sbjct  39   DFGAVGDGITNDTQAFLDAWNAACAST----EPAVLAVPAGKTYQIWPVRLAGPCK-KKL  93

Query  327  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
              ++SGT+ AP SP  W G D ++WL    V  L V+GGG IDG
Sbjct  94   KLMISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDG  137



>ref|XP_002863541.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39800.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 79/131 (60%), Gaps = 3/131 (2%)
 Frame = +3

Query  72   MEVFVF-LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            ME+ +  +F L L+ S  V+ + ++V+ +GAKG+G+TDDS+AF+ AWK  C S     S 
Sbjct  1    MEIILRGVFFLTLLHSVLVNGQIYDVLKFGAKGNGITDDSKAFVTAWKAMCGSGG--NSK  58

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGL  428
              +IP+  TFL++P+ F GPCKS  +     G +VAP +   W+     +W+SF  + GL
Sbjct  59   TFLIPSNKTFLLQPLMFQGPCKSPSVQVKFDGKIVAPINKAAWSENKLFRWVSFKEIIGL  118

Query  429  IVNGGGVIDGQ  461
             V G G I G+
Sbjct  119  TVTGSGTIHGR  129



>ref|XP_006483708.1| PREDICTED: probable polygalacturonase At3g15720-like [Citrus 
sinensis]
Length=473

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
             +FNV+D+GA GDG TDDS AF  AW D CS+T    S  + IPA   FL+K   F GPC
Sbjct  28   NTFNVVDFGAIGDGKTDDSDAFAKAWTDFCSATG--DSATLEIPANKAFLLKSTTFRGPC  85

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            KS  ++  VSGT+VAP S   W    +  WLS   V GL ++G G IDG 
Sbjct  86   KSNSVNIQVSGTIVAPDSKS-WKQCGSQCWLSLYDVQGLSIDGSGTIDGN  134



>ref|XP_010468193.1| PREDICTED: probable polygalacturonase At3g15720 [Camelina sativa]
Length=226

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 77/124 (62%), Gaps = 9/124 (7%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAG  269
            L IL + +SS     + +V  +GA GDG+TDDSQAFL AW+  CS T   +  Q+++PAG
Sbjct  11   LLILHIFTSSN----ALDVTQFGAVGDGVTDDSQAFLKAWEAVCSGT---RDGQLVVPAG  63

Query  270  STFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGV  449
             TFL++P++F G CKS  I   + G +VA  S   W G D  QW+ F  + GL+V G G 
Sbjct  64   MTFLLQPLKFQGSCKSAPIFVQILGNLVA-SSKGNWKG-DKDQWILFADIEGLVVEGDGE  121

Query  450  IDGQ  461
            I+GQ
Sbjct  122  INGQ  125



>ref|XP_007150725.1| hypothetical protein PHAVU_005G175800g [Phaseolus vulgaris]
 gb|ESW22719.1| hypothetical protein PHAVU_005G175800g [Phaseolus vulgaris]
Length=448

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 4/106 (4%)
 Frame = +3

Query  144  VIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQH  323
            V DYGAKGDG  +D++AFL AW  ACS   +     ++ P G TFLV PV   GPC+S+ 
Sbjct  57   VDDYGAKGDGFHNDTEAFLGAWGIACSLAGI---INLVFPFGKTFLVHPVDIGGPCRSK-  112

Query  324  IHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            I  ++SGT+VAP  P  W GL+  +WL F+GV  L V+GGG I+G 
Sbjct  113  ITLVISGTIVAPQDPAVWLGLNQRKWLYFHGVNHLTVDGGGSINGM  158



>gb|AAU43991.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG92404.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97396.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +3

Query  150  DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVI-IPAGSTFLVKPVQFNGPCKSQHI  326
            D+GA GDG+T+D+QAFL+AW  AC+ST     P V+ +PAG T+ + PV+  GPCK + +
Sbjct  39   DFGAVGDGITNDTQAFLDAWNAACAST----EPAVLAVPAGKTYQIWPVRLAGPCK-KKL  93

Query  327  HFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
              ++SGT+ AP SP  W G D ++WL    V  L V+GGG IDG
Sbjct  94   KLMISGTIAAPASPDEWAGRDPTKWLYVFRVDDLSVSGGGTIDG  137



>emb|CDY47032.1| BnaAnng08200D [Brassica napus]
Length=403

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 78/140 (56%), Gaps = 7/140 (5%)
 Frame = +3

Query  42   IFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            I   +     + V V     GL++      ++F+V+D+ A GDG TDDS AF+  W  AC
Sbjct  7    ILLFFEIILRLSVSVIFLCFGLVNG-----QNFSVLDFDATGDGQTDDSNAFVKTWNAAC  61

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  401
                      ++IPAG TFL++P+ FNGPC+S +    + G +VAP +   W+  ++  W
Sbjct  62   GGG--GDISILLIPAGRTFLIQPIVFNGPCRSSNTKVQLEGIIVAPSNKEAWSNPNSRMW  119

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            + F+ V GL++ G G I+G+
Sbjct  120  IKFSAVLGLVIVGSGTINGR  139



>gb|KFK42419.1| hypothetical protein AALP_AA2G253800 [Arabis alpina]
Length=444

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  153  YGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHF  332
            +GAKG+G TDD++AF++AWK ACSS       ++++P     LV+P+  +GPCK++ +  
Sbjct  58   FGAKGNGFTDDTKAFVDAWKTACSS---KSKTRILVPENYASLVRPIDLSGPCKAR-LTL  113

Query  333  IVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
             +SGT++AP  P  W GL+  +W+ F+GV  L V GGG ++G
Sbjct  114  QISGTIIAPSDPDDWEGLNLRKWIYFHGVSRLTVEGGGTVNG  155



>ref|NP_001168667.1| hypothetical protein precursor [Zea mays]
 gb|ACN29110.1| unknown [Zea mays]
 gb|AFW78963.1| hypothetical protein ZEAMMB73_374088 [Zea mays]
Length=272

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKS  317
              + D+G  GDG+ +D+QA L+AW  ACSST   +   + +PAG  + + PVQ +GPCK 
Sbjct  30   LTLDDFGGVGDGIANDTQALLDAWAAACSST---QEAVLAVPAGKVYQIWPVQLSGPCKK  86

Query  318  QHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            + +  ++SG +VAP SP  W G D  +WL   GV GL V+GGG IDG
Sbjct  87   R-LKLLISGAIVAPSSPDEWAGRDPMKWLYVYGVDGLSVSGGGTIDG  132



>ref|XP_004504535.1| PREDICTED: probable polygalacturonase At3g15720-like [Cicer arietinum]
Length=399

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 9/133 (7%)
 Frame = +3

Query  84   VFLFILGLISSSRVSCKS-----FNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSP  248
            +++ ++ +I+S  +  +      FNV+ YGA GDG TDD+ AFL AW+D C +  V   P
Sbjct  4    LYVLLMFVIASRSLCARETPTPFFNVLSYGAIGDGQTDDTNAFLEAWQDVCGT--VDGIP  61

Query  249  QVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWN--GLDTSQWLSFNGVY  422
             + IP G TF+++P+ F GPCKS +I   + G ++AP S   W     + + W+ F  + 
Sbjct  62   TLFIPRGKTFMLQPLLFQGPCKSAYIMIALKGIIIAPHSVEAWKWPNNERTAWIQFWQIS  121

Query  423  GLIVNGGGVIDGQ  461
            GL + GGG  +GQ
Sbjct  122  GLNIYGGGTFNGQ  134



>ref|XP_008385626.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=403

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPC  311
             +FNVIDYGA G+G  DDS AFL AW   C ST       +++P   TFL+  V F GPC
Sbjct  31   NTFNVIDYGAVGNGQADDSIAFLKAWGALCVST-TRGIATLVVPKSKTFLLNSVAFQGPC  89

Query  312  KSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            +S +I+F + G+++AP +   W   D  +W+ F  V GL++NGGG IDG 
Sbjct  90   RSSNINFQIQGSIIAPNNIGAWKNKD--KWIQFANVPGLMINGGGRIDGN  137



>emb|CDY30105.1| BnaC05g37570D [Brassica napus]
Length=449

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 81/124 (65%), Gaps = 9/124 (7%)
 Frame = +3

Query  90   LFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAG  269
            +FIL + + S    K+ +V  YGA GDG+TDDSQAFL AW+  CS T      Q+I+PAG
Sbjct  12   VFILKIFAYS----KALDVTQYGAVGDGVTDDSQAFLKAWEAVCSGT---GDGQLIVPAG  64

Query  270  STFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGV  449
             +F+++P++F G CKS  I   + GT+VA  S   W G D +QW+ F+ + GL+V+G G 
Sbjct  65   MSFMLQPLKFQGSCKSTPIAVQILGTLVAS-SRGKWKG-DKNQWILFSDIEGLVVDGNGK  122

Query  450  IDGQ  461
            I+GQ
Sbjct  123  INGQ  126



>gb|EPS70858.1| polygalacturonase, partial [Genlisea aurea]
Length=170

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 75/115 (65%), Gaps = 11/115 (10%)
 Frame = +3

Query  114  SSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPV  293
            SSR+  +S NV+D+GAKGDG+TDDS+A LNAWK+ACSS+   +  ++I+P    +L+K +
Sbjct  51   SSRI--RSINVLDFGAKGDGVTDDSKALLNAWKEACSSS---QDVKLIVPPDRNYLLKQL  105

Query  294  QFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            +F+GPC SQ     V G + A      + G D   W+ F+ V  L+V GGG +DG
Sbjct  106  RFSGPCTSQ-----VGGGLKASDKTSDY-GSDRRHWIRFDSVDRLVVQGGGTVDG  154



>ref|XP_007011881.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY29500.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=437

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +3

Query  135  SFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNGPCK  314
            + NV+ +GA GDG TDDS AFL AW+  C +    ++  ++IPA  TFLV  VQF GPC 
Sbjct  69   TLNVLKFGAVGDGNTDDSHAFLKAWEALCGARG--RTSTLVIPASKTFLVSHVQFLGPCS  126

Query  315  SQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            S  +H  V G +VAP     W+G +   WL F GV+GL+++G G IDG 
Sbjct  127  SSSVHVQVLGKIVAP-EANAWSGCNYDCWLCFMGVHGLVIDGSGQIDGN  174



>ref|XP_002521450.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF40940.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=466

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +3

Query  126  SCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            S  +FNV+DYGAKGDG TDD++AF  AW  AC      ++  +++P+GS FLV P+ F+G
Sbjct  73   SLATFNVLDYGAKGDGRTDDTKAFEAAWIAACKV----EASTIVVPSGSMFLVHPISFSG  128

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            P  +++I F + G ++AP S   W G    QW+ F  + G+ + G G+IDGQ
Sbjct  129  PACAENIVFQLDGKIIAPTSATAW-GSGLLQWIEFTKLKGITIKGKGIIDGQ  179



>ref|XP_008337027.1| PREDICTED: probable polygalacturonase At3g15720 [Malus domestica]
Length=373

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +3

Query  132  KSFNVIDYGAKGDGMTDDSQAFLNAWKDAC--SSTPVHKSPQVIIPAGSTFLVKPVQFNG  305
            K  +V  YGA GDG  DDSQAF  AWKD C  ++      P +I+P G T+L++ ++F G
Sbjct  28   KILDVTKYGAMGDGRADDSQAFFKAWKDLCZGNNDATDDIPILIVPEGKTYLLQRIKFEG  87

Query  306  PCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDGQ  461
            PC S+ +H  + G ++AP     W   D+  WLSF+ +  L+++G G IDGQ
Sbjct  88   PCNSKSVHVQILGNLLAP-VRGAWKECDSGDWLSFSNIENLMLDGSGKIDGQ  138



>gb|KJB68125.1| hypothetical protein B456_010G226900 [Gossypium raimondii]
Length=454

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 7/119 (6%)
 Frame = +3

Query  111  SSSRVSCKSFNVI---DYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVIIPAGSTFL  281
            SS+R+  ++  V+   D+GAKGDG  +D++AF NAW  ACS        +++IPAG T+L
Sbjct  52   SSARIRPRAKQVLSVSDFGAKGDGYHNDTRAFENAWNVACS---FPGRIRIVIPAGYTYL  108

Query  282  VKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQWLSFNGVYGLIVNGGGVIDG  458
            V PV+  G CKS+ I  ++SGT+VAP +P  W+GL+  +WL F  V  L V GGG I+G
Sbjct  109  VHPVELGGHCKSK-ITLMISGTIVAPKNPNVWDGLNPRKWLYFREVKHLHVVGGGTING  166



>ref|XP_010663872.1| PREDICTED: probable polygalacturonase At3g15720 [Vitis vinifera]
Length=399

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  87   FLFILGLISS--SRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDACSSTPVHKSPQVII  260
             LF++ L S   + + C  F+V  YGA G+G TDDS AF+ AW D C+S+    +P   I
Sbjct  7    ILFLVSLFSVLLTPLHCSVFDVTQYGAIGNGSTDDSPAFMLAWTDVCNSSA--STPIFHI  64

Query  261  PAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTS--QWLSFNGVYGLIV  434
            P   TFL+ PV F GPC+S +I F + G + A   P  W        +W+ F  V GL +
Sbjct  65   PGNKTFLLNPVFFQGPCRSTNIQFQIDGIITAESEPSNWKCTRNRCDKWIHFKRVDGLFI  124

Query  435  NGGGVIDG  458
            NG G+IDG
Sbjct  125  NGSGIIDG  132



>emb|CDX72553.1| BnaC07g45750D [Brassica napus]
Length=403

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 78/140 (56%), Gaps = 7/140 (5%)
 Frame = +3

Query  42   IFALYCCFYSMEVFVFLFILGLISSSRVSCKSFNVIDYGAKGDGMTDDSQAFLNAWKDAC  221
            I   +       V V     GL++S     ++++V+D+ A GDG TDDS AF+  W  AC
Sbjct  7    ILLFFEIILRFSVSVIFLCFGLVNS-----QNYSVLDFDATGDGQTDDSNAFVKTWNAAC  61

Query  222  SSTPVHKSPQVIIPAGSTFLVKPVQFNGPCKSQHIHFIVSGTVVAPGSPPGWNGLDTSQW  401
                      ++IPAG TFL++P+ FNGPC+S +    + G ++AP +   W+  ++  W
Sbjct  62   GGG--GDISILLIPAGRTFLIQPIVFNGPCRSSNTKVQLEGVIIAPSNKEAWSNPNSRMW  119

Query  402  LSFNGVYGLIVNGGGVIDGQ  461
            + F+ V GL++ G G I+G+
Sbjct  120  IKFSAVLGLVIVGSGTINGR  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 585382820285