BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6426

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358874.1|  PREDICTED: phosphatidylinositol glycan ancho...    272   6e-85   Solanum tuberosum [potatoes]
ref|XP_004245643.1|  PREDICTED: phosphatidylinositol glycan ancho...    271   7e-85   
ref|XP_009782606.1|  PREDICTED: phosphatidylinositol glycan ancho...    270   5e-84   Nicotiana sylvestris
gb|EYU29835.1|  hypothetical protein MIMGU_mgv1a005883mg                257   3e-79   Erythranthe guttata [common monkey flower]
ref|XP_008373833.1|  PREDICTED: phosphatidylinositol glycan ancho...    253   1e-78   
ref|XP_008373831.1|  PREDICTED: phosphatidylinositol glycan ancho...    254   1e-78   
ref|XP_008238817.1|  PREDICTED: phosphatidylinositol glycan ancho...    253   2e-77   Prunus mume [ume]
emb|CDP09802.1|  unnamed protein product                                253   2e-77   Coffea canephora [robusta coffee]
ref|XP_008369470.1|  PREDICTED: phosphatidylinositol glycan ancho...    253   2e-77   
ref|XP_008373830.1|  PREDICTED: phosphatidylinositol glycan ancho...    252   3e-77   
ref|XP_007209980.1|  hypothetical protein PRUPE_ppa005072mg             252   4e-77   Prunus persica
ref|XP_011072194.1|  PREDICTED: phosphatidylinositol glycan ancho...    250   1e-76   Sesamum indicum [beniseed]
ref|XP_006477405.1|  PREDICTED: phosphatidylinositol glycan ancho...    248   2e-75   
gb|KCW72094.1|  hypothetical protein EUGRSUZ_E00536                     246   3e-75   Eucalyptus grandis [rose gum]
ref|XP_002276721.1|  PREDICTED: phosphatidylinositol glycan ancho...    246   7e-75   Vitis vinifera
gb|KCW72093.1|  hypothetical protein EUGRSUZ_E00536                     245   2e-74   Eucalyptus grandis [rose gum]
ref|XP_010055599.1|  PREDICTED: phosphatidylinositol glycan ancho...    246   2e-74   Eucalyptus grandis [rose gum]
ref|XP_012086988.1|  PREDICTED: phosphatidylinositol glycan ancho...    245   2e-74   Jatropha curcas
ref|XP_009344269.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    243   2e-73   
ref|XP_004298744.2|  PREDICTED: phosphatidylinositol glycan ancho...    242   3e-73   Fragaria vesca subsp. vesca
ref|XP_002509716.1|  conserved hypothetical protein                     242   5e-73   
gb|KEH31711.1|  GPI transamidase subunit PIG-U                          240   1e-72   Medicago truncatula
gb|KEH31710.1|  GPI transamidase subunit PIG-U                          240   2e-72   Medicago truncatula
ref|XP_007155557.1|  hypothetical protein PHAVU_003G211900g             238   5e-72   Phaseolus vulgaris [French bean]
ref|XP_010278563.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   6e-72   Nelumbo nucifera [Indian lotus]
ref|XP_004515803.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   1e-71   Cicer arietinum [garbanzo]
ref|XP_004515804.1|  PREDICTED: phosphatidylinositol glycan ancho...    238   1e-71   Cicer arietinum [garbanzo]
gb|KDO63549.1|  hypothetical protein CISIN_1g0117601mg                  228   2e-71   Citrus sinensis [apfelsine]
ref|XP_010278562.1|  PREDICTED: phosphatidylinositol glycan ancho...    237   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006440549.1|  hypothetical protein CICLE_v10019953mg             234   3e-70   
ref|XP_007042808.1|  GPI transamidase subunit PIG-U isoform 3           233   4e-70   
ref|XP_003550876.1|  PREDICTED: phosphatidylinositol glycan ancho...    233   6e-70   Glycine max [soybeans]
gb|KJB12323.1|  hypothetical protein B456_002G011900                    232   1e-69   Gossypium raimondii
gb|KHN34428.1|  Phosphatidylinositol glycan anchor biosynthesis c...    231   4e-69   Glycine soja [wild soybean]
ref|XP_007042806.1|  GPI transamidase subunit PIG-U isoform 1           230   7e-69   
ref|XP_002299558.1|  hypothetical protein POPTR_0001s08870g             230   8e-69   
ref|XP_011029199.1|  PREDICTED: phosphatidylinositol glycan ancho...    230   9e-69   Populus euphratica
ref|NP_850969.2|  GPI transamidase subunit PIG-U                        227   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473541.1|  PREDICTED: phosphatidylinositol glycan ancho...    227   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010430394.1|  PREDICTED: phosphatidylinositol glycan ancho...    227   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010418322.1|  PREDICTED: phosphatidylinositol glycan ancho...    226   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_002887978.1|  hypothetical protein ARALYDRAFT_475037             225   8e-67   
ref|XP_010545955.1|  PREDICTED: phosphatidylinositol glycan ancho...    224   1e-66   Tarenaya hassleriana [spider flower]
ref|NP_563912.1|  GPI transamidase subunit PIG-U                        222   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302210.1|  hypothetical protein CARUB_v10020222mg             222   2e-65   
ref|XP_006307624.1|  hypothetical protein CARUB_v10009259mg             218   9e-65   
gb|KFK40542.1|  hypothetical protein AALP_AA2G009200                    219   2e-64   Arabis alpina [alpine rockcress]
ref|XP_006391780.1|  hypothetical protein EUTSA_v10023435mg             218   4e-64   Eutrema salsugineum [saltwater cress]
ref|XP_004143931.1|  PREDICTED: phosphatidylinositol glycan ancho...    217   8e-64   Cucumis sativus [cucumbers]
ref|XP_010933542.1|  PREDICTED: phosphatidylinositol glycan ancho...    216   8e-64   Elaeis guineensis
ref|XP_010676542.1|  PREDICTED: phosphatidylinositol glycan ancho...    217   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008437214.1|  PREDICTED: phosphatidylinositol glycan ancho...    216   2e-63   Cucumis melo [Oriental melon]
ref|XP_010933540.1|  PREDICTED: phosphatidylinositol glycan ancho...    216   3e-63   Elaeis guineensis
ref|XP_008786213.1|  PREDICTED: phosphatidylinositol glycan ancho...    215   5e-63   Phoenix dactylifera
ref|XP_010458704.1|  PREDICTED: phosphatidylinositol glycan ancho...    215   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002452728.1|  hypothetical protein SORBIDRAFT_04g031420          214   8e-63   Sorghum bicolor [broomcorn]
ref|XP_007042809.1|  GPI transamidase subunit PIG-U isoform 4           214   3e-62   
ref|XP_009113020.1|  PREDICTED: phosphatidylinositol glycan ancho...    213   3e-62   Brassica rapa
ref|NP_001047781.1|  Os02g0688900                                       213   3e-62   
emb|CDY45975.1|  BnaA09g12910D                                          213   4e-62   Brassica napus [oilseed rape]
gb|KGN50142.1|  hypothetical protein Csa_5G155530                       218   8e-62   Cucumis sativus [cucumbers]
ref|XP_009388331.1|  PREDICTED: phosphatidylinositol glycan ancho...    211   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK07917.1|  predicted protein                                      210   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001148568.1|  GPI transamidase subunit PIG-U family protein      210   3e-61   Zea mays [maize]
ref|XP_007042807.1|  GPI transamidase subunit PIG-U isoform 2           211   4e-61   
gb|EPS73832.1|  hypothetical protein M569_00921                         209   5e-61   Genlisea aurea
emb|CDY67234.1|  BnaCnng54040D                                          209   1e-60   Brassica napus [oilseed rape]
ref|XP_006647706.1|  PREDICTED: phosphatidylinositol glycan ancho...    206   1e-59   Oryza brachyantha
gb|EEE57603.1|  hypothetical protein OsJ_07980                          206   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004964641.1|  PREDICTED: phosphatidylinositol glycan ancho...    206   1e-59   Setaria italica
ref|XP_010476248.1|  PREDICTED: phosphatidylinositol glycan ancho...    204   9e-59   
ref|XP_010476247.1|  PREDICTED: phosphatidylinositol glycan ancho...    203   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008786214.1|  PREDICTED: phosphatidylinositol glycan ancho...    201   4e-58   Phoenix dactylifera
ref|XP_003562742.1|  PREDICTED: phosphatidylinositol glycan ancho...    201   6e-58   Brachypodium distachyon [annual false brome]
ref|XP_004953492.1|  PREDICTED: phosphatidylinositol glycan ancho...    201   6e-58   
ref|XP_012086990.1|  PREDICTED: phosphatidylinositol glycan ancho...    202   7e-58   Jatropha curcas
ref|XP_010112563.1|  Phosphatidylinositol glycan anchor biosynthe...    196   6e-56   
gb|AAF88086.1|AC025417_14  T12C24.26                                    194   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889963.1|  hypothetical protein ARALYDRAFT_471424             191   1e-53   
ref|XP_004964640.1|  PREDICTED: phosphatidylinositol glycan ancho...    187   2e-52   
gb|EMS63096.1|  Phosphatidylinositol glycan anchor biosynthesis c...    176   4e-49   Triticum urartu
ref|XP_011624959.1|  PREDICTED: phosphatidylinositol glycan ancho...    180   5e-49   
ref|XP_010933541.1|  PREDICTED: phosphatidylinositol glycan ancho...    169   1e-45   Elaeis guineensis
ref|XP_011621261.1|  PREDICTED: phosphatidylinositol glycan ancho...    163   2e-43   Amborella trichopoda
gb|EEC71873.1|  hypothetical protein OsI_04592                          164   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_006579601.1|  PREDICTED: phosphatidylinositol glycan ancho...    149   1e-38   Glycine max [soybeans]
ref|NP_974075.1|  GPI transamidase subunit PIG-U                        147   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625091.1|  PREDICTED: uncharacterized protein LOC104116025    140   3e-37   
gb|KJB12324.1|  hypothetical protein B456_002G011900                    144   9e-37   Gossypium raimondii
ref|XP_009627450.1|  PREDICTED: phosphatidylinositol glycan ancho...    139   4e-35   Nicotiana tomentosiformis
ref|XP_009627449.1|  PREDICTED: phosphatidylinositol glycan ancho...    138   7e-35   Nicotiana tomentosiformis
gb|EEC73810.1|  hypothetical protein OsI_08523                          134   3e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004491296.1|  PREDICTED: phosphatidylinositol glycan ancho...    131   1e-32   
ref|XP_001778404.1|  predicted protein                                  129   4e-31   
ref|XP_008369469.1|  PREDICTED: phosphatidylinositol glycan ancho...    128   8e-31   
gb|AAG51607.1|AC010795_11  unknown protein; 55290-58984                 128   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373832.1|  PREDICTED: phosphatidylinositol glycan ancho...    120   4e-28   
ref|XP_010050833.1|  PREDICTED: phosphatidylinositol glycan ancho...    108   5e-26   
ref|XP_011029200.1|  PREDICTED: phosphatidylinositol glycan ancho...    114   5e-26   Populus euphratica
ref|NP_973813.1|  GPI transamidase subunit PIG-U                        112   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986198.1|  hypothetical protein SELMODRAFT_43879              110   9e-25   
ref|XP_002985010.1|  hypothetical protein SELMODRAFT_121519             110   1e-24   
ref|XP_008786215.1|  PREDICTED: phosphatidylinositol glycan ancho...    109   2e-24   
ref|NP_176499.2|  GPI transamidase subunit PIG-U                        108   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458703.1|  PREDICTED: phosphatidylinositol glycan ancho...    108   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006579602.1|  PREDICTED: phosphatidylinositol glycan ancho...    107   1e-23   
ref|XP_010473542.1|  PREDICTED: phosphatidylinositol glycan ancho...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010476249.1|  PREDICTED: phosphatidylinositol glycan ancho...    106   3e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010430395.1|  PREDICTED: phosphatidylinositol glycan ancho...    105   5e-23   Camelina sativa [gold-of-pleasure]
gb|KCW60085.1|  hypothetical protein EUGRSUZ_H02816                     101   8e-23   Eucalyptus grandis [rose gum]
ref|XP_010418323.1|  PREDICTED: phosphatidylinositol glycan ancho...    105   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010235897.1|  PREDICTED: phosphatidylinositol glycan ancho...    103   3e-22   
ref|XP_010045079.1|  PREDICTED: uncharacterized protein LOC104433...  97.4    7e-22   
ref|XP_009113021.1|  PREDICTED: phosphatidylinositol glycan ancho...  99.0    1e-20   Brassica rapa
dbj|BAD81713.1|  putative transamidase complex subunit PIG-U          95.1    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ14305.1|  hypothetical protein OsJ_04231                        94.7    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010045078.1|  PREDICTED: uncharacterized protein LOC104433...  89.4    1e-18   
ref|XP_010039623.1|  PREDICTED: uncharacterized protein LOC104428326  90.1    2e-18   
gb|ERN00381.1|  hypothetical protein AMTR_s00104p00125750             84.3    3e-17   Amborella trichopoda
gb|ERN00380.1|  hypothetical protein AMTR_s00104p00124380             88.2    5e-17   Amborella trichopoda
ref|XP_010064370.1|  PREDICTED: mucin-5AC-like                        88.6    6e-17   
gb|KIW17861.1|  hypothetical protein PV08_05056                       82.4    7e-15   Exophiala spinifera
ref|XP_007754120.1|  phosphatidylinositol glycan, class U             80.9    3e-14   Cladophialophora yegresii CBS 114405
ref|XP_640406.2|  GPI transamidase subunit PIG-U family protein       81.6    3e-14   Dictyostelium discoideum AX4
ref|XP_003284102.1|  hypothetical protein DICPUDRAFT_147853           80.9    4e-14   Dictyostelium purpureum
gb|KIW71802.1|  hypothetical protein PV04_00035                       79.7    7e-14   Phialophora americana
gb|KIW94595.1|  hypothetical protein Z519_04571                       79.7    7e-14   Cladophialophora bantiana CBS 173.52
ref|XP_007744954.1|  phosphatidylinositol glycan, class U             79.3    1e-13   Cladophialophora psammophila CBS 110553
gb|KIV94669.1|  hypothetical protein PV10_02413                       77.8    3e-13   Exophiala mesophila
gb|KEQ71380.1|  PIG-U-domain-containing protein                       77.4    6e-13   Aureobasidium namibiae CBS 147.97
gb|KIW37113.1|  hypothetical protein PV06_10740                       77.0    6e-13   Exophiala oligosperma
ref|XP_009152706.1|  phosphatidylinositol glycan, class U             76.6    8e-13   Exophiala dermatitidis NIH/UT8656
gb|KIV77768.1|  hypothetical protein PV11_09549                       75.9    2e-12   Exophiala sideris
ref|XP_007720395.1|  phosphatidylinositol glycan, class U             75.5    2e-12   Capronia coronata CBS 617.96
gb|KIX06694.1|  hypothetical protein Z518_04670                       74.7    4e-12   Rhinocladiella mackenziei CBS 650.93
gb|KIW62088.1|  hypothetical protein PV05_02139                       74.3    5e-12   Exophiala xenobiotica
gb|KEQ84032.1|  GPI transamidase-like protein component PIG-U         74.3    5e-12   Aureobasidium pullulans EXF-150
gb|EFW17847.1|  GPI transamidase component PIG-U                      74.3    6e-12   Coccidioides posadasii str. Silveira
ref|XP_008724561.1|  hypothetical protein G647_10348                  74.3    6e-12   Cladophialophora carrionii CBS 160.54
gb|KIW82792.1|  hypothetical protein Z517_02035                       73.9    7e-12   Fonsecaea pedrosoi CBS 271.37
gb|EAS30072.3|  GPI transamidase component PIG-U                      73.9    8e-12   Coccidioides immitis RS
gb|KIW26532.1|  hypothetical protein PV07_09619                       73.6    9e-12   Cladophialophora immunda
gb|KEQ98049.1|  hypothetical protein AUEXF2481DRAFT_27382             73.6    9e-12   Aureobasidium subglaciale EXF-2481
gb|EZF35547.1|  hypothetical protein H101_00928                       72.0    3e-11   Trichophyton interdigitale H6
ref|XP_004359162.1|  GPI transamidase subunit PIG-U family protein    72.4    3e-11   Cavenderia fasciculata
gb|EGD97243.1|  GPI transamidase component PIG-U                      72.4    3e-11   Trichophyton tonsurans CBS 112818
gb|KDN64021.1|  putative GPI transamidase subunit PIG-U               71.6    4e-11   Colletotrichum sublineola
dbj|GAM23439.1|  hypothetical protein SAMD00019534_066140             71.6    5e-11   Acytostelium subglobosum LB1
gb|EFW98771.1|  GPI transamidase component                            70.9    7e-11   Grosmannia clavigera kw1407
ref|XP_003232922.1|  GPI transamidase component PIG-U                 70.9    9e-11   Trichophyton rubrum CBS 118892
gb|EFA79190.1|  GPI transamidase subunit PIG-U family protein         70.5    9e-11   Heterostelium album PN500
ref|XP_007777925.1|  phosphatidylinositol glycan, class U             70.1    2e-10   Coniosporium apollinis CBS 100218
ref|XP_003070612.1|  GPI transamidase subunit PIG-U family protein    69.7    2e-10   Coccidioides posadasii C735 delta SOWgp
ref|XP_010032918.1|  PREDICTED: uncharacterized protein LOC104422325  65.9    3e-10   Eucalyptus grandis [rose gum]
gb|KEQ63334.1|  GPI transamidase-like protein component PIG-U         69.3    3e-10   Aureobasidium melanogenum CBS 110374
gb|KFH62554.1|  hypothetical protein MVEG_11947                       68.9    4e-10   Mortierella verticillata NRRL 6337
gb|KIX93971.1|  hypothetical protein Z520_10308                       68.9    4e-10   Fonsecaea multimorphosa CBS 102226
ref|XP_011561007.1|  PREDICTED: phosphatidylinositol glycan ancho...  68.6    4e-10   Plutella xylostella [cabbage moth]
gb|KEZ45954.1|  hypothetical protein SAPIO_CDS1343                    68.6    4e-10   Scedosporium apiospermum
gb|EGZ76965.1|  PIG-U-domain-containing protein                       68.6    5e-10   Neurospora tetrasperma FGSC 2509
ref|XP_011554688.1|  PREDICTED: phosphatidylinositol glycan ancho...  68.6    5e-10   Plutella xylostella [cabbage moth]
gb|KEF63180.1|  phosphatidylinositol glycan, class U                  68.6    5e-10   Exophiala aquamarina CBS 119918
ref|XP_008719190.1|  hypothetical protein HMPREF1541_06638            68.6    5e-10   Cyphellophora europaea CBS 101466
ref|XP_007711525.1|  hypothetical protein COCCADRAFT_94165            68.2    6e-10   Bipolaris zeicola 26-R-13
ref|XP_009855795.1|  hypothetical protein NEUTE1DRAFT_90147           68.2    6e-10   Neurospora tetrasperma FGSC 2508
ref|XP_007592069.1|  GPI transamidase subunit PIG-U                   68.2    7e-10   
gb|KFZ16389.1|  hypothetical protein V502_05131                       67.8    8e-10   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|ELR05449.1|  hypothetical protein GMDG_01744                       67.4    1e-09   Pseudogymnoascus destructans 20631-21
ref|XP_001791507.1|  hypothetical protein SNOG_00836                  67.4    1e-09   Parastagonospora nodorum SN15
ref|XP_007737222.1|  phosphatidylinositol glycan, class U             67.4    1e-09   Capronia epimyces CBS 606.96
ref|XP_007806265.1|  hypothetical protein EPUS_06938                  67.0    1e-09   Endocarpon pusillum Z07020
ref|XP_007585520.1|  putative gpi transamidase component pig-u pr...  67.0    1e-09   
gb|KFA76780.1|  hypothetical protein S40288_08645                     67.0    1e-09   Stachybotrys chartarum IBT 40288
ref|XP_003351660.1|  hypothetical protein SMAC_00202                  67.0    2e-09   Sordaria macrospora k-hell
ref|XP_964750.3|  glycosylphosphatidylinositol transamidase 2         67.0    2e-09   Neurospora crassa OR74A
gb|KEY64722.1|  hypothetical protein S7711_09337                      67.0    2e-09   Stachybotrys chartarum IBT 7711
gb|EUN29626.1|  hypothetical protein COCVIDRAFT_35499                 67.0    2e-09   Bipolaris victoriae FI3
ref|XP_007686410.1|  hypothetical protein COCMIDRAFT_35345            66.6    2e-09   Bipolaris oryzae ATCC 44560
dbj|GAD94038.1|  GPI transamidase component GAB1                      66.6    2e-09   Byssochlamys spectabilis No. 5
ref|XP_007919918.1|  hypothetical protein MYCFIDRAFT_32437            66.6    2e-09   Pseudocercospora fijiensis CIRAD86
ref|XP_007698906.1|  hypothetical protein COCSADRAFT_140249           66.2    3e-09   Bipolaris sorokiniana ND90Pr
gb|EMD89631.1|  hypothetical protein COCHEDRAFT_1021929               66.2    3e-09   Bipolaris maydis C5
emb|CEI98019.1|  hypothetical protein RMCBS344292_12137               66.2    3e-09   Rhizopus microsporus
emb|CEG63846.1|  hypothetical protein RMATCC62417_00923               66.2    3e-09   Rhizopus microsporus
gb|KFY30062.1|  hypothetical protein V494_08290                       66.2    3e-09   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY08506.1|  hypothetical protein V492_06169                       66.2    3e-09   Pseudogymnoascus sp. VKM F-4246
gb|KFY72308.1|  hypothetical protein V499_07561                       66.2    3e-09   Pseudogymnoascus sp. VKM F-103
gb|KFZ07279.1|  hypothetical protein V501_06589                       65.9    3e-09   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|XP_002845857.1|  GPI transamidase component PIG-U                 65.9    3e-09   Microsporum canis CBS 113480
ref|XP_008031113.1|  hypothetical protein SETTUDRAFT_166106           65.9    4e-09   Exserohilum turcica Et28A
gb|KFX88189.1|  hypothetical protein O988_09129                       65.9    4e-09   Pseudogymnoascus sp. VKM F-3808
gb|KIL84525.1|  phosphatidylinositol class u                          65.9    4e-09   Fusarium avenaceum
ref|XP_001949071.2|  PREDICTED: phosphatidylinositol glycan ancho...  65.9    4e-09   Acyrthosiphon pisum
gb|ERS96460.1|  hypothetical protein HMPREF1624_07372                 65.5    4e-09   Sporothrix schenckii ATCC 58251
gb|KIH94823.1|  phosphatidylinositol glycan, class U                  65.5    5e-09   Sporothrix brasiliensis 5110
ref|XP_011316395.1|  hypothetical protein FGSG_00694                  65.5    5e-09   Fusarium graminearum PH-1
gb|KFX88932.1|  hypothetical protein V490_07331                       65.5    5e-09   Pseudogymnoascus sp. VKM F-3557
ref|XP_007297088.1|  hypothetical protein MBM_09199                   65.5    6e-09   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KFY96621.1|  hypothetical protein V500_02355                       65.5    6e-09   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
emb|CEI96442.1|  hypothetical protein RMCBS344292_10603               65.1    7e-09   Rhizopus microsporus
ref|XP_003714051.1|  hypothetical protein MGG_01168                   65.1    8e-09   Magnaporthe oryzae 70-15
ref|XP_003054523.1|  predicted protein                                65.1    8e-09   [Nectria] haematococca mpVI 77-13-4
ref|XP_007279912.1|  gpi transamidase component pig-u                 64.7    8e-09   
gb|KKA26563.1|  hypothetical protein TD95_004260                      64.3    1e-08   Thielaviopsis punctulata
gb|EXM12219.1|  phosphatidylinositol glycan, class U                  64.3    1e-08   Fusarium oxysporum f. sp. cubense tropical race 4 54006
emb|CCX12476.1|  Similar to Phosphatidylinositol glycan anchor bi...  64.3    1e-08   Pyronema omphalodes CBS 100304
gb|EMT61375.1|  Phosphatidylinositol glycan anchor biosynthesis c...  64.3    1e-08   Fusarium oxysporum f. sp. cubense race 4
gb|EWZ51861.1|  phosphatidylinositol glycan, class U                  64.3    1e-08   Fusarium oxysporum Fo47
gb|ENH61510.1|  Phosphatidylinositol glycan anchor biosynthesis c...  64.3    1e-08   Fusarium oxysporum f. sp. cubense race 1
gb|EWY92840.1|  phosphatidylinositol glycan, class U                  64.3    1e-08   Fusarium oxysporum FOSC 3-a
gb|KFY68904.1|  hypothetical protein V496_00727                       64.3    1e-08   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|EME49171.1|  hypothetical protein DOTSEDRAFT_40413                 64.3    1e-08   Dothistroma septosporum NZE10
gb|KJK79742.1|  hypothetical protein H634G_05334                      63.9    1e-08   Metarhizium anisopliae BRIP 53293
gb|KFY40252.1|  hypothetical protein V495_05523                       63.9    2e-08   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_009219131.1|  hypothetical protein GGTG_03089                  63.9    2e-08   Gaeumannomyces tritici R3-111a-1
ref|XP_007795901.1|  putative cell division control protein cdc91...  63.9    2e-08   
ref|XP_006966568.1|  predicted protein                                63.9    2e-08   Trichoderma reesei QM6a
gb|EFQ25612.1|  GPI transamidase subunit PIG-U                        63.9    2e-08   Colletotrichum graminicola M1.001
gb|EXK49157.1|  phosphatidylinositol glycan, class U                  63.5    2e-08   Fusarium oxysporum f. sp. melonis 26406
ref|XP_007813606.1|  putative cell division control protein CDC91     63.5    2e-08   Metarhizium acridum CQMa 102
gb|EWG36489.1|  phosphatidylinositol glycan, class U                  63.2    3e-08   Fusarium verticillioides 7600
emb|CCT63378.1|  related to cell division control protein CDC91       63.2    3e-08   Fusarium fujikuroi IMI 58289
ref|XP_008084885.1|  hypothetical protein GLAREA_04317                63.2    3e-08   Glarea lozoyensis ATCC 20868
gb|EEH18057.1|  hypothetical protein PABG_00620                       63.2    3e-08   Paracoccidioides brasiliensis Pb03
gb|EGU78379.1|  hypothetical protein FOXB_11130                       63.2    3e-08   Fusarium oxysporum Fo5176
ref|XP_010758248.1|  hypothetical protein PADG_03052                  63.2    3e-08   Paracoccidioides brasiliensis Pb18
gb|EXA51889.1|  phosphatidylinositol glycan, class U                  63.2    3e-08   Fusarium oxysporum f. sp. pisi HDV247
ref|XP_011113226.1|  hypothetical protein H072_7472                   62.8    4e-08   
gb|KFA65733.1|  hypothetical protein S40285_04875                     62.8    4e-08   Stachybotrys chlorohalonata IBT 40285
emb|CEJ89134.1|  Putative Phosphatidylinositol glycan anchor bios...  62.8    5e-08   Torrubiella hemipterigena
ref|XP_002415929.1|  phosphatidylinositol glycan anchor biosynthe...  62.8    5e-08   Ixodes scapularis [blacklegged tick]
ref|XP_010066093.1|  PREDICTED: uncharacterized protein LOC104453267  59.3    5e-08   
gb|EMF16367.1|  CDC91 cell division cycle 91-like protein             62.4    5e-08   Sphaerulina musiva SO2202
ref|XP_002839852.1|  hypothetical protein                             62.4    6e-08   Tuber melanosporum Mel28
gb|EPE09569.1|  gpi transamidase subunit pig-u                        62.4    6e-08   Ophiostoma piceae UAMH 11346
emb|CCU74807.1|  GPI transamidase component PIG-U                     62.4    6e-08   Blumeria graminis f. sp. hordei DH14
gb|KHJ30205.1|  putative gpi transamidase component pig-u             62.0    7e-08   Erysiphe necator
ref|XP_661430.1|  hypothetical protein AN3826.2                       62.0    7e-08   Aspergillus nidulans FGSC A4
ref|XP_009657441.1|  GPI transamidase component GAB1                  62.0    8e-08   Verticillium dahliae VdLs.17
ref|XP_003300377.1|  hypothetical protein PTT_11613                   61.6    9e-08   
ref|XP_001937251.1|  CDC91 cell division cycle 91-like protein        61.2    1e-07   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007816955.1|  GPI transamidase subunit PIG-U                   61.2    1e-07   Metarhizium robertsii ARSEF 23
gb|KFG78421.1|  cell division control protein CDC91                   61.2    1e-07   Metarhizium anisopliae
gb|KDB11111.1|  putative cell division control protein CDC91          61.2    2e-07   Ustilaginoidea virens
ref|XP_006697629.1|  GPI transamidase component-like protein          60.8    2e-07   Chaetomium thermophilum var. thermophilum DSM 1495
dbj|GAO19754.1|  hypothetical protein UVI_073880                      60.8    2e-07   Ustilaginoidea virens
ref|XP_004527292.1|  PREDICTED: phosphatidylinositol glycan ancho...  60.8    2e-07   Ceratitis capitata [medfly]
emb|CCF39294.1|  GPI transamidase subunit PIG-U                       60.8    2e-07   Colletotrichum higginsianum
gb|KID89840.1|  cell division control protein CDC91                   60.8    2e-07   Metarhizium guizhouense ARSEF 977
ref|XP_003175300.1|  hypothetical protein MGYG_02829                  60.5    2e-07   Nannizzia gypsea CBS 118893
gb|KJZ77340.1|  hypothetical protein HIM_03064                        60.5    2e-07   Hirsutella minnesotensis 3608
gb|EWC43819.1|  hypothetical protein DRE_07328                        60.5    2e-07   Drechslerella stenobrocha 248
emb|CCE33245.1|  related to cell division control protein CDC91       60.5    2e-07   Claviceps purpurea 20.1
ref|XP_003658340.1|  hypothetical protein MYCTH_2293970               60.5    2e-07   Thermothelomyces thermophila ATCC 42464
dbj|GAM43208.1|  hypothetical protein TCE0_047f17826                  60.5    3e-07   Talaromyces cellulolyticus
ref|XP_008594694.1|  GPI transamidase subunit PIG-U                   60.1    3e-07   Beauveria bassiana ARSEF 2860
gb|KID75364.1|  cell division control protein CDC91                   59.7    4e-07   Metarhizium brunneum ARSEF 3297
gb|KGQ10733.1|  Phosphatidylinositol glycan anchor biosynthesis c...  59.7    4e-07   Beauveria bassiana D1-5
gb|KIE01311.1|  cell division control protein CDC91                   59.7    4e-07   Metarhizium majus ARSEF 297
gb|EMS21566.1|  phosphatidylinositol glycan, class U                  59.7    4e-07   Rhodotorula toruloides NP11
gb|EPS30644.1|  putative Dol-P-Man alpha-1,4-mannosyltransferase      59.7    5e-07   Penicillium oxalicum 114-2
ref|XP_002036245.1|  GM17022                                          59.7    5e-07   Drosophila sechellia
gb|EHK40316.1|  hypothetical protein TRIATDRAFT_153251                59.3    6e-07   Trichoderma atroviride IMI 206040
ref|XP_011117201.1|  hypothetical protein AOL_s00004g249              59.3    6e-07   Arthrobotrys oligospora ATCC 24927
ref|XP_007309610.1|  PIG-U-domain-containing protein                  59.3    6e-07   Stereum hirsutum FP-91666 SS1
ref|XP_002078681.1|  GD23551                                          59.3    7e-07   Drosophila simulans
ref|XP_011206645.1|  PREDICTED: phosphatidylinositol glycan ancho...  59.3    7e-07   Bactrocera dorsalis [papaya fruit fly]
emb|CDM26669.1|  GPI transamidase subunit PIG-U                       59.3    7e-07   Penicillium roqueforti FM164
gb|EGU11791.1|  putative GPI transamidase component PIG-U             58.9    8e-07   Rhodotorula toruloides ATCC 204091
gb|EPQ62783.1|  GPI transamidase subunit                              58.9    8e-07   Blumeria graminis f. sp. tritici 96224
gb|KKA22624.1|  GPI transamidase component PIG-U                      58.9    9e-07   Rasamsonia emersonii CBS 393.64
ref|XP_001962582.1|  GF15532                                          58.9    9e-07   Drosophila ananassae
ref|XP_001988060.1|  GH10958                                          58.5    1e-06   Drosophila grimshawi
gb|KHN96703.1|  GPI transamidase subunit PIG-U                        58.5    1e-06   Metarhizium album ARSEF 1941
gb|ENH84418.1|  gpi transamidase component pig-u                      58.2    1e-06   
ref|XP_007832975.1|  hypothetical protein PFICI_06203                 57.8    2e-06   Pestalotiopsis fici W106-1
ref|XP_001267202.1|  GPI transamidase component PIG-U, putative       57.8    2e-06   Aspergillus fischeri NRRL 181
gb|EHK25182.1|  hypothetical protein TRIVIDRAFT_84995                 57.8    2e-06   Trichoderma virens Gv29-8
gb|ESZ97270.1|  hypothetical protein SBOR_2344                        57.4    3e-06   Sclerotinia borealis F-4128
ref|XP_752006.2|  GPI transamidase component PIG-U                    57.4    3e-06   
ref|NP_609238.1|  phosphatidylinositol glycan anchor biosynthesis...  57.4    3e-06   
ref|XP_002088834.1|  GE18782                                          57.4    3e-06   
ref|XP_006665274.1|  GPI transamidase subunit PIG-U                   57.0    3e-06   
ref|XP_002148511.1|  GPI transamidase component PIG-U, putative       57.0    4e-06   
gb|KFX51607.1|  Phosphatidylinositol glycan anchor biosynthesis c...  57.0    4e-06   
ref|XP_011409917.1|  PREDICTED: phosphatidylinositol glycan ancho...  57.0    4e-06   
ref|XP_008483397.1|  PREDICTED: phosphatidylinositol glycan ancho...  56.6    5e-06   
ref|XP_001912355.1|  hypothetical protein                             56.2    6e-06   
dbj|GAA82739.1|  GPI transamidase component PIG-U                     56.2    6e-06   
ref|XP_002903743.1|  conserved hypothetical protein                   55.8    8e-06   
gb|KCW74160.1|  hypothetical protein EUGRSUZ_E02797                   49.7    8e-06   
ref|XP_006677772.1|  hypothetical protein BATDEDRAFT_16197            55.8    9e-06   
gb|KJJ24649.1|  GPI transamidase subunit PIG-U                        55.8    9e-06   
ref|XP_002124479.1|  PREDICTED: phosphatidylinositol glycan ancho...  55.8    9e-06   
ref|XP_001271713.1|  GPI transamidase component PIG-U, putative       55.8    9e-06   
ref|XP_002019021.1|  GL26132                                          55.8    9e-06   
ref|XP_001401633.1|  GPI transamidase component GAB1                  55.8    9e-06   
ref|XP_002132259.1|  GA25302                                          55.8    1e-05   
gb|EGE79578.1|  phosphatidylinositol glycan anchor biosynthesis c...  55.8    1e-05   
ref|XP_001352268.1|  GA12039                                          55.8    1e-05   
ref|XP_002627744.1|  GPI transamidase component PIG-U                 55.8    1e-05   
gb|EQL32575.1|  phosphatidylinositol glycan, class U                  55.5    1e-05   
ref|XP_011176713.1|  PREDICTED: phosphatidylinositol glycan ancho...  55.5    1e-05   
gb|KJK66907.1|  GPI transamidase subunit PIG-U                        55.8    1e-05   
gb|KGO53640.1|  GPI transamidase subunit PIG-U                        55.1    2e-05   
ref|XP_007399676.1|  hypothetical protein PHACADRAFT_177290           55.1    2e-05   
gb|KGO45097.1|  GPI transamidase subunit PIG-U                        55.1    2e-05   
ref|XP_002559218.1|  Pc13g07920                                       54.7    2e-05   
ref|XP_004930324.1|  PREDICTED: phosphatidylinositol glycan ancho...  54.7    2e-05   
gb|ELQ39848.1|  hypothetical protein OOU_Y34scaffold00476g8           54.7    2e-05   
ref|XP_009525213.1|  hypothetical protein PHYSODRAFT_314121           54.7    3e-05   
ref|XP_011436558.1|  PREDICTED: phosphatidylinositol glycan ancho...  54.3    3e-05   
ref|XP_002947040.1|  hypothetical protein VOLCADRAFT_87261            54.7    3e-05   
gb|EEH05098.1|  phosphatidylinositol glycan anchor biosynthesis c...  53.9    4e-05   
gb|EEH41609.2|  hypothetical protein PAAG_03172                       53.9    4e-05   
gb|KDE05701.1|  hypothetical protein MVLG_03935                       53.5    5e-05   
ref|XP_011667738.1|  PREDICTED: phosphatidylinositol glycan ancho...  53.5    6e-05   
ref|XP_003656291.1|  hypothetical protein THITE_2081127               53.1    7e-05   
ref|XP_002587498.1|  hypothetical protein BRAFLDRAFT_129005           53.1    7e-05   
emb|CDK26563.1|  unnamed protein product                              53.1    8e-05   
gb|KDR16382.1|  Phosphatidylinositol glycan anchor biosynthesis c...  52.8    1e-04   
ref|XP_002052436.1|  GJ21659                                          52.0    2e-04   
gb|KFB39438.1|  AGAP008074-PA-like protein                            52.0    2e-04   
gb|EYE99700.1|  PIG-U-domain-containing protein                       52.0    2e-04   
ref|XP_009029763.1|  hypothetical protein HELRODRAFT_187585           52.0    2e-04   
ref|XP_317383.4|  AGAP008074-PA                                       52.0    2e-04   
ref|XP_001648170.1|  AAEL014183-PA                                    52.0    2e-04   
ref|XP_011138085.1|  PREDICTED: phosphatidylinositol glycan ancho...  51.6    2e-04   
gb|KGO75690.1|  GPI transamidase subunit PIG-U                        51.6    2e-04   
gb|ETI35506.1|  hypothetical protein F443_18158                       51.6    3e-04   
gb|ETP33465.1|  hypothetical protein F442_18002                       51.6    3e-04   
ref|XP_003321112.2|  hypothetical protein PGTG_02154                  50.4    3e-04   
gb|ETO64244.1|  hypothetical protein F444_18181                       51.2    4e-04   
ref|XP_011633736.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.8    4e-04   
ref|XP_011348596.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.8    5e-04   
ref|XP_011633735.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.8    5e-04   
ref|XP_002002906.1|  GI10442                                          50.4    5e-04   
ref|XP_011264669.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.4    6e-04   
ref|XP_003698413.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.4    7e-04   
ref|XP_011298181.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.1    7e-04   
ref|XP_003491062.1|  PREDICTED: phosphatidylinositol glycan ancho...  50.1    7e-04   
gb|KFD57473.1|  hypothetical protein M513_01576                       50.1    8e-04   
gb|ETK75753.1|  hypothetical protein L915_17677                       50.1    9e-04   
ref|XP_002067141.1|  GK24175                                          49.7    0.001   
ref|XP_006608989.1|  PREDICTED: phosphatidylinositol glycan ancho...  49.7    0.001   



>ref|XP_006358874.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Solanum tuberosum]
Length=462

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FWRWA AS++FRLVLIYFPKNLN ATRPEVSTPVTSLRRLAEGYWL QSSMSPYAGSMY
Sbjct  14   HFWRWAVASVIFRLVLIYFPKNLNLATRPEVSTPVTSLRRLAEGYWLTQSSMSPYAGSMY  73

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  KI+G  YHLLCSLV V+ADFISAMLI+ATG  L+ A  + LKSL
Sbjct  74   HGSPLLLSVLGPLTMKKIEGQPYHLLCSLVSVIADFISAMLIQATGLKLRMAYYERLKSL  133

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            GLGKLFE S+ILPS DIAALVYLWNP TIVTC+GFNTTP+EN+F+I+S+YGAC  +APLA
Sbjct  134  GLGKLFEISEILPSEDIAALVYLWNPLTIVTCVGFNTTPVENLFIILSLYGACIRVAPLA  193

Query  627  AFGWTVASHLS  659
            AFGW VASHLS
Sbjct  194  AFGWVVASHLS  204



>ref|XP_004245643.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Solanum lycopersicum]
Length=463

 Score =   271 bits (694),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FWRWA AS++FRLVLIYFPKNLN ATRPEVSTPVTSLRRLAEGYWL QSSMSPYAGSMY
Sbjct  15   HFWRWAVASMIFRLVLIYFPKNLNLATRPEVSTPVTSLRRLAEGYWLTQSSMSPYAGSMY  74

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  KI+G  YHLLCSLV V+ADFISAMLIRATG  L+ A  + LKSL
Sbjct  75   HGSPLLLSVLGPLTMKKIEGQPYHLLCSLVSVIADFISAMLIRATGLKLRMAYCERLKSL  134

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            GLGKLFE S+ILPS DIAALVYLWNP TIVTC+GFNTTP+EN+F+I+S+YGAC  +APLA
Sbjct  135  GLGKLFEISEILPSEDIAALVYLWNPLTIVTCVGFNTTPVENLFIILSLYGACIRVAPLA  194

Query  627  AFGWTVASHLS  659
            AFGW VASHLS
Sbjct  195  AFGWVVASHLS  205



>ref|XP_009782606.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Nicotiana sylvestris]
 ref|XP_009782607.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Nicotiana sylvestris]
 ref|XP_009782608.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X3 [Nicotiana sylvestris]
Length=464

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = +3

Query  45   MEASRkkakpkpkpQFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYW  224
            M+  +++  P  KP+FWRW  ASI+FRLVLIYFP+NLN ATRPEVSTPVTSLRRLAEGYW
Sbjct  1    MKEEKQQNIPTKKPRFWRWTVASIIFRLVLIYFPQNLNLATRPEVSTPVTSLRRLAEGYW  60

Query  225  LKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATG  404
            L QSSMSPYAGSMYHGSPLLL+ LGPLT  KI+G  +HLLCSLV V+ADFI AMLIRATG
Sbjct  61   LTQSSMSPYAGSMYHGSPLLLSVLGPLTMKKIEGQPFHLLCSLVSVIADFICAMLIRATG  120

Query  405  QSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVI  584
              L+ A  + LK LGLGKLFE S+ILPS DIAALVYLWNPFTIVTC+GFNTTP+EN+F+I
Sbjct  121  LKLRMAYCERLKLLGLGKLFEVSEILPSEDIAALVYLWNPFTIVTCVGFNTTPVENLFII  180

Query  585  ISIYGACKGLAPLAAFGWTVASHLS  659
            +S+YGAC  +APLAAFGW +ASHLS
Sbjct  181  LSLYGACIRVAPLAAFGWVIASHLS  205



>gb|EYU29835.1| hypothetical protein MIMGU_mgv1a005883mg [Erythranthe guttata]
Length=466

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  45   MEASRkkakpkpkpQFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYW  224
            ME   K    + K  FW+WA ASIV RL+L YF K LN ++RPEVSTP+TSLRRLAEGYW
Sbjct  1    MEEKTKAGSKRTKLGFWKWAIASIVLRLILSYFSKYLNLSSRPEVSTPLTSLRRLAEGYW  60

Query  225  LKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATG  404
            LKQ S+SPY+GSMYHGSPLLL+ LGPLT  KI+GH+ HLLCSLV V+ADFISA+LIRATG
Sbjct  61   LKQLSISPYSGSMYHGSPLLLSILGPLTAKKIEGHASHLLCSLVSVIADFISAILIRATG  120

Query  405  QSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVI  584
              L  A   SLK+LGL KLF+D++ILPSGDIAALVYLWNPFTI++C+GFNT+P+EN+FVI
Sbjct  121  HILVTAHGHSLKALGLDKLFKDTEILPSGDIAALVYLWNPFTIISCIGFNTSPIENLFVI  180

Query  585  ISIYGACKGLAPLAAFGWTVASHLS  659
            +S+YGA  GL PLAAFGW +ASHLS
Sbjct  181  LSLYGASAGLVPLAAFGWVIASHLS  205



>ref|XP_008373833.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X4 [Malus domestica]
Length=395

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W AAS++FRLVLIYFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  20   FWTWLAASVLFRLVLIYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMYH  79

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SLK L 
Sbjct  80   GSPLLLSLLGPLTVKRIEGQPNHLLCSLVFVVADILNAMLIRATGQTLQVAYRQSLKXLD  139

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  + E S++LPSGDIAALVYLWNP TIV C+G +T+P+EN  +I++++GACK L PL A
Sbjct  140  LVTISESSEVLPSGDIAALVYLWNPLTIVACVGLSTSPIENFAIILALFGACKRLVPLXA  199

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  200  FGWVMATHLS  209



>ref|XP_008373831.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Malus domestica]
Length=417

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W AAS++FRLVLIYFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  20   FWTWLAASVLFRLVLIYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMYH  79

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SLK L 
Sbjct  80   GSPLLLSLLGPLTVKRIEGQPNHLLCSLVFVVADILNAMLIRATGQTLQVAYRQSLKXLD  139

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  + E S++LPSGDIAALVYLWNP TIV C+G +T+P+EN  +I++++GACK L PL A
Sbjct  140  LVTISESSEVLPSGDIAALVYLWNPLTIVACVGLSTSPIENFAIILALFGACKRLVPLXA  199

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  200  FGWVMATHLS  209



>ref|XP_008238817.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Prunus mume]
Length=478

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW W AAS++FRL+LIYFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMY
Sbjct  18   RFWTWVAASVLFRLILIYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMY  77

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SLKSL
Sbjct  78   HGSPLLLSLLGPLTVKRIEGQPSHLLCSLVFVVADILNAMLIRATGQTLQVAYRQSLKSL  137

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L  + E  ++L SGDIAALVYLWNPFTIV C+G +T+P+EN+ +I+++YGACK + PLA
Sbjct  138  DLDMISESMEVLSSGDIAALVYLWNPFTIVACVGLSTSPIENLAIILALYGACKRMVPLA  197

Query  627  AFGWTVASHLS  659
            AFGW +A+HLS
Sbjct  198  AFGWVMATHLS  208



>emb|CDP09802.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 2/190 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW+WA AS++FRL+LIYFP NLN A+RPEVSTP+TSLRRLAEGYWLKQ SMSPYAGSMYH
Sbjct  27   FWKWAIASVIFRLILIYFPGNLNLASRPEVSTPLTSLRRLAEGYWLKQLSMSPYAGSMYH  86

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   +L+CSLV VVADF SAMLIR  GQ L  A  ++L+SLG
Sbjct  87   GSPLLLSVLGPLTVKRIEGQPNYLICSLVSVVADFTSAMLIRQIGQRLLAAYGQNLRSLG  146

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L +LFE S  LPSGD+AALVYLWNPFTIVTC+G+NTTP+EN+F+I+S+YGAC G+AP+AA
Sbjct  147  LAELFEGS--LPSGDVAALVYLWNPFTIVTCLGYNTTPIENLFIILSLYGACTGIAPVAA  204

Query  630  FGWTVASHLS  659
            FGW VA+HLS
Sbjct  205  FGWVVATHLS  214



>ref|XP_008369470.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Malus domestica]
Length=481

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW WAAAS++FRLVLIY PKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  22   FWTWAAASVLFRLVLIYXPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMYH  81

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  + +G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SLKSL 
Sbjct  82   GSPLLLSLLGPLTVKRXEGQPNHLLCSLVYVVADVLNAMLIRATGQTLQVAYRQSLKSLD  141

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L    E  ++LPSGDIAALVYLWNPFTIV C+G +T+P+EN  +I+++YGACK L PLAA
Sbjct  142  LDTTLESIEVLPSGDIAALVYLWNPFTIVACVGLSTSPIENFAIILALYGACKRLVPLAA  201

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  202  FGWVIATHLS  211



>ref|XP_008373830.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Malus domestica]
Length=479

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W AAS++FRLVLIYFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  20   FWTWLAASVLFRLVLIYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMYH  79

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SLK L 
Sbjct  80   GSPLLLSLLGPLTVKRIEGQPNHLLCSLVFVVADILNAMLIRATGQTLQVAYRQSLKXLD  139

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  + E S++LPSGDIAALVYLWNP TIV C+G +T+P+EN  +I++++GACK L PL A
Sbjct  140  LVTISESSEVLPSGDIAALVYLWNPLTIVACVGLSTSPIENFAIILALFGACKRLVPLXA  199

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  200  FGWVMATHLS  209



>ref|XP_007209980.1| hypothetical protein PRUPE_ppa005072mg [Prunus persica]
 gb|EMJ11179.1| hypothetical protein PRUPE_ppa005072mg [Prunus persica]
Length=478

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW W AAS++FRL+LIYFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMY
Sbjct  18   RFWTWVAASVLFRLILIYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMY  77

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G   HLLCSLV VVAD ++AM+IRATGQ+LQ A  +SLKSL
Sbjct  78   HGSPLLLSLLGPLTVKRIEGQPSHLLCSLVFVVADILNAMVIRATGQTLQVAYRQSLKSL  137

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L  + E  ++L SGDIAALVYLWNPFTIV C+G +T+P+EN+ +I+++YGACK + PLA
Sbjct  138  DLDTISESMEVLSSGDIAALVYLWNPFTIVACVGLSTSPIENLAIILALYGACKRMVPLA  197

Query  627  AFGWTVASHLS  659
            AFGW +A+HLS
Sbjct  198  AFGWVMATHLS  208



>ref|XP_011072194.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Sesamum indicum]
Length=469

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW+WA AS++FRL+L YF KNLN ++RPEVSTP+TSLRRLAEGYWLK+ SMSPY+GSMYH
Sbjct  16   FWKWAIASVIFRLILSYFSKNLNLSSRPEVSTPLTSLRRLAEGYWLKRLSMSPYSGSMYH  75

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT   I G   HLLCSLV V AD IS++LIRATG SL RA   +LKSLG
Sbjct  76   GSPLLLSILGPLTVKTIGGQPSHLLCSLVSVFADLISSILIRATGHSLVRAHVHNLKSLG  135

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KLF+D +ILPSGDIAALVYLWNPFTIV+C+GFNT+P+EN+FVI+S+YGA  GL PLAA
Sbjct  136  LDKLFKDIEILPSGDIAALVYLWNPFTIVSCVGFNTSPIENLFVILSLYGASAGLIPLAA  195

Query  630  FGWTVASHLS  659
            FGW +ASHLS
Sbjct  196  FGWVIASHLS  205



>ref|XP_006477405.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Citrus sinensis]
Length=504

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS++FRL+LIYFPKNLNF++RPEV+TPVTS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  44   FWVWVTASVIFRLILIYFPKNLNFSSRPEVATPVTSIRRLAEGYWLKQSSMSPYAGSMYH  103

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ +GPLT  +I+G   HLLCSL+  +AD +SAMLIRATGQ+LQ +S  SLKSL 
Sbjct  104  GSPLLLSLIGPLTVKRIEGQPNHLLCSLLFSLADVVSAMLIRATGQTLQMSSCLSLKSLD  163

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L +L ++S++L SGDIAALVYLWNPFTIV C+G +T+P+EN+ VI+S+YGAC  LAPLAA
Sbjct  164  LVELSKNSEMLSSGDIAALVYLWNPFTIVACVGLSTSPIENLVVILSLYGACTRLAPLAA  223

Query  630  FGWTVASHLS  659
            FGW + +HLS
Sbjct  224  FGWVMGTHLS  233



>gb|KCW72094.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=419

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW  AS+ FRL L+Y P+NL  +TRPEV+TP+TS+RRLAEGYWLKQS+MSPYAGSMYH
Sbjct  36   FWRWLVASVAFRLALVYLPRNLRLSTRPEVATPLTSIRRLAEGYWLKQSAMSPYAGSMYH  95

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPL   +I+G   HLLCSL+LV+AD ++AMLIRA GQSLQ+A  + L+SL 
Sbjct  96   GSPLLLLVLGPLAVKRIEGQPEHLLCSLLLVIADILNAMLIRAIGQSLQKAYAQHLESLD  155

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S +LPSGDIAALVYLWNPFTIV C+G +T+P+EN+ ++++++GACKGL PLAA
Sbjct  156  LFNLSEESGMLPSGDIAALVYLWNPFTIVACVGLSTSPIENLAILLALFGACKGLVPLAA  215

Query  630  FGWTVASHLS  659
            FGW +A+H+S
Sbjct  216  FGWVLATHMS  225



>ref|XP_002276721.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Vitis vinifera]
 emb|CBI34718.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW WA AS++FRLVLI+F +NLN A+RPEVSTP+TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  19   FWTWALASVIFRLVLIHFSRNLNLASRPEVSTPLTSLRRLAEGYWLKQSSISPYAGSMYH  78

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  + +G   HL+CSL+ V+ADF++A+LIRATGQSLQ A  +SLKSLG
Sbjct  79   GSPLLLSILGPLTVQRGEGQYNHLICSLLFVIADFMTAVLIRATGQSLQMAYNQSLKSLG  138

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            + +L E S++L SGDIAALVYLWNP TIVTC+G +T+P+EN+FV++S+YGAC+ L PLAA
Sbjct  139  IVRLLERSEMLSSGDIAALVYLWNPLTIVTCVGSSTSPIENLFVVLSLYGACRRLVPLAA  198

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  199  FGWVIATHLS  208



>gb|KCW72093.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=466

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW  AS+ FRL L+Y P+NL  +TRPEV+TP+TS+RRLAEGYWLKQS+MSPYAGSMYH
Sbjct  36   FWRWLVASVAFRLALVYLPRNLRLSTRPEVATPLTSIRRLAEGYWLKQSAMSPYAGSMYH  95

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPL   +I+G   HLLCSL+LV+AD ++AMLIRA GQSLQ+A  + L+SL 
Sbjct  96   GSPLLLLVLGPLAVKRIEGQPEHLLCSLLLVIADILNAMLIRAIGQSLQKAYAQHLESLD  155

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S +LPSGDIAALVYLWNPFTIV C+G +T+P+EN+ ++++++GACKGL PLAA
Sbjct  156  LFNLSEESGMLPSGDIAALVYLWNPFTIVACVGLSTSPIENLAILLALFGACKGLVPLAA  215

Query  630  FGWTVASHLS  659
            FGW +A+H+S
Sbjct  216  FGWVLATHMS  225



>ref|XP_010055599.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Eucalyptus grandis]
 gb|KCW72092.1| hypothetical protein EUGRSUZ_E00536 [Eucalyptus grandis]
Length=496

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW  AS+ FRL L+Y P+NL  +TRPEV+TP+TS+RRLAEGYWLKQS+MSPYAGSMYH
Sbjct  36   FWRWLVASVAFRLALVYLPRNLRLSTRPEVATPLTSIRRLAEGYWLKQSAMSPYAGSMYH  95

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPL   +I+G   HLLCSL+LV+AD ++AMLIRA GQSLQ+A  + L+SL 
Sbjct  96   GSPLLLLVLGPLAVKRIEGQPEHLLCSLLLVIADILNAMLIRAIGQSLQKAYAQHLESLD  155

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S +LPSGDIAALVYLWNPFTIV C+G +T+P+EN+ ++++++GACKGL PLAA
Sbjct  156  LFNLSEESGMLPSGDIAALVYLWNPFTIVACVGLSTSPIENLAILLALFGACKGLVPLAA  215

Query  630  FGWTVASHLS  659
            FGW +A+H+S
Sbjct  216  FGWVLATHMS  225



>ref|XP_012086988.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Jatropha curcas]
 ref|XP_012086989.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Jatropha curcas]
Length=489

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 159/190 (84%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW   S++ RL LI F +NLN ++RPEVSTP+TSLRRLAEGYWLKQ SMSPYAGSMYH
Sbjct  21   FWRWTFCSVILRLFLISFSRNLNLSSRPEVSTPLTSLRRLAEGYWLKQLSMSPYAGSMYH  80

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   H+LCSL+ V+AD ISAMLIRATG  LQ +  +SLK+L 
Sbjct  81   GSPLLLSLLGPLTVKRIEGQPDHVLCSLLFVIADIISAMLIRATGWKLQMSYRQSLKALD  140

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            +  + E+SD+LPSGDIAALVYLWNPFTIV C+G +T+P+EN+FV++++YGAC GL PLAA
Sbjct  141  IVNVLENSDLLPSGDIAALVYLWNPFTIVACVGLSTSPIENLFVVLTLYGACTGLVPLAA  200

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  201  FGWVMATHLS  210



>ref|XP_009344269.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol glycan anchor 
biosynthesis class U protein-like [Pyrus x bretschneideri]
Length=485

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 161/194 (83%), Gaps = 5/194 (3%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYF----PKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAG  257
            FW WAAAS++FRLVLIYF    PKNLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAG
Sbjct  22   FWTWAAASVLFRLVLIYFQKSQPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAG  81

Query  258  SMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEksl  437
            SMYHGSPLLL+ LGP+T  +I+G   HLLCSLV VVAD ++AMLIRATGQ+LQ A  +SL
Sbjct  82   SMYHGSPLLLSLLGPVTVKRIEGQPNHLLCSLVYVVADILNAMLIRATGQTLQVAYRQSL  141

Query  438  kslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLA  617
            KSL L    E  ++LPSGDIAALVY WNPFT+V C+G +T+P+EN  +I+++YGACK L 
Sbjct  142  KSLDLDTTLESIEVLPSGDIAALVYPWNPFTMVACVGLSTSPIENFAIILALYGACKSLV  201

Query  618  PLAAFGWTVASHLS  659
            PLAAFGW + +HLS
Sbjct  202  PLAAFGWVI-THLS  214



>ref|XP_004298744.2| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Fragaria vesca subsp. vesca]
Length=473

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW W  AS++FRL+LIYFP+NLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMY
Sbjct  14   RFWTWLTASVLFRLILIYFPQNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMY  73

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +IDG   HLLC LV V AD ++++LIRATGQ+LQ A  +SLKSL
Sbjct  74   HGSPLLLSLLGPLTVQRIDGLPSHLLCGLVFVAADVLNSLLIRATGQTLQIAYRQSLKSL  133

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L  + E  + LPSGDIAAL+YLWNPFTI  C+G +T+P+EN+ +++++YGACK L PLA
Sbjct  134  DLDMISETMETLPSGDIAALIYLWNPFTIAACVGLSTSPIENLAIMLALYGACKRLVPLA  193

Query  627  AFGWTVASHLS  659
            AFGW +A+HLS
Sbjct  194  AFGWVMATHLS  204



>ref|XP_002509716.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51103.1| conserved hypothetical protein [Ricinus communis]
Length=490

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +3

Query  93   WRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHg  272
            W+W A++++ RL+LIYF +NLN ++RPEVSTP+TSLRRLAEGYWLKQ S+SPYAGSMYHG
Sbjct  26   WKWIASALILRLILIYFSQNLNLSSRPEVSTPLTSLRRLAEGYWLKQLSISPYAGSMYHG  85

Query  273  splllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslgl  452
            SPLLL+ LGPL   +I+G   H+LCSL+ V+ADFISAMLIRATG+ LQ+A  +SL+SL +
Sbjct  86   SPLLLSVLGPLYVKRIEGQPNHVLCSLLFVIADFISAMLIRATGRKLQKAYRQSLESLDI  145

Query  453  gklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF  632
              + E SD++PSGDIAALVYLWNPFTIV C+G +T+P+EN+FVI+++YGAC  L PLAAF
Sbjct  146  VNIPETSDMIPSGDIAALVYLWNPFTIVACVGLSTSPIENLFVILTLYGACIRLVPLAAF  205

Query  633  GWTVASHLS  659
            GW +A+HLS
Sbjct  206  GWVMATHLS  214



>gb|KEH31711.1| GPI transamidase subunit PIG-U [Medicago truncatula]
Length=480

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S++ RL++IYFPKNLN ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  20   FWSWVIGSVILRLIIIYFPKNLNLSSRPEVSTPLTSIRRLAEGYWLKQSSMSPYAGSMYH  79

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD ++AMLI A G+ LQ A   SL+S+G
Sbjct  80   GSPLLLTLLGPLTVKRIEGQPDHLLCSLVFVIADVVTAMLICAAGKKLQAAYSSSLQSIG  139

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L EDSDILPSGD AAL+YLWNPFTIV C+G +T+ +EN+ V++++YGAC  LAPLAA
Sbjct  140  LHHLSEDSDILPSGDFAALLYLWNPFTIVACVGLSTSAIENLMVVVTLYGACARLAPLAA  199

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  200  FGWVMATHLS  209



>gb|KEH31710.1| GPI transamidase subunit PIG-U [Medicago truncatula]
Length=478

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S++ RL++IYFPKNLN ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  20   FWSWVIGSVILRLIIIYFPKNLNLSSRPEVSTPLTSIRRLAEGYWLKQSSMSPYAGSMYH  79

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD ++AMLI A G+ LQ A   SL+S+G
Sbjct  80   GSPLLLTLLGPLTVKRIEGQPDHLLCSLVFVIADVVTAMLICAAGKKLQAAYSSSLQSIG  139

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L EDSDILPSGD AAL+YLWNPFTIV C+G +T+ +EN+ V++++YGAC  LAPLAA
Sbjct  140  LHHLSEDSDILPSGDFAALLYLWNPFTIVACVGLSTSAIENLMVVVTLYGACARLAPLAA  199

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  200  FGWVMATHLS  209



>ref|XP_007155557.1| hypothetical protein PHAVU_003G211900g [Phaseolus vulgaris]
 gb|ESW27551.1| hypothetical protein PHAVU_003G211900g [Phaseolus vulgaris]
Length=469

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S+V RL+L+YFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  10   FWTWVLGSVVLRLILLYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSISPYAGSMYH  69

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD +SAMLI A G+ LQ A   SL+ LG
Sbjct  70   GSPLLLTLLGPLTVTRIEGQPDHLLCSLVFVIADVVSAMLICAVGEKLQVAYSSSLQLLG  129

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S++LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAPLAA
Sbjct  130  LRDLSENSELLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACSRLAPLAA  189

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  190  FGWVMATHLS  199



>ref|XP_010278563.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Nelumbo nucifera]
Length=463

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S+ FRLVLIYFP+NLN   RPEV+TP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  7    FWVWVITSLFFRLVLIYFPENLNLGFRPEVATPLTSLRRLAEGYWLKQSSMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSP+LL+ LGPLT  +I+G   HL+CSL+ VVAD ++AMLIRATGQ+LQ A  +SL+SL 
Sbjct  67   GSPMLLSILGPLTVKRIEGQPSHLMCSLLFVVADLVTAMLIRATGQTLQLAYSQSLRSLN  126

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E S+ L +GDIAALVYLWNP TI+TC+G +T+P+EN+ +++S+YGAC  +APLAA
Sbjct  127  LVSLLESSETLSAGDIAALVYLWNPLTIITCVGSSTSPIENLLIVLSLYGACLRIAPLAA  186

Query  630  FGWTVASHLS  659
            FGW +A HLS
Sbjct  187  FGWVLAMHLS  196



>ref|XP_004515803.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Cicer arietinum]
Length=475

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S++ RL+LIYFPKNLN ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  15   FWTWIFGSVILRLILIYFPKNLNLSSRPEVSTPLTSIRRLAEGYWLKQSSMSPYAGSMYH  74

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD ++AMLI A G+ LQ A   SL+ +G
Sbjct  75   GSPLLLTLLGPLTVTRIEGQPDHLLCSLVFVMADVVAAMLICAAGKKLQAAYSSSLQFIG  134

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+SD+LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAP+AA
Sbjct  135  LHHLLENSDVLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACARLAPVAA  194

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  195  FGWVMATHLS  204



>ref|XP_004515804.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Cicer arietinum]
Length=475

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S++ RL+LIYFPKNLN ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  15   FWTWIFGSVILRLILIYFPKNLNLSSRPEVSTPLTSIRRLAEGYWLKQSSMSPYAGSMYH  74

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD ++AMLI A G+ LQ A   SL+ +G
Sbjct  75   GSPLLLTLLGPLTVTRIEGQPDHLLCSLVFVMADVVAAMLICAAGKKLQAAYSSSLQFIG  134

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+SD+LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAP+AA
Sbjct  135  LHHLLENSDVLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACARLAPVAA  194

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  195  FGWVMATHLS  204



>gb|KDO63549.1| hypothetical protein CISIN_1g0117601mg, partial [Citrus sinensis]
Length=190

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS++FRL+LIYFPKNLNF++RPEV+TPVTS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  18   FWVWVTASVIFRLILIYFPKNLNFSSRPEVATPVTSIRRLAEGYWLKQSSMSPYAGSMYH  77

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ +GPLT  +I+G   HLLCSL+  +AD +SAMLIRATGQ+LQ +S  SLKSL 
Sbjct  78   GSPLLLSLIGPLTVKRIEGQPNHLLCSLLFSLADVVSAMLIRATGQTLQMSSCLSLKSLD  137

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGAC  605
            L +L ++S++L SGDIAALVYLWNPFTIV C+G +T+P+EN+ VI+S+YGAC
Sbjct  138  LVELSKNSEMLSSGDIAALVYLWNPFTIVACVGLSTSPIENLVVILSLYGAC  189



>ref|XP_010278562.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Nelumbo nucifera]
Length=478

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S+ FRLVLIYFP+NLN   RPEV+TP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  7    FWVWVITSLFFRLVLIYFPENLNLGFRPEVATPLTSLRRLAEGYWLKQSSMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSP+LL+ LGPLT  +I+G   HL+CSL+ VVAD ++AMLIRATGQ+LQ A  +SL+SL 
Sbjct  67   GSPMLLSILGPLTVKRIEGQPSHLMCSLLFVVADLVTAMLIRATGQTLQLAYSQSLRSLN  126

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E S+ L +GDIAALVYLWNP TI+TC+G +T+P+EN+ +++S+YGAC  +APLAA
Sbjct  127  LVSLLESSETLSAGDIAALVYLWNPLTIITCVGSSTSPIENLLIVLSLYGACLRIAPLAA  186

Query  630  FGWTVASHLS  659
            FGW +A HLS
Sbjct  187  FGWVLAMHLS  196



>ref|XP_006440549.1| hypothetical protein CICLE_v10019953mg [Citrus clementina]
 gb|ESR53789.1| hypothetical protein CICLE_v10019953mg [Citrus clementina]
Length=478

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS++FRL+LIYFPKNLNF++RPEV+TPVTS+RRLAEGYWLKQSSMSPYAGSMYH
Sbjct  18   FWVWVTASVIFRLILIYFPKNLNFSSRPEVATPVTSIRRLAEGYWLKQSSMSPYAGSMYH  77

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ +GPLT  +I+G   HLLCSL+ ++AD +SAMLIRATGQ+LQ +S  SLKSL 
Sbjct  78   GSPLLLSLIGPLTVKRIEGQPNHLLCSLLFLLADVVSAMLIRATGQTLQMSSCLSLKSLD  137

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L +L ++S++L SGDIAALVYLWNPFTIV C+G +T+P+EN+ VI+S+YGAC  L PLAA
Sbjct  138  LVELSKNSEMLSSGDIAALVYLWNPFTIVACVGLSTSPIENLVVILSLYGACTRLPPLAA  197

Query  630  FGWTVASHLS  659
            FGW + +HLS
Sbjct  198  FGWVMGTHLS  207



>ref|XP_007042808.1| GPI transamidase subunit PIG-U isoform 3 [Theobroma cacao]
 gb|EOX98639.1| GPI transamidase subunit PIG-U isoform 3 [Theobroma cacao]
Length=462

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  ASI+FRL+LIYFPKNLN A+RPEVSTP+TS RRLAEGYWLKQ SMSPYAGSMYH
Sbjct  16   FWNWVIASIIFRLILIYFPKNLNLASRPEVSTPLTSFRRLAEGYWLKQLSMSPYAGSMYH  75

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLL SLV V+AD +SA+LIRATG++L+ A  +SL+SL 
Sbjct  76   GSPLLLSLLGPLTVKRIEGQPNHLLYSLVSVIADVVSAILIRATGKNLRLAYLRSLESLD  135

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            + +  + S+IL  GD AAL+YLWNPFTIV C+G +T+P+ENM VI+ +YGAC  L PLAA
Sbjct  136  IVQQTKASEILSPGDAAALIYLWNPFTIVACVGLSTSPIENMAVILCLYGACSRLVPLAA  195

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  196  FGWVIATHLS  205



>ref|XP_003550876.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Glycine max]
 gb|KHN14116.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Glycine soja]
Length=468

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W   S+V RL+L++FPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  9    FWTWVLGSVVLRLILLFFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSLSPYAGSMYH  68

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD +SAMLI A G+ L+ A   SL+SLG
Sbjct  69   GSPLLLTLLGPLTVRRIEGQPDHLLCSLVFVIADVVSAMLICAAGEKLKVAYISSLQSLG  128

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S+ LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAPLAA
Sbjct  129  LHNLTENSEFLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACSRLAPLAA  188

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  189  FGWVMATHLS  198



>gb|KJB12323.1| hypothetical protein B456_002G011900 [Gossypium raimondii]
Length=459

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  ASI+FRL+LIYFPKNLN ++RPEVSTP+TS RRLAEGYWLKQSSMS YAGSMYH
Sbjct  13   FWNWVIASIIFRLILIYFPKNLNLSSRPEVSTPLTSFRRLAEGYWLKQSSMSSYAGSMYH  72

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLL SLV V+AD +SAMLIRATGQ+L+ A  +SL+SL 
Sbjct  73   GSPLLLSLLGPLTVKRIEGQPNHLLYSLVSVIADVVSAMLIRATGQNLRLAYLRSLESLD  132

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L K  + S+ L SGDIAAL+YL NPFTIV C+G +T+P+ENM VI+ +YGAC  L PLAA
Sbjct  133  LVKQIDVSEFLCSGDIAALIYLCNPFTIVACVGLSTSPIENMAVILCLYGACSRLIPLAA  192

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  193  FGWVIATHLS  202



>gb|KHN34428.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Glycine soja]
Length=468

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW     SIV RL+L+YFPKNLN ++RPEVSTP+TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  9    FWTCVLGSIVLRLILLYFPKNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSVSPYAGSMYH  68

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +I+G   HLLCSLV V+AD +SAMLI A G+ L+ A   SL+SLG
Sbjct  69   GSPLLLTLLGPLTVKRIEGQPDHLLCSLVFVIADVVSAMLICAAGEKLKVACSSSLQSLG  128

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L  L E+S+ LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAPLAA
Sbjct  129  LHNLSENSERLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACSRLAPLAA  188

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  189  FGWVMATHLS  198



>ref|XP_007042806.1| GPI transamidase subunit PIG-U isoform 1 [Theobroma cacao]
 gb|EOX98637.1| GPI transamidase subunit PIG-U isoform 1 [Theobroma cacao]
Length=466

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 148/194 (76%), Gaps = 4/194 (2%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  ASI+FRL+LIYFPKNLN A+RPEVSTP+TS RRLAEGYWLKQ SMSPYAGSMYH
Sbjct  16   FWNWVIASIIFRLILIYFPKNLNLASRPEVSTPLTSFRRLAEGYWLKQLSMSPYAGSMYH  75

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQ----RASEksl  437
            GSPLLL+ LGPLT  +I+G   HLL SLV V+AD +SA+LIRATG++L+    R+ E   
Sbjct  76   GSPLLLSLLGPLTVKRIEGQPNHLLYSLVSVIADVVSAILIRATGKNLRLAYLRSLESLD  135

Query  438  kslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLA  617
                     E   IL  GD AAL+YLWNPFTIV C+G +T+P+ENM VI+ +YGAC  L 
Sbjct  136  IVQQTKASGEFFKILSPGDAAALIYLWNPFTIVACVGLSTSPIENMAVILCLYGACSRLV  195

Query  618  PLAAFGWTVASHLS  659
            PLAAFGW +A+HLS
Sbjct  196  PLAAFGWVIATHLS  209



>ref|XP_002299558.1| hypothetical protein POPTR_0001s08870g [Populus trichocarpa]
 gb|EEE84363.1| hypothetical protein POPTR_0001s08870g [Populus trichocarpa]
Length=467

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW  AS++ RL+LIY PK  N A+RPEVSTP+ SLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  9    FWRWLIASVMLRLILIYLPKTFNLASRPEVSTPLVSLRRLAEGYWLKQSSISPYAGSMYH  68

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLLCSLV V+AD ISA+LIRATG +LQ A  +SL SL 
Sbjct  69   GSPLLLSLLGPLTVKRIEGQPNHLLCSLVFVIADIISALLIRATGHTLQMAYRQSLNSLD  128

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            +  L + SD+L SGDIAALVYLWNPFTI  C+G +T+P+EN+ VI++++GACKGL PLAA
Sbjct  129  IVDLLKSSDLLSSGDIAALVYLWNPFTIAACVGLSTSPVENLVVILALHGACKGLVPLAA  188

Query  630  FGWTVASHLS  659
            FGW +++HLS
Sbjct  189  FGWVMSTHLS  198



>ref|XP_011029199.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Populus euphratica]
Length=466

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW  AS++ RL+LIY PK  N A+RPEVSTP+ SLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  8    FWRWLIASVMLRLILIYLPKTFNLASRPEVSTPLVSLRRLAEGYWLKQSSISPYAGSMYH  67

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   HLLCSLV V+AD ISA+LIRATG +LQ A  +SL SL 
Sbjct  68   GSPLLLSLLGPLTVKRIEGQPNHLLCSLVFVIADIISALLIRATGHTLQMAYRQSLNSLD  127

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            +  L + SD+L SGDIAALVYLWNPFTI  C+G +T+P+EN+ VI++++GACKGL PLAA
Sbjct  128  IVDLLKSSDLLSSGDIAALVYLWNPFTIAACVGLSTSPVENLVVILALHGACKGLVPLAA  187

Query  630  FGWTVASHLS  659
            FGW +++HLS
Sbjct  188  FGWVMSTHLS  197



>ref|NP_850969.2| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AEE34055.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=469

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +SI FRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  12   RFWIWALSSIAFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  71

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+RA GQ LQ A   + + L
Sbjct  72   HGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRAIGQKLQMAYGLNARLL  131

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+EN+ VI++++GA     PLA
Sbjct  132  GFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALFGAVTRRVPLA  191

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  192  AFGLVIATHLS  202



>ref|XP_010473541.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=468

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA+AS+VFRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  11   RFWIWASASVVFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  70

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT   I G   HLLCSLV V+AD +SAML+R  GQ LQ A   + + L
Sbjct  71   HGSPLLLSILGPLTVQSIKGQPSHLLCSLVFVIADILSAMLLRGIGQKLQMAYGLNARLL  130

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+EN+ V+++++GA     PLA
Sbjct  131  GFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVVLALFGAVTRRVPLA  190

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  191  AFGFVMATHLS  201



>ref|XP_010430394.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=468

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA+AS+VFRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  11   RFWIWASASVVFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  70

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+R  GQ LQ A   + + L
Sbjct  71   HGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRGIGQKLQMAYGLNARLL  130

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+E + VI++++GA     PLA
Sbjct  131  GFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIETLAVILALFGAVTRRVPLA  190

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  191  AFGFVMATHLS  201



>ref|XP_010418322.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=465

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 150/191 (79%), Gaps = 3/191 (2%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA+AS+VFRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  11   RFWIWASASVVFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  70

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+R  GQ LQ A      + 
Sbjct  71   HGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRGIGQKLQMA---YGLNA  127

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L   F D  ILP GDIAALVY WNPFTIV+C+G +T+P+EN+ VI++++GA     PLA
Sbjct  128  RLLGFFMDKVILPCGDIAALVYFWNPFTIVSCVGLSTSPIENLAVILALFGAVTRRVPLA  187

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  188  AFGFVMATHLS  198



>ref|XP_002887978.1| hypothetical protein ARALYDRAFT_475037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64237.1| hypothetical protein ARALYDRAFT_475037 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +S+ FRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  10   RFWIWALSSVAFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  69

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+R  GQ LQ A   + + L
Sbjct  70   HGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRGIGQKLQMAYGLNARLL  129

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+EN+ VI++++GA     PLA
Sbjct  130  GFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALFGAVTRRVPLA  189

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  190  AFGLVIATHLS  200



>ref|XP_010545955.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Tarenaya hassleriana]
Length=469

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 152/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA AS++FRL+LI F +NLN ++RPEVSTP+TSLRRLAEGYWLKQSSMSPYAGSMY
Sbjct  10   RFWIWAMASVIFRLILILFQENLNLSSRPEVSTPLTSLRRLAEGYWLKQSSMSPYAGSMY  69

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G   H+LCSLV V+AD  SA+L+RATGQ LQ A   + + L
Sbjct  70   HGSPLLLSVLGPLTVKRIEGLPNHVLCSLVFVIADIFSALLLRATGQKLQMAYGMNSRLL  129

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            GL K   D  ILP GDIAA +YLWNPFTI +C+G +T+P+EN+ VI+S+YGA     PLA
Sbjct  130  GLLKSSRDRGILPCGDIAAFMYLWNPFTIFSCVGLSTSPIENLAVILSLYGAVTRRVPLA  189

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  190  AFGLVMATHLS  200



>ref|NP_563912.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AAK44067.1|AF370252_1 unknown protein [Arabidopsis thaliana]
 gb|AAL34242.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28917.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=474

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS +FRL LI+ P N+N ++RPEVSTP TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  19   FWIWTLASTIFRLFLIFSPANINLSSRPEVSTPHTSLRRLAEGYWLKQSSLSPYAGSMYH  78

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G S H LCSLV V+AD +SA+L+RA GQ LQ++   +L+ LG
Sbjct  79   GSPLLLSILGPLTVQRIEGQSSHHLCSLVFVIADLLSALLLRAIGQKLQKSYRMNLRPLG  138

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            + +  +D  ILP GDIAALVYLWNPFTI++C+G +T+P+EN+ VI+S+YGA     PLAA
Sbjct  139  VLRSSQDRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENLAVIVSLYGAVTRRVPLAA  198

Query  630  FGWTVASHLS  659
            FG  +A+HLS
Sbjct  199  FGLIMATHLS  208



>ref|XP_006302210.1| hypothetical protein CARUB_v10020222mg [Capsella rubella]
 gb|EOA35108.1| hypothetical protein CARUB_v10020222mg [Capsella rubella]
Length=476

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA  S+ FRL+LI F  NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  11   RFWIWALTSVFFRLILISFKGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  70

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+R  GQ LQ A   + + L
Sbjct  71   HGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRGIGQKLQMAYGLNARLL  130

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+EN+ VI+++YGA     PLA
Sbjct  131  GFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALYGAVTRRVPLA  190

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  191  AFGLVMATHLS  201



>ref|XP_006307624.1| hypothetical protein CARUB_v10009259mg [Capsella rubella]
 gb|EOA40522.1| hypothetical protein CARUB_v10009259mg [Capsella rubella]
Length=419

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW WA AS + RL  I+FP+    ++RPEVSTP+TSLRRLAE YWLKQSSMSPYAGSMYH
Sbjct  23   FWIWATASAILRLFFIFFPEYFKLSSRPEVSTPLTSLRRLAEAYWLKQSSMSPYAGSMYH  82

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I GHS H LCSLV V+AD +SA+L+RA GQ L +    +LK LG
Sbjct  83   GSPLLLSILGPLTSQRIKGHSSHQLCSLVFVIADILSAVLLRAIGQKLLKTYIMNLKQLG  142

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            + +  +D  ILP GDIAALVYLWNPFTI++C+G +T+P+EN  VI+S+YGA     PLAA
Sbjct  143  VLRSSQDRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENFAVIVSLYGAVTRKIPLAA  202

Query  630  FGWTVASHLS  659
            FG+ +A+HLS
Sbjct  203  FGFIMATHLS  212



>gb|KFK40542.1| hypothetical protein AALP_AA2G009200 [Arabis alpina]
Length=477

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 150/191 (79%), Gaps = 1/191 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA  S++FRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  21   RFWIWALTSVIFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  80

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G S+ LLCSLV V+AD +SAML+R  G+ LQ A   + + L
Sbjct  81   HGSPLLLSVLGPLTVQRIQGQSF-LLCSLVFVIADILSAMLLRGIGKKLQMAYGLNARLL  139

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G  K   D  IL  GDIAALVYLWNPFTIV+C+G +T+P+EN+ VI+++YGA     PLA
Sbjct  140  GHLKSSRDKGILRCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALYGAVTRRVPLA  199

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  200  AFGLVIATHLS  210



>ref|XP_006391780.1| hypothetical protein EUTSA_v10023435mg [Eutrema salsugineum]
 gb|ESQ29066.1| hypothetical protein EUTSA_v10023435mg [Eutrema salsugineum]
Length=474

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +S+ FRL+LI FP NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  17   RFWIWALSSVFFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  76

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G    LLCSLV V+AD +SAML+R  GQ LQ A   + + L
Sbjct  77   HGSPLLLSLLGPLTVQRINGQPSLLLCSLVFVIADILSAMLLRGIGQKLQMAYGLNARLL  136

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            GL K   D  IL  GDI+ALVYLWNPFTIV+C+G +T+P+EN+ VI+++YGA     PLA
Sbjct  137  GLLKSSRDKGILRCGDISALVYLWNPFTIVSCVGLSTSPIENLAVILALYGAVTRRVPLA  196

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  197  AFGLVMATHLS  207



>ref|XP_004143931.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Cucumis sativus]
Length=462

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW W   S++FRL++IYFP NLN ++RPEV+T +TS+ RLAEGYWLKQSSMSPY GSMY
Sbjct  7    NFWIWMMLSVIFRLLMIYFP-NLNLSSRPEVATSLTSIHRLAEGYWLKQSSMSPYTGSMY  65

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G   HLLCS   VVAD +SA+LIR TGQ+LQRA  +SLK L
Sbjct  66   HGSPLLLSLLGPLTVKRIEGQPDHLLCSFAFVVADVLSALLIRGTGQNLQRAYYRSLKLL  125

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             +    + S+I P+GDIA+LVY+WNPFTIV C+G +T+P+EN+ +++++YGA KG  PLA
Sbjct  126  KVNLS-KSSEIFPAGDIASLVYVWNPFTIVACVGLSTSPIENLAIVLTLYGASKGQVPLA  184

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  185  AFGFVMATHLS  195



>ref|XP_010933542.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Elaeis guineensis]
Length=407

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W W AA+I FRL+LI FP+NLN  +RPEV+TP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  7    YWGWVAAAIAFRLLLICFPENLNLGSRPEVATPLTSLRRLAEGYWLKQSSMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  + +G   H  CSL+ V+ DF++AMLI ATGQ L     +SL+ L 
Sbjct  67   GSPLLLSILGPLTITRSEGQPAHFSCSLMFVIVDFVTAMLIHATGQKLMTKCHQSLQFLN  126

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KL E S  + +G  A+LV+LWNP TIVTC+G  TTP++N  V+++I+GAC  LAPLAA
Sbjct  127  LSKLVEASGNVDAGKFASLVFLWNPLTIVTCVGSTTTPIDNFMVVLAIFGACSRLAPLAA  186

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  187  FGWVIATHLS  196



>ref|XP_010676542.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Beta vulgaris subsp. vulgaris]
Length=477

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 158/194 (81%), Gaps = 3/194 (2%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYF-PKNLN-FATRPEVSTPVTSLRRLAEGYWLK-QSSMSPYAG  257
            +FW W  A+I+FRLVLI+F P NL+  A+RPE+STP+TSLRRLAEGYWLK Q+ +SPYAG
Sbjct  20   RFWLWTIAAIIFRLVLIFFFPHNLSQLASRPELSTPLTSLRRLAEGYWLKNQALISPYAG  79

Query  258  SMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEksl  437
            SMYHGSPLLL+ LGPLT  KIDG S H+LCSL+ V+ADFI+A+L+RATGQ LQ    +S 
Sbjct  80   SMYHGSPLLLSVLGPLTVRKIDGQSSHILCSLLFVIADFIAALLLRATGQKLQSVYLQSF  139

Query  438  kslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLA  617
            KSLGL K+ E S+I  SGDI+AL YLWNP TI+TC+G +T+P+EN  V++SIYGAC  L 
Sbjct  140  KSLGLDKILEVSEIYASGDISALFYLWNPLTILTCVGSSTSPIENFLVVLSIYGACTRLI  199

Query  618  PLAAFGWTVASHLS  659
            PLAA GW +A+H+S
Sbjct  200  PLAAVGWVLATHVS  213



>ref|XP_008437214.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Cucumis melo]
Length=463

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW W   S++FRL++IYFP NLN ++RPEV+TP+TS+ RLAEGYWLKQSSMSPY GSMY
Sbjct  7    NFWIWMMLSVIFRLLMIYFP-NLNLSSRPEVATPLTSIHRLAEGYWLKQSSMSPYTGSMY  65

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HLLCS   VVAD +SA+LIR  GQ+LQRA  +SLK L
Sbjct  66   HGSPLLLSLLGPLTVKRIKGQPDHLLCSFAFVVADVLSALLIRGIGQNLQRAYYQSLKLL  125

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             +    ++S+I P+GDIA+LVY+WNPFTIV C+G +T+P+EN+ +++++YGA KG  PLA
Sbjct  126  KVKLS-KNSEIFPAGDIASLVYVWNPFTIVACVGLSTSPIENLAIVLTLYGASKGQVPLA  184

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  185  AFGFVMATHLS  195



>ref|XP_010933540.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Elaeis guineensis]
Length=457

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W W AA+I FRL+LI FP+NLN  +RPEV+TP+TSLRRLAEGYWLKQSSMSPYAGSMYH
Sbjct  7    YWGWVAAAIAFRLLLICFPENLNLGSRPEVATPLTSLRRLAEGYWLKQSSMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  + +G   H  CSL+ V+ DF++AMLI ATGQ L     +SL+ L 
Sbjct  67   GSPLLLSILGPLTITRSEGQPAHFSCSLMFVIVDFVTAMLIHATGQKLMTKCHQSLQFLN  126

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KL E S  + +G  A+LV+LWNP TIVTC+G  TTP++N  V+++I+GAC  LAPLAA
Sbjct  127  LSKLVEASGNVDAGKFASLVFLWNPLTIVTCVGSTTTPIDNFMVVLAIFGACSRLAPLAA  186

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  187  FGWVIATHLS  196



>ref|XP_008786213.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Phoenix dactylifera]
Length=456

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W W AA+I FR++LI FPKNLN  +RPEV+TP+TSLRRLAEGYWLKQ+SMSPYAGSMYH
Sbjct  7    YWGWVAAAIAFRILLICFPKNLNLGSRPEVATPLTSLRRLAEGYWLKQASMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGP T  + +G   +  CSL+ V+ DF++AMLIRATGQ L     +SL+ L 
Sbjct  67   GSPLLLSILGPFTITRSEGQPAYFYCSLMFVIVDFVTAMLIRATGQKLMLKCHQSLQFLN  126

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KL E S  + +G+ A+LV+LWNP TIVTC+G  T P++N+  +++IYGAC  LAPLAA
Sbjct  127  LSKLVEASGNVEAGNFASLVFLWNPLTIVTCVGSTTAPIDNLMAVLAIYGACSCLAPLAA  186

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  187  FGWVIATHLS  196



>ref|XP_010458704.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=476

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 148/191 (77%), Gaps = 1/191 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLI-YFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            FW WA AS++ RL  I YFP+N   ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMY
Sbjct  20   FWIWAMASVILRLFFIFYFPENFKLSSRPEVSTPLTSVRRLAEGYWLKQSSMSPYAGSMY  79

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT   I+G S H LCSLV V AD +SA+L+RA GQ LQ+    +LK L
Sbjct  80   HGSPLLLSVLGPLTSQWIEGQSSHHLCSLVFVFADILSALLLRAIGQKLQKTYSMNLKRL  139

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G+ +   D  ILP GDIAALVYLWNP+TI++C+G +T+P+EN+ VI+S+YGA     PLA
Sbjct  140  GVLRSSGDRGILPCGDIAALVYLWNPYTILSCVGLSTSPIENLAVIVSLYGAVTRRVPLA  199

Query  627  AFGWTVASHLS  659
            AFG   A+HLS
Sbjct  200  AFGLITATHLS  210



>ref|XP_002452728.1| hypothetical protein SORBIDRAFT_04g031420 [Sorghum bicolor]
 gb|EES05704.1| hypothetical protein SORBIDRAFT_04g031420 [Sorghum bicolor]
Length=442

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            ++W  AAA++ FRLVL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+S+SPY+GSMY
Sbjct  4    RYWPMAAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASVSPYSGSMY  63

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT ++ DGH  H+ CSL+ V  DF++AMLIRATG  LQ A  +SLK L
Sbjct  64   HGSPLLLSVLGPLTNSRADGHHAHIYCSLIFVAVDFLAAMLIRATGHKLQMARSRSLKLL  123

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L K   D+  + +GD+A+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC  LAPLA
Sbjct  124  DLTKAVNDTVNVSAGDVASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGACSRLAPLA  183

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  184  AFGYVMATHLS  194



>ref|XP_007042809.1| GPI transamidase subunit PIG-U isoform 4 [Theobroma cacao]
 gb|EOX98640.1| GPI transamidase subunit PIG-U isoform 4 [Theobroma cacao]
Length=501

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 156/229 (68%), Gaps = 39/229 (17%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAG----  257
            FW W  ASI+FRL+LIYFPKNLN A+RPEVSTP+TS RRLAEGYWLKQ SMSPYAG    
Sbjct  16   FWNWVIASIIFRLILIYFPKNLNLASRPEVSTPLTSFRRLAEGYWLKQLSMSPYAGFSFC  75

Query  258  -----------------------------------SMYHgsplllaalgplTGNKIDGHS  332
                                               SMYHGSPLLL+ LGPLT  +I+G  
Sbjct  76   FFFFSLCPTFFNFFFILIRQKKEMYLIFLVFGYSGSMYHGSPLLLSLLGPLTVKRIEGQP  135

Query  333  YHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVY  512
             HLL SLV V+AD +SA+LIRATG++L+ A  +SL+SL + +  + S+IL  GD AAL+Y
Sbjct  136  NHLLYSLVSVIADVVSAILIRATGKNLRLAYLRSLESLDIVQQTKASEILSPGDAAALIY  195

Query  513  LWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            LWNPFTIV C+G +T+P+ENM VI+ +YGAC  L PLAAFGW +A+HLS
Sbjct  196  LWNPFTIVACVGLSTSPIENMAVILCLYGACSRLVPLAAFGWVIATHLS  244



>ref|XP_009113020.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Brassica rapa]
Length=477

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +S++FRL+LI F  NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  18   RFWIWALSSVLFRLILISFAGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  77

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LG LT  +I G   HL CSLV V+AD +SA+L+R  G  LQ A   + + L
Sbjct  78   HGSPLLLSLLGLLTVQRIKGQPSHLFCSLVFVIADILSAILLRGIGHKLQMAYGLNARLL  137

Query  447  glgklFEDSD-ILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
            GL K   D + ILPSGDIAALVYLWNPFTIV C+G +T+P+ENM VI+++ GA     PL
Sbjct  138  GLLKSPTDKEGILPSGDIAALVYLWNPFTIVCCVGLSTSPIENMAVILALNGAVTRRVPL  197

Query  624  AAFGWTVASHLS  659
            AAFG  +A+HLS
Sbjct  198  AAFGLVMATHLS  209



>ref|NP_001047781.1| Os02g0688900 [Oryza sativa Japonica Group]
 dbj|BAD07667.1| putative cell division control protein CDC91 [Oryza sativa Japonica 
Group]
 dbj|BAF09695.1| Os02g0688900 [Oryza sativa Japonica Group]
 dbj|BAG89816.1| unnamed protein product [Oryza sativa Japonica Group]
Length=453

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW  AAA++ FRLVL+ F  +L+ A+RPEVSTP+TS+RRLAEGYWLKQ+SMSPY+GSMY
Sbjct  5    NFWSMAAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSIRRLAEGYWLKQASMSPYSGSMY  64

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL  LGPLT  +  GH  H+ CSL+ V  DFI+AMLIRATG+ LQ A  ++LKSL
Sbjct  65   HGSPLLLLVLGPLTNKRSVGHHDHIYCSLIFVAVDFIAAMLIRATGRRLQIARNRNLKSL  124

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L +   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC  LAPLA
Sbjct  125  ELTEAVSNSVNVSAGDIASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGACSRLAPLA  184

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  185  AFGYVMATHLS  195



>emb|CDY45975.1| BnaA09g12910D [Brassica napus]
Length=477

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +S++ RL+LI F  NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  18   RFWIWALSSVLLRLILISFAGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  77

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HL CSLV V+AD +SAML+R  G  LQ A   + + L
Sbjct  78   HGSPLLLSLLGPLTVQRIKGQPSHLFCSLVFVIADILSAMLLRGIGHKLQMAYGLNARLL  137

Query  447  glgklFEDSD-ILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
            GL K   D + ILPSGDIAALVYLWNPFTIV C+G +T+P+ENM VI+++ GA     PL
Sbjct  138  GLLKSPRDKEGILPSGDIAALVYLWNPFTIVCCVGLSTSPIENMAVILALNGAVTRRVPL  197

Query  624  AAFGWTVASHLS  659
            AAFG  +A+HLS
Sbjct  198  AAFGLVMATHLS  209



>gb|KGN50142.1| hypothetical protein Csa_5G155530 [Cucumis sativus]
Length=816

 Score =   218 bits (554),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW W   S++FRL++IYFP NLN ++RPEV+T +TS+ RLAEGYWLKQSSMSPY GSMY
Sbjct  361  NFWIWMMLSVIFRLLMIYFP-NLNLSSRPEVATSLTSIHRLAEGYWLKQSSMSPYTGSMY  419

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G   HLLCS   VVAD +SA+LIR TGQ+LQRA  +SLK L
Sbjct  420  HGSPLLLSLLGPLTVKRIEGQPDHLLCSFAFVVADVLSALLIRGTGQNLQRAYYRSLKLL  479

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             +    + S+I P+GDIA+LVY+WNPFTIV C+G +T+P+EN+ +++++YGA KG  PLA
Sbjct  480  KVNLS-KSSEIFPAGDIASLVYVWNPFTIVACVGLSTSPIENLAIVLTLYGASKGQVPLA  538

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  539  AFGFVMATHLS  549



>ref|XP_009388331.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Musa acuminata subsp. malaccensis]
Length=461

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 150/191 (79%), Gaps = 1/191 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIY-FPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +W  AAA+I FRL+L+  FPK+L+  +RPEV+TP+TSLRRLAEGYWLKQ+SMSPY+GSMY
Sbjct  7    YWTLAAAAIAFRLLLLLCFPKDLHLGSRPEVATPLTSLRRLAEGYWLKQASMSPYSGSMY  66

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LG LT  +++G   H  CSL+ VV DFI+A+LIRATGQ L  +  KS + L
Sbjct  67   HGSPLLLSFLGQLTIRRVEGRPPHFYCSLMFVVVDFITAILIRATGQKLLLSRHKSFQVL  126

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L KL E S  +  GD A+LVYLWNP TIVTCMG +T+P++N+ V+++IYGAC  +APLA
Sbjct  127  NLSKLVEASGTVNPGDFASLVYLWNPLTIVTCMGSSTSPVDNLMVVMAIYGACSRIAPLA  186

Query  627  AFGWTVASHLS  659
            AFGW  A+HLS
Sbjct  187  AFGWVFATHLS  197



>dbj|BAK07917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             +W  A A++ FRLVL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+SMSPY+GSMY
Sbjct  5    HYWSMAVAAVGFRLVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASMSPYSGSMY  64

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +  GH  H+ CSLV V  DFI+A+LIR+TG++LQ A  +SLKSL
Sbjct  65   HGSPLLLSVLGPLTSKRSGGHHSHIYCSLVFVAVDFIAAILIRSTGRTLQMARNRSLKSL  124

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L K  ++S  + +GD A+L+YLWNP+TI+TC+G  T+P+EN+ V+I ++GAC GL PLA
Sbjct  125  DLTKSVDNSVNVSAGDTASLIYLWNPWTIITCVGSCTSPIENLMVVIMLHGACSGLVPLA  184

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  185  AFGYVIATHLS  195



>ref|NP_001148568.1| GPI transamidase subunit PIG-U family protein [Zea mays]
 gb|ACG32078.1| GPI transamidase subunit PIG-U family protein [Zea mays]
 gb|ACN35439.1| unknown [Zea mays]
 gb|AFW72851.1| GPI transamidase subunit PIG-U family [Zea mays]
Length=452

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            ++W  A A++ FRLVL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+S+SPY+GSMY
Sbjct  4    RYWPMAGAAVGFRLVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASVSPYSGSMY  63

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT ++ DGH  H+ CSL+ V  DF++AMLIRATG  L+ A  +SLKSL
Sbjct  64   HGSPLLLSVLGPLTSSRPDGHHAHIYCSLIFVAVDFLAAMLIRATGHELEMARNRSLKSL  123

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L K  +D+  + +GD+A+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYG+C  LAPLA
Sbjct  124  DLTKAVKDTVNVSAGDVASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGSCSRLAPLA  183

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  184  AFGYVMATHLS  194



>ref|XP_007042807.1| GPI transamidase subunit PIG-U isoform 2 [Theobroma cacao]
 gb|EOX98638.1| GPI transamidase subunit PIG-U isoform 2 [Theobroma cacao]
Length=505

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 148/233 (64%), Gaps = 43/233 (18%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAG----  257
            FW W  ASI+FRL+LIYFPKNLN A+RPEVSTP+TS RRLAEGYWLKQ SMSPYAG    
Sbjct  16   FWNWVIASIIFRLILIYFPKNLNLASRPEVSTPLTSFRRLAEGYWLKQLSMSPYAGFSFC  75

Query  258  -----------------------------------SMYHgsplllaalgplTGNKIDGHS  332
                                               SMYHGSPLLL+ LGPLT  +I+G  
Sbjct  76   FFFFSLCPTFFNFFFILIRQKKEMYLIFLVFGYSGSMYHGSPLLLSLLGPLTVKRIEGQP  135

Query  333  YHLLCSLVLVVADFISAMLIRATGQSLQ----RASEkslkslglgklFEDSDILPSGDIA  500
             HLL SLV V+AD +SA+LIRATG++L+    R+ E            E   IL  GD A
Sbjct  136  NHLLYSLVSVIADVVSAILIRATGKNLRLAYLRSLESLDIVQQTKASGEFFKILSPGDAA  195

Query  501  ALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            AL+YLWNPFTIV C+G +T+P+ENM VI+ +YGAC  L PLAAFGW +A+HLS
Sbjct  196  ALIYLWNPFTIVACVGLSTSPIENMAVILCLYGACSRLVPLAAFGWVIATHLS  248



>gb|EPS73832.1| hypothetical protein M569_00921, partial [Genlisea aurea]
Length=462

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 152/197 (77%), Gaps = 7/197 (4%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGS-MY  266
            FW+WA AS++ R++L YF  NL  + RPEVSTP+TS+RRLAEGYWLKQ +MSPY+GS MY
Sbjct  17   FWKWAIASVLVRMILSYFSHNLRLSARPEVSTPLTSMRRLAEGYWLKQHAMSPYSGSSMY  76

Query  267  HgsplllaalgplTGNKIDGHSYHLL------CSLVLVVADFISAMLIRATGQSLQRASE  428
            HGSPLLL+ALG  T      +   +L      CSLV   ADFI+A+LIR TG+ L  +  
Sbjct  77   HGSPLLLSALGSFTVKSCLSNHQSILVFITSGCSLVSAFADFIAAILIRETGRLLTASHV  136

Query  429  kslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACK  608
            ++L  LG+ K+ +++DILPSGDIA LVYLWNPFTIV+C+GFNTTP+EN+F+I+S++GA  
Sbjct  137  RNLTLLGINKIPKETDILPSGDIAGLVYLWNPFTIVSCVGFNTTPIENLFIILSVFGASA  196

Query  609  GLAPLAAFGWTVASHLS  659
            GL PLAAFGW +ASHLS
Sbjct  197  GLIPLAAFGWVIASHLS  213



>emb|CDY67234.1| BnaCnng54040D [Brassica napus]
Length=478

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 149/192 (78%), Gaps = 1/192 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA +S++FRL+LI +  NLN ++RPEVSTP+TS+RRLAEGYWLKQ+SMSPYAGSMY
Sbjct  18   RFWIWALSSVLFRLILISYAGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMY  77

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I G   HL CSLV V+AD +SA+L+R  G+ LQ A   + + L
Sbjct  78   HGSPLLLSLLGPLTVQRIKGQPSHLFCSLVFVIADILSAILLRGIGKKLQMAYGLNARLL  137

Query  447  glgklFED-SDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
            GL K   D + ILP GDIAALVYLWNPFTIV C+G +T+P+EN+ VI+++ GA     PL
Sbjct  138  GLLKSPRDKAGILPCGDIAALVYLWNPFTIVCCVGLSTSPIENLAVILALNGAVTRRVPL  197

Query  624  AAFGWTVASHLS  659
            AAFG  +A+HLS
Sbjct  198  AAFGLVMATHLS  209



>ref|XP_006647706.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Oryza brachyantha]
Length=453

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W  A A++ FRL L+ F  +L  A+RPEVSTP+TS+RRLAEGYWLKQ+SMSPY+GSMYH
Sbjct  6    YWSMAVAAVGFRLALVLFGGDLQLASRPEVSTPLTSIRRLAEGYWLKQASMSPYSGSMYH  65

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +  GH  H+ CSL+ V  DFI+AMLIRATG+ LQ A  +SLKSL 
Sbjct  66   GSPLLLSVLGPLTNKRSVGHHNHIYCSLIFVAVDFIAAMLIRATGRILQIARNRSLKSLE  125

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L +   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P+EN+ V++ IYGAC  LAPLAA
Sbjct  126  LTEAVSNSVDVSAGDIASLIYLWNPWAIVTCVGSCTSPIENLMVVVMIYGACSRLAPLAA  185

Query  630  FGWTVASHLS  659
            FG+ +A+HLS
Sbjct  186  FGYVMATHLS  195



>gb|EEE57603.1| hypothetical protein OsJ_07980 [Oryza sativa Japonica Group]
Length=460

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 145/198 (73%), Gaps = 7/198 (4%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW  AAA++ FRLVL+ F  +L+ A+RPEVSTP+TS+RRLAEGYWLKQ+SMSPY+GSMY
Sbjct  5    NFWSMAAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSIRRLAEGYWLKQASMSPYSGSMY  64

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQ--RASEkslk  440
            HGSPLLL  LGPLT  +  GH  H+ CSL+ V  DFI+AMLIRATG+ LQ  R       
Sbjct  65   HGSPLLLLVLGPLTNKRSVGHHDHIYCSLIFVAVDFIAAMLIRATGRRLQIARNRNLKSL  124

Query  441  slglgklFEDSDILP-----SGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGAC  605
             L    L    D +P     +GDIA+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC
Sbjct  125  ELTEALLIVLIDTVPAVNVSAGDIASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGAC  184

Query  606  KGLAPLAAFGWTVASHLS  659
              LAPLAAFG+ +A+HLS
Sbjct  185  SRLAPLAAFGYVMATHLS  202



>ref|XP_004964641.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Setaria italica]
Length=447

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 151/190 (79%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W   AA+I FR VL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+SMSPY+GSMYH
Sbjct  6    YWPMVAAAIGFRFVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASMSPYSGSMYH  65

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT N+  G + H+ CSL+ V  DF++AMLI+ATG+ LQ +  +SLKSL 
Sbjct  66   GSPLLLSVLGPLTSNRSGGKNAHVYCSLIFVAVDFLAAMLIQATGRILQMSRNRSLKSLD  125

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L K   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC  LAPLAA
Sbjct  126  LTKAVNNSANVSAGDIASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGACSRLAPLAA  185

Query  630  FGWTVASHLS  659
            FG+ +A+HLS
Sbjct  186  FGYVIATHLS  195



>ref|XP_010476248.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=455

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 146/191 (76%), Gaps = 1/191 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYF-PKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            FW W   S++ RL  I+F P+N   ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMY
Sbjct  20   FWIWVMGSVILRLFFIFFFPENFKLSSRPEVSTPLTSVRRLAEGYWLKQSSMSPYAGSMY  79

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G S H LCSLV V AD +SA+L+RA G  LQ+    +LK L
Sbjct  80   HGSPLLLSVLGPLTSQRIEGQSSHHLCSLVFVFADILSALLLRAIGHKLQKTCRMNLKRL  139

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G+ +      ILP GDIAALVYLWNPFTI++C+G +T+P+EN+ VI+S+YGA     PLA
Sbjct  140  GVLRPSGGRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENLAVIVSLYGAVTRRVPLA  199

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  200  AFGLIIATHLS  210



>ref|XP_010476247.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=507

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 146/191 (76%), Gaps = 1/191 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYF-PKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            FW W   S++ RL  I+F P+N   ++RPEVSTP+TS+RRLAEGYWLKQSSMSPYAGSMY
Sbjct  20   FWIWVMGSVILRLFFIFFFPENFKLSSRPEVSTPLTSVRRLAEGYWLKQSSMSPYAGSMY  79

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G S H LCSLV V AD +SA+L+RA G  LQ+    +LK L
Sbjct  80   HGSPLLLSVLGPLTSQRIEGQSSHHLCSLVFVFADILSALLLRAIGHKLQKTCRMNLKRL  139

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
            G+ +      ILP GDIAALVYLWNPFTI++C+G +T+P+EN+ VI+S+YGA     PLA
Sbjct  140  GVLRPSGGRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENLAVIVSLYGAVTRRVPLA  199

Query  627  AFGWTVASHLS  659
            AFG  +A+HLS
Sbjct  200  AFGLIIATHLS  210



>ref|XP_008786214.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Phoenix dactylifera]
Length=445

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 144/190 (76%), Gaps = 11/190 (6%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W W AA+I FR++LI FPKNLN  +RPEV+TP+TSLRRLAEGYWLKQ+SMSPYAGSMYH
Sbjct  7    YWGWVAAAIAFRILLICFPKNLNLGSRPEVATPLTSLRRLAEGYWLKQASMSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGP T           + SL+ V+ DF++AMLIRATGQ L     +SL+ L 
Sbjct  67   GSPLLLSILGPFT-----------ITSLMFVIVDFVTAMLIRATGQKLMLKCHQSLQFLN  115

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KL E S  + +G+ A+LV+LWNP TIVTC+G  T P++N+  +++IYGAC  LAPLAA
Sbjct  116  LSKLVEASGNVEAGNFASLVFLWNPLTIVTCVGSTTAPIDNLMAVLAIYGACSCLAPLAA  175

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  176  FGWVIATHLS  185



>ref|XP_003562742.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Brachypodium distachyon]
Length=454

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 150/192 (78%), Gaps = 1/192 (1%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             +W  AAA++ FRL L+ F  NL+ A+RPEVSTP+TSLRRLAEGYWLKQ+SMSPY+GSMY
Sbjct  5    HYWSMAAAAVGFRLALVLFGGNLHLASRPEVSTPLTSLRRLAEGYWLKQASMSPYSGSMY  64

Query  267  HgsplllaalgplTGNKIDG-HSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslks  443
            HGSPLLL+ LGPLT +K  G H  H+ CSLV V  DF++AMLIR+TG+ LQ A  +SLKS
Sbjct  65   HGSPLLLSVLGPLTSSKRSGGHHAHIYCSLVFVAVDFLAAMLIRSTGRRLQMARNRSLKS  124

Query  444  lglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
            L L +    S  + SGD A+L+YLWNP+ I+TC+G  T+P+EN+ V+I IYGAC  LAPL
Sbjct  125  LDLTRSVNSSVNVSSGDAASLIYLWNPWAIITCVGSCTSPIENLMVVIMIYGACSRLAPL  184

Query  624  AAFGWTVASHLS  659
            AAFG+ +A+HLS
Sbjct  185  AAFGYVMATHLS  196



>ref|XP_004953492.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Setaria italica]
Length=452

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W   AA++ FRLVL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+SMSPY+GSMYH
Sbjct  6    YWPMVAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASMSPYSGSMYH  65

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT  +  G   H+ CSL+ V  DF++AMLIRATG+ LQ +   SLKSL 
Sbjct  66   GSPLLLTVLGPLTRTRSGGKHAHVYCSLIFVAVDFLAAMLIRATGRRLQMSRNISLKSLD  125

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L K   +S  + +G IA+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC  LAPLAA
Sbjct  126  LTKAVNNSANVCAGGIASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGACSRLAPLAA  185

Query  630  FGWTVASHLS  659
            FG+ +A+HLS
Sbjct  186  FGYVLATHLS  195



>ref|XP_012086990.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Jatropha curcas]
 gb|KDP25499.1| hypothetical protein JCGZ_20655 [Jatropha curcas]
Length=473

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 143/190 (75%), Gaps = 16/190 (8%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FWRW   S++ RL LI F +NLN ++RPEVSTP+TSLRR                 SMYH
Sbjct  21   FWRWTFCSVILRLFLISFSRNLNLSSRPEVSTPLTSLRR----------------RSMYH  64

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +I+G   H+LCSL+ V+AD ISAMLIRATG  LQ +  +SLK+L 
Sbjct  65   GSPLLLSLLGPLTVKRIEGQPDHVLCSLLFVIADIISAMLIRATGWKLQMSYRQSLKALD  124

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            +  + E+SD+LPSGDIAALVYLWNPFTIV C+G +T+P+EN+FV++++YGAC GL PLAA
Sbjct  125  IVNVLENSDLLPSGDIAALVYLWNPFTIVACVGLSTSPIENLFVVLTLYGACTGLVPLAA  184

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  185  FGWVMATHLS  194



>ref|XP_010112563.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Morus notabilis]
 gb|EXC34110.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Morus notabilis]
Length=463

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            +FW WA AS++FRL+LIYFP NLN ++RPEVSTP+TSLRRLAEGYWLKQSS+SPYAGSMY
Sbjct  7    RFWGWAFASVIFRLILIYFPNNLNLSSRPEVSTPLTSLRRLAEGYWLKQSSLSPYAGSMY  66

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL  LGPLT             SLV V+AD ++A+LIR  GQ+LQ +  + LK+L
Sbjct  67   HGSPLLLYVLGPLTAK-----------SLVFVIADVVNALLIRVIGQNLQISYNQRLKAL  115

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAP  620
             L  + ++  ILPS DIAALVYLWNPFTIV+C+G +T+P+ENM VI+S+YGAC    P
Sbjct  116  SLDAIPKEKAILPSRDIAALVYLWNPFTIVSCVGLSTSPIENMAVILSLYGACTRYGP  173



>gb|AAF88086.1|AC025417_14 T12C24.26 [Arabidopsis thaliana]
Length=453

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS +FRL LI+ P N+N ++RPEVSTP TSLRRLAEGYWLKQSS+SPYAGSMYH
Sbjct  9    FWIWTLASTIFRLFLIFSPANINLSSRPEVSTPHTSLRRLAEGYWLKQSSLSPYAGSMYH  68

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT             + V++ AD +SA+L+RA GQ LQ++   +L+ LG
Sbjct  69   GSPLLLSILGPLTVQSDKFVVAGSKGNRVIICADLLSALLLRAIGQKLQKSYRMNLRPLG  128

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            + +  +D  ILP GDIAALVYLWNPFTI++C+G +T+P+EN+ VI+S+YGA     PLAA
Sbjct  129  VLRSSQDRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENLAVIVSLYGAVTRRVPLAA  188

Query  630  FGWTVASHLS  659
            FG  +A+HLS
Sbjct  189  FGLIMATHLS  198



>ref|XP_002889963.1| hypothetical protein ARALYDRAFT_471424 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66222.1| hypothetical protein ARALYDRAFT_471424, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=484

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 154/200 (77%), Gaps = 10/200 (5%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYF-PKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
            FW WA AS +FRL LI+F P+N+N ++RPE+STP+TSLRRLAEGYWLKQSS+SPYAGSMY
Sbjct  19   FWIWAMASTIFRLFLIFFFPENINASSRPELSTPLTSLRRLAEGYWLKQSSLSPYAGSMY  78

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
            HGSPLLL+ LGPLT  +I+G S H LCSLV V+AD +SA+L+RATGQ LQ+A   +L+ L
Sbjct  79   HGSPLLLSILGPLTIQRIEGKSSHHLCSLVFVIADILSALLLRATGQKLQKAYRLNLRRL  138

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVI-------ISIYGA-  602
            GL    +D  ILP GDIAALV+LWNPFTI++C+G +T+P+EN+ VI       +SI    
Sbjct  139  GLLTSLQDRGILPCGDIAALVHLWNPFTILSCVGLSTSPIENLAVIQLLEKVFLSILDEN  198

Query  603  -CKGLAPLAAFGWTVASHLS  659
               G  PLAAFG  +A+HLS
Sbjct  199  PAFGRVPLAAFGLVMATHLS  218



>ref|XP_004964640.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Setaria italica]
Length=480

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 151/223 (68%), Gaps = 33/223 (15%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRR---------------------  206
            +W   AA+I FR VL+ F  +L+ A+RPEVSTP+TSLRR                     
Sbjct  6    YWPMVAAAIGFRFVLVLFGGDLHLASRPEVSTPLTSLRRRKRLLNHQPPPSLPASLGDIA  65

Query  207  ------------LAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCS  350
                        +AEGYWLKQ+SMSPY+GSMYHGSPLLL+ LGPLT N+  G + H+ CS
Sbjct  66   VIGLFIYLLCIAVAEGYWLKQASMSPYSGSMYHGSPLLLSVLGPLTSNRSGGKNAHVYCS  125

Query  351  LVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFT  530
            L+ V  DF++AMLI+ATG+ LQ +  +SLKSL L K   +S  + +GDIA+L+YLWNP+ 
Sbjct  126  LIFVAVDFLAAMLIQATGRILQMSRNRSLKSLDLTKAVNNSANVSAGDIASLIYLWNPWA  185

Query  531  IVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            IVTC+G  T+P+EN+ V+I IYGAC  LAPLAAFG+ +A+HLS
Sbjct  186  IVTCVGSCTSPIENLMVVIMIYGACSRLAPLAAFGYVIATHLS  228



>gb|EMS63096.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Triticum urartu]
Length=357

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 135/191 (71%), Gaps = 27/191 (14%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             +W  A A++ FRLVL+ F  +L+ A+RPEVSTP+TSLRRLAEGYWLKQ+SMSPY+G   
Sbjct  5    HYWSMAVAAVGFRLVLVLFGGDLHLASRPEVSTPLTSLRRLAEGYWLKQASMSPYSG---  61

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
                            ++D        ++++ +ADFI+AMLIR+TG++LQ A  +SLKSL
Sbjct  62   ----------------QVD--------TILIYIADFIAAMLIRSTGRTLQMARNRSLKSL  97

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L K   +S  + +GD A+L+YLWNP+TI+TC+G  T+P+EN+ V+I ++GAC  LAPLA
Sbjct  98   DLRKSVNNSVNVSAGDTASLIYLWNPWTIITCVGSCTSPIENLMVVIMLHGACSRLAPLA  157

Query  627  AFGWTVASHLS  659
            AFG+ +A+HLS
Sbjct  158  AFGYVMATHLS  168



>ref|XP_011624959.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Amborella trichopoda]
Length=579

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            F  WAA ++  RL+L   P +L+F +RPE+++P+TS+RRLAEG WLKQSS SPYAGSMYH
Sbjct  118  FCGWAALALFIRLLL--NPISLSFTSRPEIASPLTSIRRLAEGQWLKQSSFSPYAGSMYH  175

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL  LGPLT ++  G   H+L SLVLV  D ISAMLIRATGQ LQ A  +SL  L 
Sbjct  176  GSPLLLPVLGPLTVSRTGGVPSHILLSLVLVTVDAISAMLIRATGQKLQAAYSRSLGLLN  235

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L +  E S  L SGD+AAL+YL NP TI  C G +T+ +EN+ +++++YGAC     L +
Sbjct  236  LSRPIETSGTLDSGDVAALIYLLNPLTIAACAGSSTSSIENLMILLTVYGACARCTSLGS  295

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  296  FGWVIATHLS  305



>ref|XP_010933541.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Elaeis guineensis]
Length=441

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 16/190 (8%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W W AA+I FRL+LI FP+NLN  +RPEV+TP+TSLRR                 SMYH
Sbjct  7    YWGWVAAAIAFRLLLICFPENLNLGSRPEVATPLTSLRR----------------RSMYH  50

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  + +G   H  CSL+ V+ DF++AMLI ATGQ L     +SL+ L 
Sbjct  51   GSPLLLSILGPLTITRSEGQPAHFSCSLMFVIVDFVTAMLIHATGQKLMTKCHQSLQFLN  110

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            L KL E S  + +G  A+LV+LWNP TIVTC+G  TTP++N  V+++I+GAC  LAPLAA
Sbjct  111  LSKLVEASGNVDAGKFASLVFLWNPLTIVTCVGSTTTPIDNFMVVLAIFGACSRLAPLAA  170

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  171  FGWVIATHLS  180



>ref|XP_011621261.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Amborella trichopoda]
Length=462

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 133/190 (70%), Gaps = 9/190 (5%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W WAA ++  RL LI  P +L+F +RPE++TP+TS+RRLAEG WLKQSS SPYAGSMYH
Sbjct  9    YWGWAALALFIRLFLI--PISLSFTSRPEIATPLTSIRRLAEGQWLKQSSFSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslg  449
            GSPLLL+ LGPLT  +  G   H+L SLVLV+         R +G   +   E S+K  G
Sbjct  67   GSPLLLSVLGPLTVCRTGGVPSHILLSLVLVIR-----WSTRLSG--FESNLEVSIKLEG  119

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            +   F     L SGD+AAL+YL+NP TI  C G +T+P+ENM +++++YGAC G+ PLAA
Sbjct  120  IFGDFYLVGTLDSGDVAALIYLFNPLTIAACAGSSTSPIENMMILLTVYGACAGVPPLAA  179

Query  630  FGWTVASHLS  659
            FGW +A+HLS
Sbjct  180  FGWVIATHLS  189



>gb|EEC71873.1| hypothetical protein OsI_04592 [Oryza sativa Indica Group]
Length=761

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 121/191 (63%), Gaps = 38/191 (20%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             +W  AAA++ FRLVL+ F  +L+ A+RPEVSTP+TS+RRLAEGYWLKQ+SMSPYA    
Sbjct  5    HYWPMAAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSIRRLAEGYWLKQASMSPYA----  60

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslksl  446
                                              DFI+AMLIRATG  L     +SL SL
Sbjct  61   ----------------------------------DFIAAMLIRATGHRLNITRNRSLNSL  86

Query  447  glgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
             L +   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P+EN+ V+I IYGAC  LAPLA
Sbjct  87   ELTEAVSNSVNISAGDIASLIYLWNPWAIVTCVGSCTSPIENLMVVIMIYGACSRLAPLA  146

Query  627  AFGWTVASHLS  659
            AFG+ +++HL+
Sbjct  147  AFGYVMSTHLT  157



>ref|XP_006579601.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Glycine max]
Length=448

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +3

Query  243  SPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRA  422
            SPYAGSMYHGSPLLL  LGPLT  +I+G   HLLCSLV V+AD +SAMLI A G+ L+ A
Sbjct  40   SPYAGSMYHGSPLLLTLLGPLTVKRIEGQPDHLLCSLVFVIADVVSAMLICAAGEKLKVA  99

Query  423  SEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGA  602
               SL+SLGL  L E+S+ LPSGD AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGA
Sbjct  100  CSSSLQSLGLHNLSENSERLPSGDFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGA  159

Query  603  CKGLAPLAAFGWTVASHLS  659
            C  LAPLAAFGW +A+HLS
Sbjct  160  CSRLAPLAAFGWVMATHLS  178



>ref|NP_974075.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 dbj|BAH19432.1| AT1G63110 [Arabidopsis thaliana]
 gb|AEE34057.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=407

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  240  MSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQR  419
            MSPYAGSMYHGSPLLL+ LGPLT  +I G   HLLCSLV V+AD +SAML+RA GQ LQ 
Sbjct  1    MSPYAGSMYHGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRAIGQKLQM  60

Query  420  ASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYG  599
            A   + + LG  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+EN+ VI++++G
Sbjct  61   AYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALFG  120

Query  600  ACKGLAPLAAFGWTVASHLS  659
            A     PLAAFG  +A+HLS
Sbjct  121  AVTRRVPLAAFGLVIATHLS  140



>ref|XP_009625091.1| PREDICTED: uncharacterized protein LOC104116025 [Nicotiana tomentosiformis]
Length=170

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +3

Query  39   AQMEASRkkakpkpkpQFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEG  218
            A M+  +++  P  KP+FWRWA ASI+FRL+LIYFPKNLN ATRPEVSTPVTSLRRLAEG
Sbjct  54   ATMKGEKQQNIPTKKPRFWRWAVASIIFRLILIYFPKNLNLATRPEVSTPVTSLRRLAEG  113

Query  219  YWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVA  368
            YWL QSSMSPYAGSMYHGSPLLL+ LGPLT  KI+G  +HLLC   L +A
Sbjct  114  YWLTQSSMSPYAGSMYHGSPLLLSVLGPLTMKKIEGQPFHLLCRYCLFLA  163



>gb|KJB12324.1| hypothetical protein B456_002G011900 [Gossypium raimondii]
Length=397

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  240  MSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQR  419
            MS YAGSMYHGSPLLL+ LGPLT  +I+G   HLL SLV V+AD +SAMLIRATGQ+L+ 
Sbjct  1    MSSYAGSMYHGSPLLLSLLGPLTVKRIEGQPNHLLYSLVSVIADVVSAMLIRATGQNLRL  60

Query  420  ASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYG  599
            A  +SL+SL L K  + S+ L SGDIAAL+YL NPFTIV C+G +T+P+ENM VI+ +YG
Sbjct  61   AYLRSLESLDLVKQIDVSEFLCSGDIAALIYLCNPFTIVACVGLSTSPIENMAVILCLYG  120

Query  600  ACKGLAPLAAFGWTVASHLS  659
            AC  L PLAAFGW +A+HLS
Sbjct  121  ACSRLIPLAAFGWVIATHLS  140



>ref|XP_009627450.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Nicotiana tomentosiformis]
Length=339

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            SLV V+ADFI AMLIRATG  L+    + LK LGLGKLFE S+ILPS DIAALVYLWNPF
Sbjct  10   SLVSVIADFICAMLIRATGLKLRMTYCERLKLLGLGKLFEVSEILPSEDIAALVYLWNPF  69

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TIVTC+GFNTTP+EN+F+I+S+YGAC  +APLAAFGW +ASHLS
Sbjct  70   TIVTCVGFNTTPVENLFIILSLYGACIRVAPLAAFGWVIASHLS  113



>ref|XP_009627449.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Nicotiana tomentosiformis]
Length=372

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            SLV V+ADFI AMLIRATG  L+    + LK LGLGKLFE S+ILPS DIAALVYLWNPF
Sbjct  10   SLVSVIADFICAMLIRATGLKLRMTYCERLKLLGLGKLFEVSEILPSEDIAALVYLWNPF  69

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TIVTC+GFNTTP+EN+F+I+S+YGAC  +APLAAFGW +ASHLS
Sbjct  70   TIVTCVGFNTTPVENLFIILSLYGACIRVAPLAAFGWVIASHLS  113



>gb|EEC73810.1| hypothetical protein OsI_08523 [Oryza sativa Indica Group]
Length=400

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMY  266
             FW  AAA++ FRLVL+ F  +L+ A+RPEVSTP+TS+RRLAEGYWLKQ+SMSPY+GSMY
Sbjct  5    NFWSMAAAAVGFRLVLVLFGGDLHLASRPEVSTPLTSIRRLAEGYWLKQASMSPYSGSMY  64

Query  267  HgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRA  422
            HGSPLLL  LGPLT  +  GH  H+ CSL+ V  DFI+AMLIRATG+ LQ A
Sbjct  65   HGSPLLLLVLGPLTNKRSVGHHDHIYCSLIFVAVDFIAAMLIRATGRRLQIA  116



>ref|XP_004491296.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Cicer arietinum]
Length=316

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +3

Query  261  MYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslk  440
            MYHGSPLLL  LGPLT  +I+G   +LLCSLV V+AD ++AMLI A G+ LQ A   SL+
Sbjct  1    MYHGSPLLLTLLGPLTVTRIEGQPDYLLCSLVFVMADVVTAMLICAAGKKLQAAYSSSLQ  60

Query  441  slglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAP  620
             +GL  L E+SD+L SG+ AALVYLWNPFTIV C+G +T+ +EN+ V++S+YGAC  LAP
Sbjct  61   FIGLHHLSENSDVLRSGEFAALVYLWNPFTIVACVGLSTSAIENLMVVLSLYGACARLAP  120

Query  621  LAAFGWTVASHLS  659
            +AAFGW +A+HLS
Sbjct  121  VAAFGWVMATHLS  133



>ref|XP_001778404.1| predicted protein [Physcomitrella patens]
 gb|EDQ56762.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 122/208 (59%), Gaps = 29/208 (14%)
 Frame = +3

Query  93   WRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHg  272
            W      I  R +L+          R EV +PVTSL RLAEGYWLK+   SPYAGS YHG
Sbjct  69   WGGGTLGICVRFLLVVMGSLSLLDRRVEVVSPVTSLSRLAEGYWLKEYGKSPYAGSAYHG  128

Query  273  splllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslgl  452
            SPLLL+ +GP+ G+          CSL  VVAD +SA+L+R+TG+ L+    K L+ LGL
Sbjct  129  SPLLLSLIGPVIGDS---------CSL-FVVADLMSALLLRSTGKLLEHGHSKHLQLLGL  178

Query  453  gklFEDS----DILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGL--  614
              L  +     D L  GDI+ LVYL+NPFTI  C+G +T+ +ENM +I+S+YGA  GL  
Sbjct  179  TNLLREKTDRKDKLGIGDISFLVYLFNPFTIAVCVGGSTSSIENMLIILSLYGAAAGLLM  238

Query  615  -------------APLAAFGWTVASHLS  659
                          PLA FGW +A+HLS
Sbjct  239  CKRVGMAWWAAGKVPLAGFGWAMATHLS  266



>ref|XP_008369469.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X1 [Malus domestica]
Length=412

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            +L++  AD ++AMLIRATGQ+LQ A  +SLKSL L    E  ++LPSGDIAALVYLWNPF
Sbjct  39   NLIIFSADVLNAMLIRATGQTLQVAYRQSLKSLDLDTTLESIEVLPSGDIAALVYLWNPF  98

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TIV C+G +T+P+EN  +I+++YGACK L PLAAFGW +A+HLS
Sbjct  99   TIVACVGLSTSPIENFAIILALYGACKRLVPLAAFGWVIATHLS  142



>gb|AAG51607.1|AC010795_11 unknown protein; 55290-58984 [Arabidopsis thaliana]
Length=551

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 27/151 (18%)
 Frame = +3

Query  207  LAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAM  386
            +AEGYWLKQ+SMSPYAG               L GN++               AD +SAM
Sbjct  198  VAEGYWLKQASMSPYAG---------------LKGNQVTS------------CADILSAM  230

Query  387  LIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPL  566
            L+RA GQ LQ A   + + LG  K   D  ILP GDIAALVYLWNPFTIV+C+G +T+P+
Sbjct  231  LLRAIGQKLQMAYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPI  290

Query  567  ENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            EN+ VI++++GA     PLAAFG  +A+HLS
Sbjct  291  ENLAVILALFGAVTRRVPLAAFGLVIATHLS  321



>ref|XP_008373832.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Malus domestica]
Length=400

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            ++   D ++AMLIRATGQ+LQ A  +SLK L L  + E S++LPSGDIAALVYLWNP TI
Sbjct  29   IIFSVDILNAMLIRATGQTLQVAYRQSLKXLDLVTISESSEVLPSGDIAALVYLWNPLTI  88

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            V C+G +T+P+EN  +I++++GACK L PL AFGW +A+HLS
Sbjct  89   VACVGLSTSPIENFAIILALFGACKRLVPLXAFGWVMATHLS  130



>ref|XP_010050833.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Eucalyptus grandis]
Length=114

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS+ FR+ L Y P+NL  +TRPEV++P+TS+RRL EGYWLKQS MSPYAGSMYH
Sbjct  23   FWTWVVASVAFRVALFYLPRNLRLSTRPEVTSPLTSIRRLGEGYWLKQSVMSPYAGSMYH  82

Query  270  gsplllaalgplTGNKIDGHSYHLLCSL  353
            GSPLLL  LGPL   +I+G   HLLC +
Sbjct  83   GSPLLLLVLGPLAVKRIEGQPEHLLCRI  110



>ref|XP_011029200.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Populus euphratica]
Length=399

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            +L++  AD ISA+LIRATG +LQ A  +SL SL +  L + SD+L SGDIAALVYLWNPF
Sbjct  27   NLIIFFADIISALLIRATGHTLQMAYRQSLNSLDIVDLLKSSDLLSSGDIAALVYLWNPF  86

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI  C+G +T+P+EN+ VI++++GACKGL PLAAFGW +++HLS
Sbjct  87   TIAACVGLSTSPVENLVVILALHGACKGLVPLAAFGWVMSTHLS  130



>ref|NP_973813.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AEE28918.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=390

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V++ AD +SA+L+RA GQ LQ++   +L+ LG+ +  +D  ILP GDIAALVYLWNPFTI
Sbjct  23   VIICADLLSALLLRAIGQKLQKSYRMNLRPLGVLRSSQDRGILPCGDIAALVYLWNPFTI  82

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            ++C+G +T+P+EN+ VI+S+YGA     PLAAFG  +A+HLS
Sbjct  83   LSCVGLSTSPIENLAVIVSLYGAVTRRVPLAAFGLIMATHLS  124



>ref|XP_002986198.1| hypothetical protein SELMODRAFT_43879, partial [Selaginella moellendorffii]
 gb|EFJ12729.1| hypothetical protein SELMODRAFT_43879, partial [Selaginella moellendorffii]
Length=442

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 104/165 (63%), Gaps = 13/165 (8%)
 Frame = +3

Query  174  EVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSL  353
            E++TPVTSL RL EG+WLK+  +SPYAGS+YHGSPLLL  +GPL  N            +
Sbjct  29   EIATPVTSLVRLEEGFWLKKLGLSPYAGSVYHGSPLLLEIIGPLGANS----------PI  78

Query  354  VLVVADFISAMLIRATGQSLQRASEksl---kslglgklFEDSDILPSGDIAALVYLWNP  524
            + +++DF +A+LI   G+ L  A +        +    LF   + L  G+IAAL+YL+NP
Sbjct  79   LFLLSDFATALLIILIGKRLSAARDHYTHWNIGITYSMLFLTGETLDIGEIAALLYLFNP  138

Query  525  FTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            FT+  C+G +T+  E+  V +++Y + +G APLAAF W +ASH +
Sbjct  139  FTVFVCVGGSTSSFESFVVCLALYASLEGNAPLAAFAWVMASHFA  183



>ref|XP_002985010.1| hypothetical protein SELMODRAFT_121519 [Selaginella moellendorffii]
 gb|EFJ13885.1| hypothetical protein SELMODRAFT_121519 [Selaginella moellendorffii]
Length=466

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 104/165 (63%), Gaps = 13/165 (8%)
 Frame = +3

Query  174  EVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSL  353
            E++TPVTSL RL EG+WLK+  +SPYAGS+YHGSPLLL  +GPL  N            +
Sbjct  39   EIATPVTSLVRLEEGFWLKKLGLSPYAGSVYHGSPLLLEIIGPLGANS----------PI  88

Query  354  VLVVADFISAMLIRATGQSLQRASEksl---kslglgklFEDSDILPSGDIAALVYLWNP  524
            + +++DF +A+LI   G+ L  A +        +    LF   + L  G+IAAL+YL+NP
Sbjct  89   LFLLSDFATALLIILIGKRLSAARDHYTHWNIGITHSMLFLTGETLDIGEIAALLYLFNP  148

Query  525  FTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            FT+  C+G +T+  E+  V +++Y + +G APLAAF W +ASH +
Sbjct  149  FTVFVCVGGSTSSFESFVVCLALYASLEGNAPLAAFAWVMASHFA  193



>ref|XP_008786215.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Phoenix dactylifera]
Length=362

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            + V+ DF++AMLIRATGQ L     +SL+ L L KL E S  + +G+ A+LV+LWNP TI
Sbjct  1    MFVIVDFVTAMLIRATGQKLMLKCHQSLQFLNLSKLVEASGNVEAGNFASLVFLWNPLTI  60

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            VTC+G  T P++N+  +++IYGAC  LAPLAAFGW +A+HLS
Sbjct  61   VTCVGSTTAPIDNLMAVLAIYGACSCLAPLAAFGWVIATHLS  102



>ref|NP_176499.2| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
 gb|AAL38264.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91122.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34056.1| GPI transamidase subunit PIG-U [Arabidopsis thaliana]
Length=397

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  366  ADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCM  545
            AD +SAML+RA GQ LQ A   + + LG  K   D  ILP GDIAALVYLWNPFTIV+C+
Sbjct  33   ADILSAMLLRAIGQKLQMAYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTIVSCV  92

Query  546  GFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            G +T+P+EN+ VI++++GA     PLAAFG  +A+HLS
Sbjct  93   GLSTSPIENLAVILALFGAVTRRVPLAAFGLVIATHLS  130



>ref|XP_010458703.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X1 [Camelina sativa]
Length=390

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V + AD +SA+L+RA GQ LQ+    +LK LG+ +   D  ILP GDIAALVYLWNP+TI
Sbjct  23   VTICADILSALLLRAIGQKLQKTYSMNLKRLGVLRSSGDRGILPCGDIAALVYLWNPYTI  82

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            ++C+G +T+P+EN+ VI+S+YGA     PLAAFG   A+HLS
Sbjct  83   LSCVGLSTSPIENLAVIVSLYGAVTRRVPLAAFGLITATHLS  124



>ref|XP_006579602.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Glycine max]
 ref|XP_006579603.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Glycine max]
 ref|XP_006579604.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X4 [Glycine max]
Length=362

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  384  MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTP  563
            MLI A G+ L+ A   SL+SLGL  L E+S+ LPSGD AALVYLWNPFTIV C+G +T+ 
Sbjct  1    MLICAAGEKLKVACSSSLQSLGLHNLSENSERLPSGDFAALVYLWNPFTIVACVGLSTSA  60

Query  564  LENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +EN+ V++S+YGAC  LAPLAAFGW +A+HLS
Sbjct  61   IENLMVVLSLYGACSRLAPLAAFGWVMATHLS  92



>ref|XP_010473542.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=391

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V+  AD +SAML+R  GQ LQ A   + + LG  K   D  ILP GDIAALVYLWNPFTI
Sbjct  23   VISCADILSAMLLRGIGQKLQMAYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTI  82

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            V+C+G +T+P+EN+ V+++++GA     PLAAFG+ +A+HLS
Sbjct  83   VSCVGLSTSPIENLAVVLALFGAVTRRVPLAAFGFVMATHLS  124



>ref|XP_010476249.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X3 [Camelina sativa]
Length=421

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V++ AD +SA+L+RA G  LQ+    +LK LG+ +      ILP GDIAALVYLWNPFTI
Sbjct  23   VIICADILSALLLRAIGHKLQKTCRMNLKRLGVLRPSGGRGILPCGDIAALVYLWNPFTI  82

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            ++C+G +T+P+EN+ VI+S+YGA     PLAAFG  +A+HLS
Sbjct  83   LSCVGLSTSPIENLAVIVSLYGAVTRRVPLAAFGLIIATHLS  124



>ref|XP_010430395.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=391

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V+  AD +SAML+R  GQ LQ A   + + LG  K   D  ILP GDIAALVYLWNPFTI
Sbjct  23   VISCADILSAMLLRGIGQKLQMAYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTI  82

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            V+C+G +T+P+E + VI++++GA     PLAAFG+ +A+HLS
Sbjct  83   VSCVGLSTSPIETLAVILALFGAVTRRVPLAAFGFVMATHLS  124



>gb|KCW60085.1| hypothetical protein EUGRSUZ_H02816 [Eucalyptus grandis]
Length=167

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS+ FRL L+Y P+NL  +TRPEV++P+TS+RRL EGYWLKQS MSPYAGSMYH
Sbjct  23   FWTWVVASVAFRLALVYLPRNLRLSTRPEVASPLTSIRRLGEGYWLKQSVMSPYAGSMYH  82



>ref|XP_010418323.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Camelina sativa]
Length=388

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +3

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            V+  AD +SAML+R  GQ LQ A      +  L   F D  ILP GDIAALVY WNPFTI
Sbjct  23   VISCADILSAMLLRGIGQKLQMA---YGLNARLLGFFMDKVILPCGDIAALVYFWNPFTI  79

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            V+C+G +T+P+EN+ VI++++GA     PLAAFG+ +A+HLS
Sbjct  80   VSCVGLSTSPIENLAVILALFGAVTRRVPLAAFGFVMATHLS  121



>ref|XP_010235897.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like isoform X2 [Brachypodium distachyon]
Length=361

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  363  VADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTC  542
            +ADF++AMLIR+TG+ LQ A  +SLKSL L +    S  + SGD A+L+YLWNP+ I+TC
Sbjct  5    IADFLAAMLIRSTGRRLQMARNRSLKSLDLTRSVNSSVNVSSGDAASLIYLWNPWAIITC  64

Query  543  MGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +G  T+P+EN+ V+I IYGAC  LAPLAAFG+ +A+HLS
Sbjct  65   VGSCTSPIENLMVVIMIYGACSRLAPLAAFGYVMATHLS  103



>ref|XP_010045079.1| PREDICTED: uncharacterized protein LOC104433884 isoform X2 [Eucalyptus 
grandis]
Length=98

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            FW W  AS+ FRL L+Y P+NL  +TRPEV++ +TS+RRL EGYWLKQS MSPYAGSMYH
Sbjct  23   FWTWVVASVAFRLALVYLPRNLGLSTRPEVASSLTSIRRLGEGYWLKQSVMSPYAGSMYH  82



>ref|XP_009113021.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein isoform X2 [Brassica rapa]
Length=399

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +3

Query  366  ADFISAMLIRATGQSLQRASEkslkslglgklFEDSD-ILPSGDIAALVYLWNPFTIVTC  542
            AD +SA+L+R  G  LQ A   + + LGL K   D + ILPSGDIAALVYLWNPFTIV C
Sbjct  33   ADILSAILLRGIGHKLQMAYGLNARLLGLLKSPTDKEGILPSGDIAALVYLWNPFTIVCC  92

Query  543  MGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +G +T+P+ENM VI+++ GA     PLAAFG  +A+HLS
Sbjct  93   VGLSTSPIENMAVILALNGAVTRRVPLAAFGLVMATHLS  131



>dbj|BAD81713.1| putative transamidase complex subunit PIG-U [Oryza sativa Japonica 
Group]
Length=320

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  384  MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTP  563
            MLIRATG  L     +SL SL L +   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P
Sbjct  1    MLIRATGHRLNITRNRSLNSLELTEAVSNSVNISAGDIASLIYLWNPWAIVTCVGSCTSP  60

Query  564  LENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +EN+ V+I IYGAC  LAPLAAFG+ +++HL+
Sbjct  61   IENLMVVIMIYGACSRLAPLAAFGYVMSTHLT  92



>gb|EAZ14305.1| hypothetical protein OsJ_04231 [Oryza sativa Japonica Group]
Length=325

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  384  MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTP  563
            MLIRATG  L     +SL SL L +   +S  + +GDIA+L+YLWNP+ IVTC+G  T+P
Sbjct  1    MLIRATGHRLNITRNRSLNSLELTEAVSNSVNISAGDIASLIYLWNPWAIVTCVGSCTSP  60

Query  564  LENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +EN+ V+I IYGAC  LAPLAAFG+ +++HL+
Sbjct  61   IENLMVVIMIYGACSRLAPLAAFGYVMSTHLT  92



>ref|XP_010045078.1| PREDICTED: uncharacterized protein LOC104433884 isoform X1 [Eucalyptus 
grandis]
Length=127

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGS  260
            FW W  AS+ FRL L+Y P+NL  +TRPEV++ +TS+RRL EGYWLKQS MSPYAGS
Sbjct  23   FWTWVVASVAFRLALVYLPRNLGLSTRPEVASSLTSIRRLGEGYWLKQSVMSPYAGS  79



>ref|XP_010039623.1| PREDICTED: uncharacterized protein LOC104428326 [Eucalyptus grandis]
Length=180

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 67/117 (57%), Gaps = 29/117 (25%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAG-------  257
            W  AS+ FRL L+Y P+NL  +TRPEV++P+TS+RRL EGYWLKQS MSPY G       
Sbjct  58   WVVASVAFRLALVYLPRNLRLSTRPEVASPLTSIRRLGEGYWLKQSVMSPYTGSAPFDLC  117

Query  258  ----------------------SMYHgsplllaalgplTGNKIDGHSYHLLCSLVLV  362
                                  SMYHGSPLLL  L PL   +I+G   HLLC  +L+
Sbjct  118  RKEAACLPTGVSLFDALIPSTSSMYHGSPLLLLVLRPLAVKRIEGRPEHLLCRYLLL  174



>gb|ERN00381.1| hypothetical protein AMTR_s00104p00125750 [Amborella trichopoda]
Length=93

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYH  269
            +W WAA ++  RL LI  P +L+F +RPE++TP+TS+RRLAEG WLKQSS SPYAGSMYH
Sbjct  9    YWGWAALALFIRLFLI--PISLSFTSRPEIATPLTSIRRLAEGQWLKQSSFSPYAGSMYH  66

Query  270  gsplllaalgplTGNKIDGHSYHLL  344
            GSPLLL+ LGPLT  +  G   H+L
Sbjct  67   GSPLLLSVLGPLTVCRTGGVPSHIL  91



>gb|ERN00380.1| hypothetical protein AMTR_s00104p00124380 [Amborella trichopoda]
Length=347

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  480  LPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            L SGD+AAL+YL+NP TI  C G +T+P+ENM +++++YGAC G+ PLAAFGW +A+HLS
Sbjct  19   LDSGDVAALIYLFNPLTIAACAGSSTSPIENMMILLTVYGACAGVPPLAAFGWVIATHLS  78



>ref|XP_010064370.1| PREDICTED: mucin-5AC-like [Eucalyptus grandis]
Length=410

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAG  257
            FW W  AS+ F L L+Y P+NL+ +TRPEV+TP+TS+RRL EGYWLKQS+M PYAG
Sbjct  32   FWTWLVASVAFWLTLVYLPRNLHLSTRPEVTTPLTSIRRLGEGYWLKQSAMYPYAG  87



>gb|KIW17861.1| hypothetical protein PV08_05056 [Exophiala spinifera]
Length=402

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 101/187 (54%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +I  RL++++ FP   NF +T+ E+STPV+S +RL EG +L Q  +SPY G +YH +P
Sbjct  14   AGAICLRLLVVFAFPDLPNFLSTQVEISTPVSSFKRLQEGLFLYQHGLSPYDGGVYHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  +LV V  D ++A+ ++    +L+  + +         
Sbjct  74   LLLVIFEI------------LPSTLVFVSLDVLNAVALQTIADNLRIPTPR---------  112

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F+D D    G + A  YL+NPFTI++C+G +T+   +  +I +I  A  G A  A FG 
Sbjct  113  -FKDLD----GSLIAAAYLFNPFTILSCLGKSTSIFTSAAIIQAILNAQSGNALRAMFGL  167

Query  639  TVASHLS  659
             + S+LS
Sbjct  168  AIGSYLS  174



>ref|XP_007754120.1| phosphatidylinositol glycan, class U [Cladophialophora yegresii 
CBS 114405]
 gb|EXJ65553.1| phosphatidylinositol glycan, class U [Cladophialophora yegresii 
CBS 114405]
Length=402

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 99/189 (52%), Gaps = 29/189 (15%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  LV + FP   +F  TR E+STP++S RRL EG +L Q  +SPY G ++H +
Sbjct  13   YAGAALLRLLVFVAFPDITDFLTTRVEISTPISSFRRLQEGLFLYQHGLSPYDGGVFHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVA-DFISAMLIRATGQSLQRASEkslkslgl  452
            PLLL               + ++ S V+ V  D ++AM + +  ++L+  S         
Sbjct  73   PLLLVI-------------FEIIPSTVVFVGLDILNAMSLHSIAENLRIPSP--------  111

Query  453  gklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF  632
               F   D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A F
Sbjct  112  --RFRKLD----GPLIAAAYLFNPFTILSCLGRSTSLFTNAAIIQAVLYASSGDAIRAMF  165

Query  633  GWTVASHLS  659
            G    ++LS
Sbjct  166  GLATGTYLS  174



>ref|XP_640406.2| GPI transamidase subunit PIG-U family protein [Dictyostelium 
discoideum AX4]
 gb|EAL66427.2| GPI transamidase subunit PIG-U family protein [Dictyostelium 
discoideum AX4]
Length=560

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 109/198 (55%), Gaps = 22/198 (11%)
 Frame = +3

Query  108  ASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplll  287
            ++I+ R++L Y   +  F+ R E++TP+TS +RL EG  L++  +SPYAGS YH  PL+L
Sbjct  56   SAILIRIILFYQGFDQLFSNRNEITTPLTSFKRLVEGLHLRELGLSPYAGSAYHQPPLVL  115

Query  288  aa--------lgplTGNKIDGHSYHLL------CSLVLVVADFISAMLIRATGQSLQRAS  425
                            N     + +L+        ++ ++ D I A+++R   + + R  
Sbjct  116  LLFYPFVNSINISNNNNNSGDGNNYLIFGIFEKSQILFLIIDCIIAIVLREIAKQIPRVL  175

Query  426  EkslkslglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGAC  605
             K +K +       +S+ LP  +I A +YL+NPFTI TC+G +T  L N+ +++S+Y + 
Sbjct  176  PKEMKPISA-----NSN-LP--NITAALYLFNPFTIFTCIGMSTINLTNLAIVLSLYYSL  227

Query  606  KGLAPLAAFGWTVASHLS  659
            KG+   + F   +AS+LS
Sbjct  228  KGMIFQSVFSVAMASYLS  245



>ref|XP_003284102.1| hypothetical protein DICPUDRAFT_147853 [Dictyostelium purpureum]
 gb|EGC39428.1| hypothetical protein DICPUDRAFT_147853 [Dictyostelium purpureum]
Length=493

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 96/167 (57%), Gaps = 10/167 (6%)
 Frame = +3

Query  159  FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYH  338
            F+ R E++TP+TS +RL EG  L++  +SPYAGS+YH  PL+L    P+     +   ++
Sbjct  62   FSNRNEIATPLTSFKRLIEGIHLRELGLSPYAGSVYHQPPLVLLLFLPILKMN-EFIQFN  120

Query  339  LLCS-LVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYL  515
            +  S L  V+ D + A+ +R   +S+ +            K      ILP  ++ A +YL
Sbjct  121  ITSSQLFFVLVDCLIAVSLREITKSVSKV------LPNEMKPLSKDSILP--NLTAALYL  172

Query  516  WNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHL  656
            +NPFT+ TC+G +T  L N+ +++S+Y + KG   L+ F  +++++L
Sbjct  173  FNPFTLFTCVGMSTIILTNLAIVLSLYFSLKGKLFLSVFSVSMSAYL  219



>gb|KIW71802.1| hypothetical protein PV04_00035 [Capronia semiimmersa]
Length=402

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 97/188 (52%), Gaps = 27/188 (14%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  LV + FP  + F  TR E+STP++S +RL EG +L Q  +SPY G ++H +
Sbjct  13   YAGAALLRLLVFLAFPGIIEFLTTRVEISTPISSFKRLQEGLFLYQHGLSPYDGGVFHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     +              S V V  D ++A+ + +  ++LQ  S          
Sbjct  73   PLLLVIFEIVP------------PSFVFVGLDLLNAVSLHSIAENLQIPSP---------  111

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F+  D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G    A FG
Sbjct  112  -RFQKLD----GPLIAAAYLFNPFTILSCLGRSTSLFTNAAIIQAVLYASSGDGIRAMFG  166

Query  636  WTVASHLS  659
              + ++LS
Sbjct  167  LAIGTYLS  174



>gb|KIW94595.1| hypothetical protein Z519_04571 [Cladophialophora bantiana CBS 
173.52]
Length=401

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 100/188 (53%), Gaps = 30/188 (16%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +I+ RLV+ + FP   NF T R E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  14   AGAILLRLVIFLAFPDIPNFLTARVEISTPISSFQRLQEGLFLYQHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCS-LVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            LLL               + +L S L+ V  D ++A  ++   + L+  + +        
Sbjct  74   LLLVL-------------FEILPSPLIFVGLDVLNAASLQGIAEELRVPTSR--------  112

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F+  D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A FG
Sbjct  113  --FQKLD----GSLIAAAYLFNPFTILSCLGRSTSIFTNAAIIQAVLNAQSGNAVRAMFG  166

Query  636  WTVASHLS  659
              + S+LS
Sbjct  167  LAIGSYLS  174



>ref|XP_007744954.1| phosphatidylinositol glycan, class U [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ71175.1| phosphatidylinositol glycan, class U [Cladophialophora psammophila 
CBS 110553]
Length=401

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 98/187 (52%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +I+ RLV+ + FP   NF T R E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  14   AGAILLRLVIFLAFPDIPNFLTARVEISTPISSFQRLQEGLFLYQHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  +L+ V  D ++A  ++   + L+  + +         
Sbjct  74   LLLVIFEI------------LPSTLIFVGLDVLNAASLQGIAKELRLPTSR---------  112

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F+  D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A FG 
Sbjct  113  -FQKLD----GSLIAAAYLFNPFTILSCLGRSTSIFTNAAIIQAVLNAQSGNAVRAMFGL  167

Query  639  TVASHLS  659
             + ++LS
Sbjct  168  AIGTYLS  174



>gb|KIV94669.1| hypothetical protein PV10_02413 [Exophiala mesophila]
Length=405

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 94/188 (50%), Gaps = 27/188 (14%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+ +  LV + FP   +F T + E+STP++S +RL EG +L Q  +SPY G ++H +
Sbjct  13   YAGAAAIRLLVFLSFPSLADFLTSQVEISTPISSFKRLQEGLFLYQHGLSPYDGGVFHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL                 L  SLV V  D ++A  + +    LQ ++ +        
Sbjct  73   PLLLVIFDI------------LPASLVFVALDILNAWSLHSIANDLQLSTPR--------  112

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F   D    G + A  YL+NPFTI++C+G +T    N  +I ++  A  G A  A F 
Sbjct  113  --FRKLD----GTLIAAAYLFNPFTILSCLGRSTNIFTNTAIIQAVLNAQSGYAVRAMFA  166

Query  636  WTVASHLS  659
              + S+LS
Sbjct  167  LAIGSYLS  174



>gb|KEQ71380.1| PIG-U-domain-containing protein [Aureobasidium namibiae CBS 147.97]
Length=428

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 87/167 (52%), Gaps = 17/167 (10%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVT  +RL EG +L    +SPY G ++H +P+LL     L     D   Y L+ 
Sbjct  35   RVELSTPVTGFKRLQEGLFLYNHGLSPYDGGVFHQAPILLPLFSLLP----DPTRYPLVT  90

Query  348  SLVLVVADFISA---MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLW  518
             L+  + D  SA   M I A+GQS          +        +S    S  +AA  YL+
Sbjct  91   VLLYTLVDLASAYALMQIFASGQS---------YTTRFFTSSRESKRWSSSAVAA-AYLF  140

Query  519  NPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            NPF I+TC+  +T    N+FV+I+I  AC+G    +AF   +AS++S
Sbjct  141  NPFVILTCLARSTNVFGNLFVLIAILKACRGAVLGSAFALAIASYMS  187



>gb|KIW37113.1| hypothetical protein PV06_10740 [Exophiala oligosperma]
Length=402

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 96/188 (51%), Gaps = 27/188 (14%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A  +  LV   FP   +F +T+ E+STPV+S +RL EG +L Q  +SPY G +YH +
Sbjct  13   YAGAVCLRLLVFFVFPALPDFLSTQVEISTPVSSFKRLQEGLFLYQHGLSPYDGGVYHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL                 L  +LV V  D ++A+ ++    +L+  +          
Sbjct  73   PLLLVIFEI------------LPSTLVFVALDVLNAVALQTIANNLRIPTP---------  111

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              FE  D    G + A  YL+NPFT+++C+G +T+   +  +I +I  A  G A  A FG
Sbjct  112  -RFEKLD----GRLIAAAYLFNPFTVLSCLGKSTSIFTSAAIIQAILNAQSGNAIRAMFG  166

Query  636  WTVASHLS  659
              + S+LS
Sbjct  167  LAMGSYLS  174



>ref|XP_009152706.1| phosphatidylinositol glycan, class U [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52245.1| phosphatidylinositol glycan, class U [Exophiala dermatitidis 
NIH/UT8656]
Length=402

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 92/188 (49%), Gaps = 27/188 (14%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+ +  LV + FP   +F   + E+STP++S +RL EG +L Q  +SPY G ++H +
Sbjct  13   YAGAAFLRLLVFVAFPDLSDFLGNQVEISTPISSFKRLQEGLFLYQHGLSPYDGGVFHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL                 L  +LV V  D I+A  ++     L   + +        
Sbjct  73   PLLLVLFET------------LPSALVFVALDLINAASLQQIANDLHIPTPR--------  112

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F   D    G I A  YL+NPFTI++C+G NT+   N  +I ++  A  G A  A F 
Sbjct  113  --FRKLD----GSIIAAAYLFNPFTILSCLGKNTSIFTNAAIIQAVLNAQSGNAIRAMFS  166

Query  636  WTVASHLS  659
              + ++LS
Sbjct  167  LAIGTYLS  174



>gb|KIV77768.1| hypothetical protein PV11_09549 [Exophiala sideris]
Length=402

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 91/190 (48%), Gaps = 31/190 (16%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A  +  LV + FP   +F +T+ E+STP++S +RL EG +L Q  +SPY G +YH  
Sbjct  13   YAGAIFLRLLVFVAFPDIPDFLSTQVEISTPISSFKRLQEGLFLYQHGLSPYDGGVYHQ-  71

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRAS--Ekslkslg  449
                                     L+L++ +F+ + L+      L  AS    + K   
Sbjct  72   -----------------------APLLLIIFEFLPSTLVFIALDILNAASLHSIADKLHI  108

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
                F+  D    G + A  YL+NPFTI++C+G +T    +  +I ++  A  G A  A 
Sbjct  109  PTPRFQKLD----GSLIAAAYLFNPFTILSCLGRSTVIFTSAAIIQAVLNAQSGNAVRAM  164

Query  630  FGWTVASHLS  659
            FG  + S+LS
Sbjct  165  FGLAIGSYLS  174



>ref|XP_007720395.1| phosphatidylinositol glycan, class U [Capronia coronata CBS 617.96]
 gb|EXJ96166.1| phosphatidylinositol glycan, class U [Capronia coronata CBS 617.96]
Length=402

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 95/188 (51%), Gaps = 27/188 (14%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  LV + FP   +F  ++ E+STP++S +RL EG +L Q  +SPY G +YH +
Sbjct  13   YAGAALLRLLVFVAFPDLSDFLGSQVEISTPISSFKRLQEGLFLYQHGLSPYDGGVYHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL                 L  +LV V  D ++A+ +     +L   S +        
Sbjct  73   PLLLVIFEI------------LPSALVFVALDILNAVSLHTIANNLDIPSRR--------  112

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F   D    G + A  YL+NPFTI++C+G +T+   N  +I +++ A  G    A F 
Sbjct  113  --FRKLD----GTLIAAAYLFNPFTILSCLGKSTSIFTNTAIIQAVFNAQSGNPLRAMFS  166

Query  636  WTVASHLS  659
              + ++LS
Sbjct  167  LAIGTYLS  174



>gb|KIX06694.1| hypothetical protein Z518_04670 [Rhinocladiella mackenziei CBS 
650.93]
Length=400

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 98/187 (52%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVLIYFPKNLN--FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +++ RL++ +   +L+    T+ E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  12   AGAVILRLLVFFGCPDLSDFLTTQVEISTPISSYKRLQEGLFLYQHGLSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  ++V V  D ++A  + +  ++LQ  + +         
Sbjct  72   LLLVIFEI------------LPPAVVFVGLDILNATSLHSIAENLQIPTSR---------  110

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F+  D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A FG 
Sbjct  111  -FQKLD----GSVTAAAYLFNPFTILSCLGRSTSIFTNAAIIQAVLNAQSGKAIRAMFGL  165

Query  639  TVASHLS  659
             + ++LS
Sbjct  166  AMGTYLS  172



>gb|KIW62088.1| hypothetical protein PV05_02139 [Exophiala xenobiotica]
Length=402

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 98/188 (52%), Gaps = 30/188 (16%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A ++  RL++ Y  P   +F +T+ E+STP++S +RL EG +L Q+ +SPY G +YH +P
Sbjct  14   AGAVFLRLLVFYALPDLPDFLSTQVEISTPISSFKRLQEGLFLYQNGLSPYDGGVYHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVA-DFISAMLIRATGQSLQRASEkslkslglg  455
            LLL               + +L S V+ V  D ++A+ +     SL+  S          
Sbjct  74   LLLVI-------------FEILPSTVVFVGLDVLNAVALHTIADSLRLPSP---------  111

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F   D    G + A  YL+NPFTI++C+G +T+   +  +I ++  A  G A  A FG
Sbjct  112  -RFSRLD----GSLIAAAYLFNPFTILSCLGKSTSIFTSAAIIQAVLNAQSGNAVRAMFG  166

Query  636  WTVASHLS  659
              + ++LS
Sbjct  167  LAIGTYLS  174



>gb|KEQ84032.1| GPI transamidase-like protein component PIG-U [Aureobasidium 
pullulans EXF-150]
Length=428

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 89/167 (53%), Gaps = 17/167 (10%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVT  +RL EG +L    +SPY G ++H +PLLL     L         Y L+ 
Sbjct  35   RVELSTPVTGFKRLQEGLFLYNHGLSPYDGGVFHQAPLLLPLFSLLPDPA----RYPLVT  90

Query  348  SLVLVVADFISA---MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLW  518
             L+  + D  SA   M I A+GQS   AS     S        +S    S  +AA  +L+
Sbjct  91   VLLYTLVDLASAYALMQIFASGQSY--ASRFFTSS-------RESQRWSSSAVAA-AHLF  140

Query  519  NPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            NPF ++TC+  +T    N+F+++S+  AC+G A  +AF   +AS++S
Sbjct  141  NPFVVLTCLARSTNVFGNLFILVSVLKACRGAAFGSAFALALASYMS  187



>gb|EFW17847.1| GPI transamidase component PIG-U [Coccidioides posadasii str. 
Silveira]
Length=423

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 96/192 (50%), Gaps = 12/192 (6%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSM  263
            + W + +A ++  L++++FP   +  T R EVSTPV+S +RL EG +L + ++SPY G +
Sbjct  7    KVWVFGSAFLLRLLLIVFFPGLPDLLTGRVEVSTPVSSFKRLQEGLFLYKRNVSPYDGGV  66

Query  264  YHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslks  443
            +H +P+LL     L     +   Y L+  LV +V D ++A        +L R +      
Sbjct  67   FHQAPILLPIFSLLP----EPRDYQLMTGLVYIVLDLLNA-------NALGRIANSDEAV  115

Query  444  lglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
                       I   G   A  YL+NPFTI +C+G +T    N  +I SI  A  G +  
Sbjct  116  APRLYTSPRKHIRWDGTAIAAGYLFNPFTIASCLGRSTNAFTNSAIISSISNAIAGNSFN  175

Query  624  AAFGWTVASHLS  659
            +     +AS++S
Sbjct  176  SMLALGLASYMS  187



>ref|XP_008724561.1| hypothetical protein G647_10348 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI26688.1| hypothetical protein G647_10348 [Cladophialophora carrionii CBS 
160.54]
Length=402

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 97/189 (51%), Gaps = 29/189 (15%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  LV + FP   +F  TR E+STP++S +RL EG +L +  +SPY G ++H +
Sbjct  13   YAGAALLRLLVFVAFPGITDFLTTRVEISTPISSFKRLQEGLFLYKHGLSPYDGGVFHQA  72

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVA-DFISAMLIRATGQSLQRASEkslkslgl  452
            PLLL               + ++ S V+    D ++A+ + +   +LQ  S         
Sbjct  73   PLLLVI-------------FEIVPSTVIFTGLDILNAVSLHSIADNLQLPSP--------  111

Query  453  gklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF  632
               F+  D    G + A  YL NPFTI++C+G +T+   N  +I ++  A  G A  A  
Sbjct  112  --RFQKLD----GSLIAAAYLSNPFTILSCLGRSTSLFTNAAIIQAVLHASSGDAIRAML  165

Query  633  GWTVASHLS  659
            G  + ++LS
Sbjct  166  GLAIGTYLS  174



>gb|KIW82792.1| hypothetical protein Z517_02035 [Fonsecaea pedrosoi CBS 271.37]
Length=401

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 94/187 (50%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +IV RLV+ + FP   +F T R E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  14   AGAIVLRLVIFLAFPDIPDFLTARVEISTPISSFQRLQEGLFLYQHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  +LV V  D ++A  +      L+  +           
Sbjct  74   LLLVIFEI------------LPPTLVFVGLDVLNAASLHVIADDLRIPTS----------  111

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F   D    G + A  YL+NPFTI++C+G +T+   N  +I +++ A  G A  A F  
Sbjct  112  RFHQLD----GSLIAAGYLFNPFTILSCLGRSTSIFTNAAIIQAVFNAQSGNAIRAMFAL  167

Query  639  TVASHLS  659
             + ++LS
Sbjct  168  AIGTYLS  174



>gb|EAS30072.3| GPI transamidase component PIG-U [Coccidioides immitis RS]
Length=423

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 96/192 (50%), Gaps = 12/192 (6%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSM  263
            + W + +A ++  L++++FP   +  T R EVSTPV+S +RL EG +L + ++SPY G +
Sbjct  7    KVWVFGSAFLLRLLLIVFFPGLPDLLTGRVEVSTPVSSFKRLQEGLFLYKRNVSPYDGGV  66

Query  264  YHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslks  443
            +H +P+LL     L     +   Y L+  LV +V D ++A        +L R +      
Sbjct  67   FHQAPILLPIFSLLP----EPRDYQLVTGLVYIVLDLLNA-------NALGRIANSDEAV  115

Query  444  lglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
                       I   G   A  YL+NPFTI +C+G +T    N  +I SI  A  G +  
Sbjct  116  APRLYTSPRKHIRWDGTAIAAGYLFNPFTIASCLGRSTNAFTNSAIISSISNAIAGNSFN  175

Query  624  AAFGWTVASHLS  659
            +     +AS++S
Sbjct  176  SMLALGLASYMS  187



>gb|KIW26532.1| hypothetical protein PV07_09619 [Cladophialophora immunda]
Length=401

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 93/187 (50%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +IV RLV+ + FP    F T R E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  14   AGAIVLRLVIFLAFPDVPEFLTARVEISTPISSFQRLQEGLFLYQHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  +LV V  D ++A  ++     L+  +           
Sbjct  74   LLLVIFEM------------LPPTLVFVGLDVLNAASLQVIADKLRIPTS----------  111

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F   D    G + A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A F  
Sbjct  112  RFHQLD----GSLIAAAYLFNPFTILSCLGRSTSIFTNAAIIQAVLNAQSGNAIRAMFAL  167

Query  639  TVASHLS  659
             + ++LS
Sbjct  168  AIGTYLS  174



>gb|KEQ98049.1| hypothetical protein AUEXF2481DRAFT_27382 [Aureobasidium subglaciale 
EXF-2481]
Length=428

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 87/167 (52%), Gaps = 17/167 (10%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVT  +RL EG +L    +SPY G ++H +PLLL     L         Y L+ 
Sbjct  35   RVELSTPVTGFKRLREGLFLYNHGLSPYDGGVFHQAPLLLPLFSLLPDPT----RYPLVT  90

Query  348  SLVLVVADFISA---MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLW  518
             L+  + D  SA   M I A+GQS          +        +S    S  +AA  YL+
Sbjct  91   VLLYTLVDLASAYALMQIFASGQS---------YATRFFTSSRESKRWSSSAVAA-TYLF  140

Query  519  NPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            NPF I+TC+  +T    N+F+++S+  AC+G    +AF  ++AS++S
Sbjct  141  NPFIILTCLARSTNVFGNLFILLSVLKACRGAPIGSAFALSMASYMS  187



>gb|EZF35547.1| hypothetical protein H101_00928 [Trichophyton interdigitale H6]
Length=354

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 90/187 (48%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A++  RLVLI  FP   +  T R EVSTP++S +RL EG +L   ++SPY G ++H +P
Sbjct  12   GAAVALRLVLILLFPGLPDLLTGRVEVSTPISSFKRLQEGLFLYLRNVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            + L     +       H Y +L  LV  + D I+A        +L   S      +    
Sbjct  72   IFLPLFSLIP----QSHGYTILTVLVYTLLDLINA-------NALIEISNSGESVVSRLF  120

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 +I   G    + YL+NPFTI TC+G  TT   N  +I +I  A  G +  +    
Sbjct  121  SSPRKNIRWDGIAIVIGYLFNPFTIATCLGRPTTAFTNTAIIYAISNAIAGRSINSMLAL  180

Query  639  TVASHLS  659
             +AS+LS
Sbjct  181  GLASYLS  187



>ref|XP_004359162.1| GPI transamidase subunit PIG-U family protein [Dictyostelium 
fasciculatum]
 gb|EGG21312.1| GPI transamidase subunit PIG-U family protein [Dictyostelium 
fasciculatum]
Length=485

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (52%), Gaps = 17/180 (9%)
 Frame = +3

Query  123  RLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgp  302
            R++L Y   +   + R E+STP+TS +RL EG +L Q  +SPY+GS +H  PLLL     
Sbjct  61   RIILYYNGFHHILSERNEISTPITSFKRLTEGLYLNQLGLSPYSGSAFHQPPLLLVLFKA  120

Query  303  lTGNKIDGHSYHLLCSLVL-VVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDI  479
                  D  S+ LL   VL +V   +SA+L+R     + R   K +K             
Sbjct  121  FN----DNSSFVLLRPQVLFLVISILSAILLRRIAVLVPRVLPKEMKQSI----------  166

Query  480  LPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
              S +I   ++L+NPF+I++ +G +T  + N+ ++ ++Y   KG   L  F    A++LS
Sbjct  167  --SPNIVVAMFLFNPFSILSDVGMSTIAVNNLVILCALYFTLKGNLFLGVFSVAAAAYLS  224



>gb|EGD97243.1| GPI transamidase component PIG-U [Trichophyton tonsurans CBS 
112818]
Length=423

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 90/187 (48%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A++  RLVLI  FP   +  T R EVSTP++S +RL EG +L   ++SPY G ++H +P
Sbjct  12   GAAVALRLVLILLFPGLPDLLTGRVEVSTPISSFKRLQEGLFLYLRNVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            + L     +       H Y +L  LV  + D I+A        +L   S      +    
Sbjct  72   IFLPLFSLIP----QSHGYTILTVLVYTLLDLINA-------NALIEISNSGESVVSRLF  120

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 +I   G    + YL+NPFTI TC+G  TT   N  +I +I  A  G +  +    
Sbjct  121  SSPRKNIRWDGIAIVIGYLFNPFTIATCLGRPTTAFTNTAIIYAISNAIAGRSINSMLAL  180

Query  639  TVASHLS  659
             +AS+LS
Sbjct  181  GLASYLS  187



>gb|KDN64021.1| putative GPI transamidase subunit PIG-U [Colletotrichum sublineola]
Length=427

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 99/189 (52%), Gaps = 14/189 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+++  L+ + FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +
Sbjct  16   YVAAAVLRLLLFVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQA  75

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PL L           D  S  +   L+ V+ D +SA+ +     S +  S +   S   G
Sbjct  76   PLFLPLFS----LLPDPKSLPIFTYLLYVLVDILSAIALSRIADSGEAGSSRLFTSPRRG  131

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF-  632
            K +       SG + A ++L+NPFTI TC+G +T+      ++ SI  A  G APL A  
Sbjct  132  KRW-------SGLVVASLFLFNPFTIATCVGRSTSVFSTCAILHSIAKAISG-APLGAMV  183

Query  633  GWTVASHLS  659
              + A++LS
Sbjct  184  ALSFATYLS  192



>dbj|GAM23439.1| hypothetical protein SAMD00019534_066140, partial [Acytostelium 
subglobosum LB1]
Length=459

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 94/191 (49%), Gaps = 26/191 (14%)
 Frame = +3

Query  108  ASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplll  287
             +++ RLVL Y   +   + R E+STP+T  +RL EG  L    +SPYAGS YH +PLLL
Sbjct  44   VAVILRLVLYYQGFHNVLSQRNEISTPLTGFKRLTEGLHLHTLGLSPYAGSAYHQAPLLL  103

Query  288  aalgplTGNKIDGHSYHLLCS-LVLVVADFISAMLIR----ATGQSLQRASEkslkslgl  452
             A        +  H  H++ S L+ V+ D I A L+R      G  L +           
Sbjct  104  LAF-------MPLHGLHIIASQLMFVLVDVIIAYLLRRITVLAGSVLPQEMG--------  148

Query  453  gklFEDSDILPSG--DIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLA  626
                 D  +  S   ++ A +YL+NPFT+ T +G +T    N+ +I S+Y A  G   L+
Sbjct  149  ----GDPKLAQSNFPNVVAAIYLFNPFTLFTSVGMSTIVFNNLSIIASLYFALSGNMFLS  204

Query  627  AFGWTVASHLS  659
             F    A ++S
Sbjct  205  LFSVASAVYIS  215



>gb|EFW98771.1| GPI transamidase component [Grosmannia clavigera kw1407]
Length=429

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 93/178 (52%), Gaps = 13/178 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+ V   +  +FP+  +  T R E+STPVTS +RL EG +L   ++SPY G +YH +
Sbjct  17   YVAAAAVRLFLFTFFPRLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQA  76

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    +  +   L+ +V D + A  + +  +S +  +    KS    
Sbjct  77   PLLLPLFSLLPSVK----TLPIFTDLLYIVVDLLCASALYSIAESGEAGASARFKS----  128

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
                  D   SG + A V+L+NPFTI TC+G +TT      ++ +I  A  G AP++A
Sbjct  129  ---PRRDKRWSGFVIAAVFLFNPFTIATCVGRSTTVFSTCAILYAIARAIAG-APISA  182



>ref|XP_003232922.1| GPI transamidase component PIG-U [Trichophyton rubrum CBS 118892]
 gb|EGD90686.1| hypothetical protein TERG_06912 [Trichophyton rubrum CBS 118892]
 gb|EZF25576.1| hypothetical protein H100_02150 [Trichophyton rubrum MR850]
 gb|EZF44542.1| hypothetical protein H102_02148 [Trichophyton rubrum CBS 100081]
 gb|EZF55330.1| hypothetical protein H103_02157 [Trichophyton rubrum CBS 288.86]
 gb|EZF65814.1| hypothetical protein H104_02133 [Trichophyton rubrum CBS 289.86]
 gb|EZF76526.1| hypothetical protein H105_02165 [Trichophyton soudanense CBS 
452.61]
 gb|EZF87246.1| hypothetical protein H110_02153 [Trichophyton rubrum MR1448]
 gb|EZF97954.1| hypothetical protein H113_02156 [Trichophyton rubrum MR1459]
 gb|EZG08822.1| hypothetical protein H106_02014 [Trichophyton rubrum CBS 735.88]
 gb|EZG19486.1| hypothetical protein H107_02222 [Trichophyton rubrum CBS 202.88]
 gb|KDB36321.1| hypothetical protein H112_02153 [Trichophyton rubrum D6]
Length=423

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 89/187 (48%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A++  RLVLI  FP   +  T R EVSTP++S +RL EG +L    +SPY G ++H +P
Sbjct  12   GAAVALRLVLILLFPGLPDLLTGRVEVSTPISSFKRLQEGLFLYLRDVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            +LL     +       H Y +L  LV  + D I+A        +L   S      +    
Sbjct  72   ILLPLFSLIP----QSHGYTILTVLVYTLLDLINA-------NALIEISSSGESVVSRLF  120

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                  I   G    + YL+NPFTI TC+G  TT   N  +I +I  A  G +  +    
Sbjct  121  TSPRKKIRWDGIAIVVGYLFNPFTIATCLGRPTTAFTNSAIIYAISNAIAGRSVNSMLAL  180

Query  639  TVASHLS  659
             +AS+LS
Sbjct  181  GLASYLS  187



>gb|EFA79190.1| GPI transamidase subunit PIG-U family protein [Polysphondylium 
pallidum PN500]
Length=365

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 85/167 (51%), Gaps = 19/167 (11%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STP+T+ +RL EG  L    +SPYAGS YH +PLLL    P   +         L 
Sbjct  49   RNEISTPLTAFKRLIEGLHLHSVGLSPYAGSAYHQAPLLLLLFKPFYESVA-------LS  101

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSG---DIAALVYLW  518
             L+ +V D + A+L+R+    + +          L        I P+    ++ A +YL+
Sbjct  102  QLLFIVVDVVIAILLRSITYRVPKV---------LPLEMSGDQIPPTSNFPNVVAALYLF  152

Query  519  NPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            NPFT+ T +G +T    N+ VI S+Y A KG    + F   ++S+LS
Sbjct  153  NPFTLFTSIGMSTIVFNNLSVITSLYFALKGNQFQSLFFVAMSSYLS  199



>ref|XP_007777925.1| phosphatidylinositol glycan, class U [Coniosporium apollinis 
CBS 100218]
 gb|EON62608.1| phosphatidylinositol glycan, class U [Coniosporium apollinis 
CBS 100218]
Length=423

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+ +  L+   FP   +  T R E+STPVTS +RL EG +L   ++SPY G ++H  
Sbjct  11   FGAAAAIRLLLFAAFPSLPDLLTGRVEISTPVTSFKRLQEGLFLYTHNVSPYDGGIFH--  68

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
                  L PL     D  ++ L  +L+ ++AD  SA        +L + +E +       
Sbjct  69   --QAPLLLPLFSLLPDIRAHPLAANLLYILADLCSA-------NALMQIAETAESVSSRL  119

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  ++  S    A  +L+NP TI+T +   T+   N F+++SI  AC G A      
Sbjct  120  FTSPRKELRWSSTAIAAGFLFNPLTILTTLARPTSVFTNTFILLSIAKACTGSAMTMIIA  179

Query  636  WTVASHLS  659
             ++AS+LS
Sbjct  180  LSIASYLS  187



>ref|XP_003070612.1| GPI transamidase subunit PIG-U family protein [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER28467.1| GPI transamidase subunit PIG-U family protein [Coccidioides posadasii 
C735 delta SOWgp]
Length=405

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 88/192 (46%), Gaps = 30/192 (16%)
 Frame = +3

Query  87   QFWRWAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSM  263
            + W + +A ++  L++++FP   +  T R EVSTPV+S +RL EG +L + ++SPY G +
Sbjct  7    KVWVFGSAFLLRLLLIVFFPGLPDLLTGRVEVSTPVSSFKRLQEGLFLYKRNVSPYDGGV  66

Query  264  YHgsplllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslks  443
            +H                       L+  LV +V D ++A        +L R +      
Sbjct  67   FH----------------------QLMTGLVYIVLDLLNA-------NALGRIANSDEAV  97

Query  444  lglgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPL  623
                       I   G   A  YL+NPFTI +C+G +T    N  +I SI  A  G +  
Sbjct  98   APRLYTSPRRHIRWDGTAIAAGYLFNPFTIASCLGRSTNAFTNSAIISSISNAIAGNSFN  157

Query  624  AAFGWTVASHLS  659
            +     +AS++S
Sbjct  158  SMLALGLASYMS  169



>ref|XP_010032918.1| PREDICTED: uncharacterized protein LOC104422325 [Eucalyptus grandis]
Length=123

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +3

Query  90   FWRWAAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYA  254
            FW W  AS+ FRL L+Y  +NL  +TRPEV+TP+TS   L +GYWLKQ  +S ++
Sbjct  27   FWIWLVASVAFRLALVYLLRNLRLSTRPEVATPLTSSCHLGKGYWLKQFHVSRFS  81



>gb|KEQ63334.1| GPI transamidase-like protein component PIG-U [Aureobasidium 
melanogenum CBS 110374]
Length=428

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 83/167 (50%), Gaps = 17/167 (10%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVT  +R  EG +L    +SPY G ++H +PLLL     L         Y L+ 
Sbjct  35   RVELSTPVTGFKRFQEGLFLYNHGLSPYDGGVFHQAPLLLPLFSLLPDPT----RYPLVT  90

Query  348  SLVLVVADFISA---MLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLW  518
             L+  + D  SA   M I A+GQS          +        +S    S  +AA  YL+
Sbjct  91   VLLYTIVDLASAYALMQIFASGQS---------YATRFFTSSRESKRWSSSAVAA-AYLF  140

Query  519  NPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            NPF I+TC+  +T    N+FV+++   AC+G    ++    +AS++S
Sbjct  141  NPFIILTCLARSTNAFGNLFVLVATAKACRGAFLTSSLALAIASYMS  187



>gb|KFH62554.1| hypothetical protein MVEG_11947 [Mortierella verticillata NRRL 
6337]
Length=426

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 86/162 (53%), Gaps = 9/162 (6%)
 Frame = +3

Query  174  EVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLCSL  353
            E+STPVTS +R++EG +L ++ + PY G  +H +PLLL    P+        S  LL  L
Sbjct  37   EISTPVTSFKRMSEGVFLFKNGVPPYDGGAFHQAPLLLGLFYPII-------SSSLLVKL  89

Query  354  VLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPFTI  533
            +  ++D +   ++         AS K  K    G   E + +  +G   A +YL+NP+TI
Sbjct  90   LYTLSDLVIGYMLLQITSLKDMASAKENKIREYGNRPEAAGM--TGLTVATLYLFNPYTI  147

Query  534  VTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            V+C+G +T    NM V+  I+   KG   LA F   VAS+LS
Sbjct  148  VSCIGRSTIIFSNMAVVAGIWMGMKGDRALALFSIAVASYLS  189



>gb|KIX93971.1| hypothetical protein Z520_10308 [Fonsecaea multimorphosa CBS 
102226]
Length=401

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 92/187 (49%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A +IV RLV+ + FP   +   TR E+STP++S +RL EG +L Q  +SPY G ++H +P
Sbjct  14   AGAIVLRLVVFVAFPDIPDLLTTRVEISTPISSFQRLQEGLFLYQHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L  +LV V  D ++A  ++     L+  +           
Sbjct  74   LLLVIFEI------------LPPTLVFVGLDVLNAASLQVIADGLRIPTS----------  111

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F   D    G + A  YL+NPFTI++C+G +T+      +I ++  A  G A  A F  
Sbjct  112  RFHQLD----GSLIAAAYLFNPFTILSCLGRSTSIFTTAAIIQAVLNAQSGNAIRAMFAL  167

Query  639  TVASHLS  659
             + ++LS
Sbjct  168  AMGTYLS  174



>ref|XP_011561007.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Plutella xylostella]
Length=429

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 87/171 (51%), Gaps = 13/171 (8%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            + R E++TP+ S +RL EG +L    ++PY G  +H SP++L     L   K+       
Sbjct  27   SNRVEIATPLNSWKRLTEGVYLYDHDVNPYEGDAFHESPIMLIVFHFLM-KKVP-----Y  80

Query  342  LCSLVLVVADFISAMLIRATGQSL-------QRASEkslkslglgklFEDSDILPSGDIA  500
            L  L+  + D I+A L+  T +S        Q +++  +     G L +DSD+    +  
Sbjct  81   LLPLIFTIIDLITAHLLYKTAKSFVAMFKDAQESAKDEVAEESKGMLLQDSDLAEVPNYV  140

Query  501  ALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASH  653
              VYL+NP++++ C+G  TT ++N+ V  +++ A      LA     +A+H
Sbjct  141  LSVYLFNPYSVLNCVGMTTTVVQNVLVTGALWSAAGSQQVLACLCLALATH  191



>gb|KEZ45954.1| hypothetical protein SAPIO_CDS1343 [Scedosporium apiospermum]
Length=421

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 97/188 (52%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +AAA+ V  L+ + FP   +  T R EVSTPVTS +R  EG +L   ++SPY G ++H +
Sbjct  11   YAAAASVRLLLFVAFPGLADLLTGRVEVSTPVTSFKRFQEGLYLYNHNVSPYNGGIFHQA  70

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L  N+    +  ++  L+ +V D ++A  +     S +  S +   S    
Sbjct  71   PLLLPFFSLLPDNR----TLPIITFLLYIVLDILTADALSKIADSGEAGSTRLFTSPRKE  126

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K +       SG   A  YL+NPFT+ TC+G +T+   +  ++ +   A +G +  +   
Sbjct  127  KKW-------SGVQVAAAYLFNPFTVATCLGRSTSVFTSFMIVYATSKAVQGKSLSSMVA  179

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  180  ISFASYLS  187



>gb|EGZ76965.1| PIG-U-domain-containing protein [Neurospora tetrasperma FGSC 
2509]
Length=427

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 90/188 (48%), Gaps = 15/188 (8%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +P
Sbjct  16   AGAAVLRLALFTLFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAP  75

Query  279  lllaalgplTGNKIDGHS-YHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            LLL        N +   S + +   L+ +  D +SA        +L R +E         
Sbjct  76   LLLPIF-----NLLPSFSAFPIFTYLLYIAIDILSA-------HALSRIAESGEAGSSAR  123

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  D   SG I A ++L+NPFTI TC+G +TT      ++ +I  A  G    A   
Sbjct  124  FTSPRRDKRWSGAIIAALFLFNPFTIATCIGRSTTVFTTCAILHAIANAISGRPFHAMVA  183

Query  636  WTVASHLS  659
               AS+LS
Sbjct  184  LAFASYLS  191



>ref|XP_011554688.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Plutella xylostella]
Length=433

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 87/171 (51%), Gaps = 13/171 (8%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            + R E++TP+ S +RL EG +L    ++PY G  +H SP++L     L   K+       
Sbjct  31   SNRVEIATPLNSWKRLTEGVYLYDHDVNPYEGDAFHESPIMLIVFHFLM-KKVP-----Y  84

Query  342  LCSLVLVVADFISAMLIRATGQSL-------QRASEkslkslglgklFEDSDILPSGDIA  500
            L  L+  + D I+A L+  T +S        Q +++  +     G L +DSD+    +  
Sbjct  85   LLPLIFTIIDLITAHLLYKTAKSFVAMFKDAQESAKDEVAEESKGMLLQDSDMAEVPNYV  144

Query  501  ALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASH  653
              VYL+NP++++ C+G  TT ++N+ V  +++ A      LA     +A+H
Sbjct  145  LSVYLFNPYSVLNCVGMTTTVVQNVLVTGALWSAAGSQQVLACLCLALATH  195



>gb|KEF63180.1| phosphatidylinositol glycan, class U [Exophiala aquamarina CBS 
119918]
Length=403

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 90/187 (48%), Gaps = 28/187 (15%)
 Frame = +3

Query  105  AASIVFRLVLIYFPKNL-NFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A ++V RL++     NL +F T + E+STP++S +RL EG +L +  +SPY G ++H +P
Sbjct  14   AGAVVIRLIVFLIWPNLSDFLTAQVEISTPISSFKRLQEGLFLYRHGLSPYDGGVFHQAP  73

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL                 L   LV +  D ++ + +      L+  S +         
Sbjct  74   LLLVVFDI------------LPAPLVFIALDTVNGLALHTIADKLRIPSPRFRNL-----  116

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                     SG + A  YL+NP TI++C+G +TT   N  +I ++  A  G    A FG 
Sbjct  117  ---------SGSLIAAAYLFNPLTILSCLGKSTTIFTNTAIIQAVLNAQAGNRVRAMFGL  167

Query  639  TVASHLS  659
             V S+LS
Sbjct  168  AVGSYLS  174



>ref|XP_008719190.1| hypothetical protein HMPREF1541_06638 [Cyphellophora europaea 
CBS 101466]
 gb|ETN38601.1| hypothetical protein HMPREF1541_06638 [Cyphellophora europaea 
CBS 101466]
Length=404

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 89/171 (52%), Gaps = 28/171 (16%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + VFRL + + FP   +  +T+ E+STPV+S +R+ EG +L +  +SPY G ++H +P
Sbjct  12   AGAAVFRLAVFFLFPSIPDLLSTQVELSTPVSSFKRVKEGLFLYERGVSPYDGGLFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL   G                SLV    D +SA  ++    +++ AS +         
Sbjct  72   LLLTIFGLFP------------PSLVFTALDIVSATALKTLADNVRLASPR---------  110

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
             F+  D    G++ A  YL+NPFTI +C G +T+ L N  +I S+  A +G
Sbjct  111  -FKPLD----GNVIAAAYLFNPFTIFSCFGCSTSVLTNTAIIQSVLSAHQG  156



>ref|XP_007711525.1| hypothetical protein COCCADRAFT_94165 [Bipolaris zeicola 26-R-13]
 gb|EUC34152.1| hypothetical protein COCCADRAFT_94165 [Bipolaris zeicola 26-R-13]
Length=423

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 81/150 (54%), Gaps = 11/150 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R EVSTPVTS +RL EG +L   ++SPY G +YH +PLLL     L+   +   + ++
Sbjct  34   AGRVEVSTPVTSFKRLQEGLFLYTHNVSPYDGGVYHQAPLLLPLFALLSHPAVAPLATYV  93

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
              +LV    D +SA        SL + ++    S+         D+  S    A+ +L+N
Sbjct  94   FFTLV----DLLSA-------HSLAQLADTGFASVTRLFASPRKDLRWSSAAIAVGFLFN  142

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKG  611
            PFT+ TC+  +T+ L N+FV+ ++  A +G
Sbjct  143  PFTVATCLARSTSALTNLFVLTAMAKASRG  172



>ref|XP_009855795.1| hypothetical protein NEUTE1DRAFT_90147 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO52153.1| hypothetical protein NEUTE1DRAFT_90147 [Neurospora tetrasperma 
FGSC 2508]
Length=427

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 90/188 (48%), Gaps = 15/188 (8%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +P
Sbjct  16   AGAAVLRLALFTLFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAP  75

Query  279  lllaalgplTGNKIDGHS-YHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            LLL        N +   S + +   L+ +  D +SA        +L R +E         
Sbjct  76   LLLPIF-----NLLPSFSAFPIFTYLLYIAIDILSA-------HALLRIAESGEAGSSAR  123

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  D   SG I A ++L+NPFTI TC+G +TT      ++ +I  A  G    A   
Sbjct  124  FTSPRRDKRWSGAIVAALFLFNPFTIATCIGRSTTVFTTCAILHAIANAISGRPFHAMVA  183

Query  636  WTVASHLS  659
               AS+LS
Sbjct  184  LAFASYLS  191



>ref|XP_007592069.1| GPI transamidase subunit PIG-U [Colletotrichum fioriniae PJ7]
 gb|EXF84278.1| GPI transamidase subunit PIG-U [Colletotrichum fioriniae PJ7]
Length=427

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 80/154 (52%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PL L           D  S+ +  
Sbjct  40   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLFLPLFS----LLPDLKSFPIFT  95

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             L+ ++ D +SA+ +     S +  S +   S    K +       SG + A +YL+NPF
Sbjct  96   YLLYILVDILSAVALSKIADSGEAGSSRLFSSPRRSKRW-------SGLVVASLYLFNPF  148

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            TI TC+G +T+      ++ ++  A  G APL A
Sbjct  149  TIATCIGRSTSVFSTCAILHAVAKAIAG-APLGA  181



>gb|KFZ16389.1| hypothetical protein V502_05131 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=365

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  12   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  68

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  69   -QAPLLLPFFSLLPNYSTWPIFTNIIYILVDLLSALALMKIAESGESVSTKLYTSPRKER  127

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+      ++ +I  A  G +  + F  
Sbjct  128  RWSSTKI-------AAFFLFNPFTIATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAL  180

Query  639  TVASHLS  659
              AS+LS
Sbjct  181  AFASYLS  187



>gb|ELR05449.1| hypothetical protein GMDG_01744 [Pseudogymnoascus destructans 
20631-21]
Length=424

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SAM +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYATWPIFTNIIYILVDLLSAMALMKIAESGESVSTKHYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFT+ TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTLATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAL  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>ref|XP_001791507.1| hypothetical protein SNOG_00836 [Phaeosphaeria nodorum SN15]
 gb|EAT92331.1| hypothetical protein SNOG_00836 [Phaeosphaeria nodorum SN15]
Length=419

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R EVSTPVTS +RL EG +L   ++SPY G +YH +PLLL     L         Y +  
Sbjct  32   RVEVSTPVTSFKRLQEGVFLYTHNVSPYDGGIYHQAPLLLPLFALLPSPT----DYPIAT  87

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             ++ +V D +SA  I     S Q  + +   S      +    I          +L+NPF
Sbjct  88   DVLYIVVDLLSAYAIGQIANSGQNVATRLFTSSRKNLRWSSLAITAG-------FLFNPF  140

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+  +T+   N+F++ +I  A +G +       + A++LS
Sbjct  141  TIATCLARSTSAFSNLFILTAIAKASQGASSTFILALSFAAYLS  184



>ref|XP_007737222.1| phosphatidylinositol glycan, class U [Capronia epimyces CBS 606.96]
 gb|EXJ79434.1| phosphatidylinositol glycan, class U [Capronia epimyces CBS 606.96]
Length=402

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 83/174 (48%), Gaps = 27/174 (16%)
 Frame = +3

Query  141  FPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNK  317
            FP   +F   + E+STP++S +RL EG +L Q  +SPY G +YH +PLLL          
Sbjct  27   FPDLSDFLGEQVEISTPISSFKRLQEGLFLYQHGLSPYDGGVYHQAPLLLVIFEI-----  81

Query  318  IDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDI  497
                   L  +LV V  D  +A  +    + L   + +          F   D    G I
Sbjct  82   -------LPSALVFVALDLSNAASLHMIAEGLHLPTPR----------FRKLD----GSI  120

Query  498  AALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
             A  YL+NPFTI++C+G +T+   N  +I ++  A  G A  A F   + ++LS
Sbjct  121  IAAAYLFNPFTILSCLGKSTSIFTNTAIIQAVLNAQSGNAFRAMFSLAIGTYLS  174



>ref|XP_007806265.1| hypothetical protein EPUS_06938 [Endocarpon pusillum Z07020]
 gb|ERF68127.1| hypothetical protein EPUS_06938 [Endocarpon pusillum Z07020]
Length=360

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 89/187 (48%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFR-LVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            AA+IV R LV  +FP+     T + EVSTPV+S +RL EG +L   ++SPY G ++H +P
Sbjct  12   AAAIVGRILVFAFFPQLPELLTGQVEVSTPVSSYKRLQEGLFLYIRNVSPYEGGIFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL     L G      S  L   L+  + D        A   +L + ++          
Sbjct  72   LLLPLFSLLPGRS----SISLTTGLLYTLMDL-------ANANALAKIADSGEAVSSRLF  120

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 +    G   ++ YL+NPFTI  C G +T+   N  ++ ++  A  G    A F  
Sbjct  121  TSPRKETRLDGAALSIAYLFNPFTIAGCFGRSTSAFTNTAIVHAVSNAVTGSPFRAMFAL  180

Query  639  TVASHLS  659
             +AS+LS
Sbjct  181  ALASYLS  187



>ref|XP_007585520.1| putative gpi transamidase component pig-u protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD47014.1| putative gpi transamidase component pig-u protein [Neofusicoccum 
parvum UCRNP2]
Length=424

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 12/163 (7%)
 Frame = +3

Query  126  LVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgp  302
             + + FP   N  T R E+STPVTS +RL EG +L   ++SPY G ++H        L P
Sbjct  20   FLFVAFPSLPNLLTDRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVFH----QAPLLLP  75

Query  303  lTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDIL  482
            L     D +S+ L  +LV +  D +SA        ++ R +E               D+ 
Sbjct  76   LFSLLPDIYSFPLATNLVYIAVDLLSA-------NAMMRIAETGENVSSRLFTSPRKDLR  128

Query  483  PSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
             S    A  YL+NPF I T +G  T+ + ++ ++ SI  A +G
Sbjct  129  WSSLAVAAGYLFNPFIIATMLGRPTSAITSLLLLTSIASAARG  171



>gb|KFA76780.1| hypothetical protein S40288_08645 [Stachybotrys chartarum IBT 
40288]
Length=421

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STP+TS +RL EG +L   ++SPY G +YH  
Sbjct  10   FAGAALLRLILFVAFPGLPDLLTGRVEISTPITSFKRLQEGLFLYNHNVSPYDGGVYH--  67

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
                  L PL     D  ++ +  SL+ ++ D +SA        +L + +E         
Sbjct  68   --QAPLLLPLFSLLPDVKTWPIFTSLLYILVDLLSA-------DALIKIAESGEAGQSKH  118

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                      SG + A  YL+NP TI TC+G  T+   N  ++ +I     G    A   
Sbjct  119  FTSPRRGKRASGLLVAAAYLFNPLTIATCIGRPTSVFTNCAILQAISKVITGSPFSAVVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>ref|XP_003351660.1| hypothetical protein SMAC_00202 [Sordaria macrospora k-hell]
 emb|CCC05986.1| unnamed protein product [Sordaria macrospora k-hell]
Length=427

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 90/188 (48%), Gaps = 15/188 (8%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +P
Sbjct  16   AGAAVLRLALFTLFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAP  75

Query  279  lllaalgplTGNKIDGHS-YHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            LLL        N +   S + +   L+ +  D +SA        +L R +E         
Sbjct  76   LLLPIF-----NLLPSFSTFPIFTYLLYIAVDILSA-------DALLRIAESGEAGSSAR  123

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  D   SG + A ++L+NPFTI TC+G +TT      ++ ++  A  G    A   
Sbjct  124  FTSPRRDKRWSGAVVAALFLFNPFTIATCIGRSTTVFTTCAILHAVANAISGRHFHAMVA  183

Query  636  WTVASHLS  659
               AS+LS
Sbjct  184  LAFASYLS  191



>ref|XP_964750.3| glycosylphosphatidylinositol transamidase 2 [Neurospora crassa 
OR74A]
 emb|CAE76579.1| related to cell division control protein CDC91 [Neurospora crassa]
 gb|EAA35514.3| glycosylphosphatidylinositol transamidase 2 [Neurospora crassa 
OR74A]
 gb|KHE81808.1| PIG-U-domain-containing protein [Neurospora crassa]
Length=427

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 90/187 (48%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +P
Sbjct  16   AGAAVLRLALFTLFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAP  75

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL     L        ++ +   L+ +  D +SA        +L R +E    S     
Sbjct  76   LLLPIFNLLPSFA----AFPIFTYLLYIAIDILSA-------HALLRIAESGEASSSARF  124

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 D   SG I A ++L+NPFTI TC+G +TT      ++ ++  A  G    A    
Sbjct  125  TSPRRDKRWSGAIIAALFLFNPFTIATCIGRSTTVFTTCAILHAVANAISGRPFHAMVAL  184

Query  639  TVASHLS  659
              AS+LS
Sbjct  185  AFASYLS  191



>gb|KEY64722.1| hypothetical protein S7711_09337 [Stachybotrys chartarum IBT 
7711]
 gb|KFA53685.1| hypothetical protein S40293_03889 [Stachybotrys chartarum IBT 
40293]
Length=421

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 89/188 (47%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STP+TS +RL EG +L   ++SPY G +YH  
Sbjct  10   FAGAALLRLILFVAFPGLPDLLTGRVEISTPITSFKRLQEGLFLYNHNVSPYDGGVYH--  67

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
                  L PL     D  ++ +  SL+ ++ D +SA        +L + +E         
Sbjct  68   --QAPLLLPLFSLLPDVKTWPIFTSLLYILVDLLSA-------DALIKIAESGEAGQSKH  118

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                      SG + A  YL+NP TI TC+G  T+   N  ++ +I     G    A   
Sbjct  119  FTSPRRGKRASGLLVAAAYLFNPLTIATCIGRPTSVFTNCAILQAISKVIAGSPFSAVVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>gb|EUN29626.1| hypothetical protein COCVIDRAFT_35499 [Bipolaris victoriae FI3]
Length=423

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 80/150 (53%), Gaps = 11/150 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R EVSTPVTS +RL EG +L   ++SPY G +YH +PLLL     L+   +   + ++
Sbjct  34   AGRVEVSTPVTSFKRLQEGLFLYTHNVSPYDGGVYHQAPLLLPLFALLSHPAVAPLATYV  93

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
              +LV    D +SA        SL + ++    S+         D+  S    A  +L+N
Sbjct  94   FFTLV----DLLSA-------HSLAQLADTGFASVTRLFASPRKDLRWSSAAIAAGFLFN  142

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKG  611
            PFT+ TC+  +T+ L N+FV+ ++  A +G
Sbjct  143  PFTVATCLARSTSALTNLFVLTAMAKASQG  172



>ref|XP_007686410.1| hypothetical protein COCMIDRAFT_35345 [Bipolaris oryzae ATCC 
44560]
 gb|EUC47042.1| hypothetical protein COCMIDRAFT_35345 [Bipolaris oryzae ATCC 
44560]
Length=423

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 90/172 (52%), Gaps = 12/172 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLN-FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+ V  L+   FP   +  A R EVSTPVTS +RL EG +L   ++SPY G +YH +
Sbjct  12   FGAAAAVRLLLFTLFPALPDVLAGRVEVSTPVTSFKRLQEGLFLYTHNVSPYDGGVYHQA  71

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L+   I   + ++  +LV    D +SA        SL + ++    S+   
Sbjct  72   PLLLPLFALLSHPAIAPLATYVFFTLV----DLLSA-------HSLAQLADTGFASVTRL  120

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
                  D+  S    A  +L++PFT+ TC+  +T+ L N+FV+ ++  A +G
Sbjct  121  FASPRKDLRWSSAAIAAGFLFSPFTVATCLARSTSALTNLFVLAAMAKASQG  172



>dbj|GAD94038.1| GPI transamidase component GAB1 [Byssochlamys spectabilis No. 
5]
Length=426

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R EVSTPV+S +RL EG +L   ++SPY G +YH +PLLL     L  +     +Y L+ 
Sbjct  38   RVEVSTPVSSFKRLQEGLFLYTRNVSPYDGGVYHQAPLLLPIFALLPSSS----AYPLVT  93

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             +   + D ++A        +L   S+               +I   G I A  YL+NPF
Sbjct  94   GIFYSLVDLLNA-------NALITISDSGESVGSRLYSTPRKNIKWDGVIIAAAYLFNPF  146

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+G +TT   N  ++ +I  A  G    +     VAS+LS
Sbjct  147  TIATCLGRSTTVFTNSAILYAISSAVSGNGFNSMLSLAVASYLS  190



>ref|XP_007919918.1| hypothetical protein MYCFIDRAFT_32437 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME89740.1| hypothetical protein MYCFIDRAFT_32437 [Pseudocercospora fijiensis 
CIRAD86]
Length=435

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 88/180 (49%), Gaps = 12/180 (7%)
 Frame = +3

Query  126  LVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgp  302
            L+ + FP   +  T R E+STPV S +RL EG +L +  + PY G ++H +PL L     
Sbjct  26   LLALTFPGLPDLLTGRVEISTPVNSFKRLQEGLFLYERGLDPYDGGIFHQAPLFLPLF--  83

Query  303  lTGNKIDGHSYHLLCSLVLVVA-DFISAMLIRATGQSLQRASEkslkslglgklFEDSDI  479
             +       +   + S+ L  A D +SA  +    QS   A+     S    + +  + +
Sbjct  84   -SLLPSPATALGRIISVALYTALDILSADCLFDIAQSGAAAASLLYTSPRHTRAWRPASV  142

Query  480  LPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
                   A VYL+NP+TI+ C+G  TT   + F ++SI  AC+     AAF   +AS+ S
Sbjct  143  -------AAVYLFNPYTILACLGRPTTAFASFFTLLSIKHACQAKITTAAFALAIASYTS  195



>ref|XP_007698906.1| hypothetical protein COCSADRAFT_140249 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65878.1| hypothetical protein COCSADRAFT_140249 [Bipolaris sorokiniana 
ND90Pr]
Length=423

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 80/150 (53%), Gaps = 11/150 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R EVSTPVTS +RL EG +L   ++SPY G +YH +PLLL     L+   +   + ++
Sbjct  34   AGRVEVSTPVTSFKRLQEGLFLYTHNVSPYDGGVYHQAPLLLPLFALLSHPAVAPLATYV  93

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
              +L+    D +SA        SL + ++    S+         D+  S    A  +L+N
Sbjct  94   FFTLI----DLLSA-------HSLAQLADTGFASVTRLFASPRKDLRWSSAAIAAGFLFN  142

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKG  611
            PFT+ TC+  +T+ L N+FV+ ++  A +G
Sbjct  143  PFTVATCLARSTSALTNLFVLTAMAKASQG  172



>gb|EMD89631.1| hypothetical protein COCHEDRAFT_1021929 [Bipolaris maydis C5]
 gb|ENI10157.1| hypothetical protein COCC4DRAFT_36501 [Bipolaris maydis ATCC 
48331]
Length=423

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 11/150 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R EVSTPVTS +RL EG +L   ++SPY G +YH +PLLL     L+   +   + ++
Sbjct  34   AGRVEVSTPVTSFKRLQEGLFLYTHNVSPYDGGVYHQAPLLLPLFALLSHPAVAPLASYV  93

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
              +LV    D +SA        SL + ++    S+    +    D+  S    A  +L+N
Sbjct  94   FFTLV----DLLSA-------HSLAQLADTGFASVTRLFVSPRKDLRWSNAAIAAGFLFN  142

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKG  611
            PFT+ TC+  +T+ L N+F++ ++  A +G
Sbjct  143  PFTVATCLARSTSALTNLFILTAMAKASQG  172



>emb|CEI98019.1| hypothetical protein RMCBS344292_12137 [Rhizopus microsporus]
Length=397

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 88/186 (47%), Gaps = 28/186 (15%)
 Frame = +3

Query  123  RLVLIYFPKNLN-FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalg  299
            R+ L  FP  ++  + R E+STPVTS +RL EG +L  +++ PY G ++H          
Sbjct  13   RIALFNFPSVIDTLSQRVELSTPVTSFKRLTEGVFLYNNNIPPYDGGVFH----------  62

Query  300  plTGNKIDGHSYHLLC--SLVLVVADFISAMLIRAT----GQSLQRASEkslkslglgkl  461
                      S  LLC  S +   A FI  +L          +L   +    +       
Sbjct  63   ---------QSPLLLCLFSFITTFAPFIVPVLYTTIDVIIAYALSIITTIKQQQPEPKLS  113

Query  462  FEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWT  641
             E + I PS  +AAL YL+NPFTI+ C+  +T    N  +I++I  A KG    + F  +
Sbjct  114  IEKTSISPS-TVAAL-YLFNPFTILNCVSKSTLIFTNFSIILAILSALKGNMKPSMFWAS  171

Query  642  VASHLS  659
            V+++LS
Sbjct  172  VSAYLS  177



>emb|CEG63846.1| hypothetical protein RMATCC62417_00923 [Rhizopus microsporus]
Length=397

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 88/186 (47%), Gaps = 28/186 (15%)
 Frame = +3

Query  123  RLVLIYFPKNLN-FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalg  299
            R+ L  FP  ++  + R E+STPVTS +RL EG +L  +++ PY G ++H          
Sbjct  13   RIALFNFPSVIDTLSQRVELSTPVTSFKRLTEGVFLYNNNIPPYDGGVFH----------  62

Query  300  plTGNKIDGHSYHLLC--SLVLVVADFISAMLIRAT----GQSLQRASEkslkslglgkl  461
                      S  LLC  S +   A FI  +L          +L   +    +       
Sbjct  63   ---------QSPLLLCLFSFITTFAPFIVPVLYTTIDVIIAYALSIITTIKQQQPEPKLS  113

Query  462  FEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWT  641
             E + I PS  +AAL YL+NPFTI+ C+  +T    N  +I++I  A KG    + F  +
Sbjct  114  IEKTSISPS-TVAAL-YLFNPFTILNCVSKSTLIFTNFSIILAILSALKGNMKPSMFWAS  171

Query  642  VASHLS  659
            V+++LS
Sbjct  172  VSAYLS  177



>gb|KFY30062.1| hypothetical protein V494_08290 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=424

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYATWPIFTNIIYILVDLLSAVALMNIAESGESVSTKFYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWNSTKI-------AAFFLFNPFTIATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAV  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>gb|KFY08506.1| hypothetical protein V492_06169 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=424

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYATWPIFTNIIYILVDLLSAVALMNIAESGESVSTKFYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWNSTKI-------AAFFLFNPFTIATCIGRPTSVFTTCAILHAIAKAANGASFTSMFAV  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>gb|KFY72308.1| hypothetical protein V499_07561 [Pseudogymnoascus pannorum VKM 
F-103]
Length=424

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  S+ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYASWPIFTNIIYILVDLLSAVALMKIAESGESVSTKHYTSPRKDR  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFT+ TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTLATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAI  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>gb|KFZ07279.1| hypothetical protein V501_06589 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=424

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLVLFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  S+ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYASWPIFTNIIYILVDLLSAVALMKIAESGESVSTKHYTSPRKDR  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFT+ TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTLATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAI  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>ref|XP_002845857.1| GPI transamidase component PIG-U [Arthroderma otae CBS 113480]
 gb|EEQ32907.1| GPI transamidase component PIG-U [Arthroderma otae CBS 113480]
Length=423

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 89/188 (47%), Gaps = 15/188 (8%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+   RL+LI  FP   +  T R EVSTP++S +RL EG +L   ++SPY G ++H +P
Sbjct  12   GAAFALRLILILLFPGLPDLLTGRVEVSTPISSFKRLQEGLFLYLRNVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISA-MLIRATGQSLQRASEkslkslglg  455
            +LL     +  +    H Y LL   V  + D I+A  LI  +      AS          
Sbjct  72   ILLPLFALIPRS----HGYTLLTVAVYTLLDLINANALIEISNSGESVASRLFTS-----  122

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                   I   G    + YL+NPFT+  C+G  TT   N  +I +I  A  G +  +   
Sbjct  123  ---PRKQIRWDGIAIVIGYLFNPFTVAMCLGRPTTAFTNTAIIYAISSAITGRSINSMLA  179

Query  636  WTVASHLS  659
              +AS+LS
Sbjct  180  LGLASYLS  187



>ref|XP_008031113.1| hypothetical protein SETTUDRAFT_166106 [Setosphaeria turcica 
Et28A]
 gb|EOA81737.1| hypothetical protein SETTUDRAFT_166106 [Setosphaeria turcica 
Et28A]
Length=423

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 71/150 (47%), Gaps = 11/150 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R EVSTPVTS +RL EG +L   ++SPY G +YH        L PL     D     L
Sbjct  34   AGRVEVSTPVTSFKRLQEGVFLYTHNVSPYDGGVYH----QAPLLLPLFALLPDAAVAPL  89

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
              +L     D +SA        +L R ++    S          D+  S    A  +L+N
Sbjct  90   ATNLFFTAVDLLSA-------NALARIADTGFASATRLFASPRKDLRWSSAAIAAGFLFN  142

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKG  611
            PFT+ TC+  +T+ L N+F++ ++  A  G
Sbjct  143  PFTVATCIARSTSALTNLFILTAMAKASHG  172



>gb|KFX88189.1| hypothetical protein O988_09129 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=424

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 91/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLALFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYSTWPIFTNIIYILVDLLSALALMKIAESGESVSTKLYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTIATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAL  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>gb|KIL84525.1| phosphatidylinositol class u [Fusarium avenaceum]
Length=421

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H  
Sbjct  10   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFH--  67

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
                  L PL     D  S+ +   L+ +  D +SA  +    +S   +S +   S    
Sbjct  68   --QAPLLLPLFSLLPDVKSWPIFTHLLYIAVDLLSADSLYKIAESGVASSSRLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  126  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFSNCAILLAISKAIQGSPFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>ref|XP_001949071.2| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein [Acyrthosiphon pisum]
Length=431

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 86/186 (46%), Gaps = 12/186 (6%)
 Frame = +3

Query  114  IVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaa  293
            I+ R+ L +   + + A R EVSTP+ S +R+ EG  L   +++PY G ++H +PL L  
Sbjct  13   ILIRIYLSFSDFSTSIADRVEVSTPLNSWKRVIEGVSLYNENINPYDGDLFHETPLALVF  72

Query  294  lgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDS  473
               LT    D +      SLV +V D I+A ++  T +       K           E +
Sbjct  73   FSHLTSTFSDFY-----VSLVFIVCDLITAFVLYYTSKIYTENLLKQQTKTKHVYNKEFN  127

Query  474  DILPSGDIAAL-------VYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF  632
             +L   D + +       VY+ NP+T+ +C+   TT   N+F+ + +Y   K    L   
Sbjct  128  KLLIPDDFSVINPFYVCSVYMLNPYTVFSCIARTTTVFNNLFLALCLYSMVKRHRLLGCL  187

Query  633  GWTVAS  650
               +AS
Sbjct  188  SLVLAS  193



>gb|ERS96460.1| hypothetical protein HMPREF1624_07372 [Sporothrix schenckii ATCC 
58251]
 gb|KJR87200.1| phosphatidylinositol glycan, class U [Sporothrix schenckii 1099-18]
Length=426

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 77/154 (50%), Gaps = 13/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PLLL     L    +   +Y L  
Sbjct  40   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFSLLPPASLPVFTYLLYI  99

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            ++ L+ AD            +L R ++               +   SG + A VYL+NPF
Sbjct  100  AVDLLSAD------------ALVRIADSGEAGASALFTSPRREKRWSGFVVAAVYLFNPF  147

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            T+ TC+G +T+      ++ +I  A  G APL A
Sbjct  148  TVATCIGRSTSVFSTCAILHAISKAIAG-APLRA  180



>gb|KIH94823.1| phosphatidylinositol glycan, class U [Sporothrix brasiliensis 
5110]
Length=426

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 77/154 (50%), Gaps = 13/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PLLL     L    +   +Y L  
Sbjct  40   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFSLLPPASLPVFTYLLYI  99

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            ++ L+ AD            +L R ++               +   SG + A VYL+NPF
Sbjct  100  AVDLLSAD------------ALVRIADSGEAGASALFTSPRREKRWSGFVVAAVYLFNPF  147

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            T+ TC+G +T+      ++ +I  A  G APL A
Sbjct  148  TVATCIGRSTSVFSTCAILHAISKAIAG-APLRA  180



>ref|XP_011316395.1| hypothetical protein FGSG_00694 [Fusarium graminearum PH-1]
 gb|ESU05910.1| hypothetical protein FGSG_00694 [Fusarium graminearum PH-1]
 gb|EYB33522.1| hypothetical protein FG05_00694 [Fusarium graminearum]
 emb|CEF72675.1| unnamed protein product [Fusarium graminearum]
Length=421

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 93/187 (50%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + + RLVL + FP   N  T R E+STPVTS +RL EG +L  +++SPY G ++H   
Sbjct  11   AGAALLRLVLFLAFPGLPNLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYEGGVFH---  67

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L PL     D  S+ +   L+ +  D +SA  +     S   ++ +  KS     
Sbjct  68   -QAPLLLPLFSLLPDVKSWPIFTHLLYIAVDLLSADALYKIADSGVASNSRLFKSPRRAN  126

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             F  + +       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A    
Sbjct  127  KFGTAAV-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAITKAIQGSPFNAMVAL  179

Query  639  TVASHLS  659
            + AS+LS
Sbjct  180  SFASYLS  186



>gb|KFX88932.1| hypothetical protein V490_07331 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=424

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 92/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLALFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYSTWPIFTNIIYILVDLLSAVALMKIAESGESVSTKLYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+   +  ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTIATCIGRPTSVFTSCAILHAIAKAVNGASFTSMFAL  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>ref|XP_007297088.1| hypothetical protein MBM_09199 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD12630.1| hypothetical protein MBM_09199 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=421

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 92/188 (49%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+ V  L+ + FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH +
Sbjct  11   FATAAAVRLLLFVGFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQA  70

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L  +     SY +   L+ ++ D  SA        +L + +E         
Sbjct  71   PLLLPLFSLLPSSM----SYPIFTYLLYILVDLSSA-------NALMKIAETGEAGSSKL  119

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  D   S    A  +L+NPFTI TC+G  T+ L    ++ +I  A  G +  + F 
Sbjct  120  YTSPRKDKRWSSYAIAAAFLFNPFTIATCIGRPTSVLTTCAILHAISKAVVGASFTSMFA  179

Query  636  WTVASHLS  659
             + A++LS
Sbjct  180  LSFAAYLS  187



>gb|KFY96621.1| hypothetical protein V500_02355 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=424

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 11/164 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH        L P      +  ++ +  
Sbjct  38   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH----QAPLLLPFFSLLPNYSTWPIFT  93

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            +++ ++ D +SA+ +    +S +  S K   S    + +  + I       A  +L+NPF
Sbjct  94   NIIYILVDLLSALALVKIAESGESVSTKLYTSPRKERKWSSTKI-------AAFFLFNPF  146

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+G  T+      ++ +I  A  G +  + F    AS+LS
Sbjct  147  TIATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFALAFASYLS  190



>emb|CEI96442.1| hypothetical protein RMCBS344292_10603 [Rhizopus microsporus]
Length=398

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 89/186 (48%), Gaps = 28/186 (15%)
 Frame = +3

Query  123  RLVLIYFPKNLN-FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalg  299
            R+ L  FP  ++  + R E+STPVTS +RL EG +L  +++ PY G ++H          
Sbjct  13   RIALFNFPSVIDTLSQRVELSTPVTSFKRLTEGVFLYNNNIPPYDGGVFH----------  62

Query  300  plTGNKIDGHSYHLLC--SLVLVVADFISAMLIRA----TGQSLQRASEkslkslglgkl  461
                      S  LLC  S +   A FI  +L          +L   +    +       
Sbjct  63   ---------QSPLLLCLFSFITTFAPFIVPVLYATIDVIIAYALSIITTIKQQQPEPKLS  113

Query  462  FEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWT  641
             E + I PS  +AAL YL+NPFTI+ C+  +T    N+ +I+++  A +G    + F  +
Sbjct  114  IEKTSISPS-TVAAL-YLFNPFTILNCVSKSTLIFTNLSIILAVLSALRGNMKPSMFWAS  171

Query  642  VASHLS  659
            V+++LS
Sbjct  172  VSAYLS  177



>ref|XP_003714051.1| hypothetical protein MGG_01168 [Magnaporthe oryzae 70-15]
 gb|EHA54244.1| hypothetical protein MGG_01168 [Magnaporthe oryzae 70-15]
Length=435

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PLLL           D  +Y +  
Sbjct  44   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFS----LLPDVATYPIFT  99

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            +L+ +  D   A  +    +S +  S    +S    + +       SG I A +YL++PF
Sbjct  100  ALLYIAVDLFCADALLQIAESGEAGSSAKFQSPRRQRRW-------SGAIVAAIYLFSPF  152

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKG  611
            TI TC+G +T    +  V+ +I  A +G
Sbjct  153  TIATCIGRSTAVFTSCAVLHAIAKAIQG  180



>ref|XP_003054523.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU48810.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=421

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 11/165 (7%)
 Frame = +3

Query  165  TRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLL  344
            +R E+STPVTS +RL EG +L  +++SPY G ++H +PLLL     L   K+    + + 
Sbjct  33   SRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQAPLLLPLFSLLPDVKV----WPIF  88

Query  345  CSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNP  524
              L+ +  D +SA  +     S + AS K   S      F        G   A  +L+NP
Sbjct  89   THLLYIAVDLLSADALYKIANSGEAASSKLFTSPRRANKF-------VGAAVAAAFLFNP  141

Query  525  FTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            +TI TC+G +T    N  ++ +I  A KG    A    + AS+LS
Sbjct  142  YTIATCIGRSTGVFTNCAILYAIARAIKGSPFNAMIALSFASYLS  186



>ref|XP_007279912.1| gpi transamidase component pig-u [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA31039.1| gpi transamidase component pig-u [Colletotrichum gloeosporioides 
Nara gc5]
Length=394

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 80/154 (52%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PL L           D  S+ +  
Sbjct  35   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLFLPLFS----LLPDPKSFPIFT  90

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             ++ ++ D +SA  +     S +  + +   S   GK +       SG + A +YL+NPF
Sbjct  91   YILYILFDILSADALSKIADSGEAGTSRLFTSPRRGKRW-------SGLVVASLYLFNPF  143

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            TI TC+G +T+      ++ +I  A  G APL A
Sbjct  144  TIATCIGRSTSIFSTCAILHAIAKAISG-APLGA  176



>gb|KKA26563.1| hypothetical protein TD95_004260 [Thielaviopsis punctulata]
Length=427

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 81/166 (49%), Gaps = 13/166 (8%)
 Frame = +3

Query  165  TRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLL  344
            +R E+STP+TS +RL EG +L   ++SPY G ++H        L PL     D   + + 
Sbjct  39   SRVEISTPITSFKRLQEGLFLYNYNVSPYDGGVFH----QAPLLLPLFSLLPDSREWPIF  94

Query  345  CSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNP  524
              L+    D +SA        +L R ++    S          D   SG + +  YL NP
Sbjct  95   THLLYTGIDLLSA-------SALARIADSGEASSSKLFTSPRRDRRWSGAMVSAFYLLNP  147

Query  525  FTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF-GWTVASHLS  659
            FTI TC+G +T+      ++ +I  A +G AP++A    T AS+LS
Sbjct  148  FTIATCLGRSTSVFTTCAILHAIAKAIEG-APISAMIALTFASYLS  192



>gb|EXM12219.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
cubense tropical race 4 54006]
Length=425

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  74   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  129

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  130  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  ISFASYLS  190



>emb|CCX12476.1| Similar to Phosphatidylinositol glycan anchor biosynthesis class 
U protein; acc. no. Q8CHJ0 [Pyronema omphalodes CBS 100304]
Length=414

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 91/185 (49%), Gaps = 16/185 (9%)
 Frame = +3

Query  111  SIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgspll  284
            ++V RL L  +FP   +  T R E+STPVTS +RL EG +L    +SPY G ++H +PLL
Sbjct  12   AVVLRLSLFTFFPSLPDLLTNRVELSTPVTSFKRLQEGLFLYTHGVSPYDGGIFHQAPLL  71

Query  285  laalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklF  464
            LA    L  + +  H  + LC       D +SA+        +  AS K      L    
Sbjct  72   LAFFTSLPSSSLLVHLIYTLC-------DVLSAL------SLITIASSKVPAITPLHTSS  118

Query  465  EDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTV  644
              + + P    AA  +L NPFTI TC+  +T    N  ++ SI  A  G A  A    ++
Sbjct  119  RAAALCPPWAAAA-AFLLNPFTIATCLSRSTIVFSNTVILASIAKAVSGDAIPAMLALSM  177

Query  645  ASHLS  659
            AS+LS
Sbjct  178  ASYLS  182



>gb|EMT61375.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Fusarium oxysporum f. sp. cubense race 4]
Length=421

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  10   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  70   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  126  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  ISFASYLS  186



>gb|EWZ51861.1| phosphatidylinositol glycan, class U [Fusarium oxysporum Fo47]
 gb|EWZ87101.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
lycopersici MN25]
 gb|EXL43901.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
radicis-lycopersici 26381]
Length=425

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  74   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  129

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  130  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  ISFASYLS  190



>gb|ENH61510.1| Phosphatidylinositol glycan anchor biosynthesis class U protein 
[Fusarium oxysporum f. sp. cubense race 1]
Length=421

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  10   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  70   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  126  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  ISFASYLS  186



>gb|EWY92840.1| phosphatidylinositol glycan, class U [Fusarium oxysporum FOSC 
3-a]
 gb|EXM30430.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
vasinfectum 25433]
Length=425

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  74   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  129

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  130  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  ISFASYLS  190



>gb|KFY68904.1| hypothetical protein V496_00727 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=424

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 91/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLALFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  + K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYSTWPIFTNIIYILVDLLSAVALMKIAESGESVATKLYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+      ++ +I  A  G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTIATCIGRPTSVFTTCAILHAIAKAVNGASFTSMFAL  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>gb|EME49171.1| hypothetical protein DOTSEDRAFT_40413 [Dothistroma septosporum 
NZE10]
Length=446

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 9/164 (5%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+S+PV S +RL EG +L +  + PY G ++H +PLLL     +           ++ 
Sbjct  28   RVEISSPVNSFKRLQEGLFLYERGLDPYDGGIFHQAPLLLPLFSLMPSPSTTLG--RIIS  85

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             L+    D ISA  I    +S   A      S        D    P+  +A  VYL+NPF
Sbjct  86   ILLYTGLDIISADCIFDIAKSGANAVSSVYLSPRA-----DRSWKPTSVVA--VYLFNPF  138

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            T++ C+G  T+    +F ++S+  AC   A  +AF   +AS+LS
Sbjct  139  TVLACLGRPTSSFTTVFTLLSLKHACSAEAVTSAFALAIASYLS  182



>gb|KJK79742.1| hypothetical protein H634G_05334 [Metarhizium anisopliae BRIP 
53293]
 gb|KJK94861.1| hypothetical protein H633G_01268 [Metarhizium anisopliae BRIP 
53284]
Length=421

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 95/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  L+ + FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YAGAAVLRLLLTVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    ++ +  SL+ ++ DF+SA  +     S +    +   S    
Sbjct  70   PLLLPLFSLLPSVK----TWPIFTSLLYIIVDFLSADALCTIANSGEAGQSRLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K          G   A  +L+NPFTI +C+G +T+      ++ +I  A +G A  A   
Sbjct  126  KR-------ACGLAVAAAFLFNPFTIASCIGRSTSIFTTCAILHAISKAIQGSAFNAMIA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>gb|KFY40252.1| hypothetical protein V495_05523 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY61146.1| hypothetical protein V497_03092 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=424

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 91/187 (49%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A+ V RL L   FP   +  T R E+STPVTS +RL EG +L   ++SPY G +YH   
Sbjct  15   GAAAVLRLALFTAFPTLPDTLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
                 L P      +  ++ +  +++ ++ D +SA+ +    +S +  S K   S    +
Sbjct  72   -QAPLLLPFFSLLPNYSTWPIFTNIIYILVDLLSAVALMKIAESGESVSTKLYTSPRKER  130

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
             +  + I       A  +L+NPFTI TC+G  T+   +  ++ +I     G +  + F  
Sbjct  131  RWSSTKI-------AAFFLFNPFTIATCIGRPTSVFTSCAILHAIAKGVNGASFTSMFAL  183

Query  639  TVASHLS  659
              AS+LS
Sbjct  184  AFASYLS  190



>ref|XP_009219131.1| hypothetical protein GGTG_03089 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT77986.1| hypothetical protein GGTG_03089 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=441

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 82/165 (50%), Gaps = 13/165 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPV+S +RL EG +L   ++SPY G +YH +PLLL           D  +Y +  
Sbjct  39   RVEISTPVSSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFS----LLPDVSAYPIFT  94

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            SL+ +  D  SA        +L R ++    +               G + A +YL++PF
Sbjct  95   SLLYIAVDLASA-------HALHRIADSGEAAWSAHFKSPRRARRWGGAVVAALYLFSPF  147

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF-GWTVASHLS  659
            T+ TC+G +T+      ++ +I  A  G APL A    + AS+LS
Sbjct  148  TLATCLGRSTSVFTTCAILSAIAKAVSG-APLGALVALSFASYLS  191



>ref|XP_007795901.1| putative cell division control protein cdc91 protein [Eutypa 
lata UCREL1]
 gb|EMR65000.1| putative cell division control protein cdc91 protein [Eutypa 
lata UCREL1]
Length=421

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 87/187 (47%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLIYFPKNLN--FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            AA+   R +L  F + L      R E+STPVTS +R  EG +L   ++SPY G ++H +P
Sbjct  12   AAAAFLRFILFTFFQGLPDLLTARVEISTPVTSFKRFQEGLFLYNHNVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            LLL     L        +Y +  +++ +  D +SA        +L + +E          
Sbjct  72   LLLPLFSLLPDPS----AYPIFTNILYIAVDLLSA-------HALFKIAESGEAQQSRLF  120

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 D   SG I A  +L+NPFTI TC+G  T+      V+ +I  A  G    A    
Sbjct  121  TSPRKDKRWSGYIVAAGFLFNPFTIATCLGRPTSVFTTCAVLHAIAKAISGNPFTAMLSL  180

Query  639  TVASHLS  659
            + A++LS
Sbjct  181  SFAAYLS  187



>ref|XP_006966568.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47442.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS00859.1| cell division control protein CDC91 [Trichoderma reesei RUT C-30]
Length=425

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 88/174 (51%), Gaps = 19/174 (11%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            A + + RLVL   FP   +  T R E+STPVTS +RL EG +L   ++SPY G ++H   
Sbjct  15   AGAALLRLVLFAAFPSLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVFH---  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISA---MLIRATGQSLQRASEkslkslg  449
                 L PL     D  ++ +  +L+ ++ D +SA   ++I  +G++ Q     S +   
Sbjct  72   -QAPLLLPLFSLLPDVKTWPIFTALLYILVDLLSAYALLVIADSGEAGQSKHFTSPRRAK  130

Query  450  lgklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
                        SG + A  +L+NP+TI +C+G +T+   N  ++ +I  A  G
Sbjct  131  R----------SSGLLVAAAFLFNPYTIASCIGRSTSAFTNCAILFAIAKALSG  174



>gb|EFQ25612.1| GPI transamidase subunit PIG-U [Colletotrichum graminicola M1.001]
Length=422

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 75/154 (49%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PL L           D  S  +  
Sbjct  35   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLFLPLFS----LLPDPKSLPIFT  90

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             L+ V+ D +SA        +L R ++                   SG + A ++L+NPF
Sbjct  91   HLLYVLFDILSA-------DALSRIADSGEAGSSRLFTSPRRGKRWSGLVVASLFLFNPF  143

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            TI TC+G +T+      ++ ++  A  G APL A
Sbjct  144  TIATCVGRSTSVFSTCAILHAVAKAISG-APLGA  176



>gb|EXK49157.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
melonis 26406]
Length=425

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  74   PLLLPLFSLLPNVK----SWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  129

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  130  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  ISFASYLS  190



>ref|XP_007813606.1| putative cell division control protein CDC91 [Metarhizium acridum 
CQMa 102]
 gb|EFY86668.1| putative cell division control protein CDC91 [Metarhizium acridum 
CQMa 102]
Length=421

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 95/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  L+ + FP   +F T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YAGAAVLRLLLTVAFPGLPDFLTGRVEISTPVTSFKRLQEGLFLYNHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    ++ +  SL+ ++ D +SA  +     S +    +   S    
Sbjct  70   PLLLPLFSLLPSVK----TWPIFTSLLYILVDLLSADALSTIASSGEAGQSRLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K          G   A  +L+NPFTI +C+G +T+      ++ +I  A +G A  A   
Sbjct  126  KR-------ACGLAVAAAFLFNPFTIASCIGRSTSIFTTCAILHAISKAIQGSAFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>gb|EWG36489.1| phosphatidylinositol glycan, class U [Fusarium verticillioides 
7600]
Length=425

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 99/189 (52%), Gaps = 14/189 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA       ++L + +E  +      
Sbjct  74   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSA-------EALYKIAELGVAGNSKL  122

Query  456  klF-EDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF  632
                  ++   S  IAA  +L+NP+TI TC+G +T    N  ++++I  A +G    A  
Sbjct  123  FTSPRRANKFGSAAIAA-GFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMV  181

Query  633  GWTVASHLS  659
              + AS+LS
Sbjct  182  AISFASYLS  190



>emb|CCT63378.1| related to cell division control protein CDC91 [Fusarium fujikuroi 
IMI 58289]
Length=421

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 89/172 (52%), Gaps = 12/172 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  10   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  S+ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  70   PLLLPLFSLLP----DVKSWPIFTHLLYIAVDLLSAEALYKIAESGVAGNSKLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G
Sbjct  126  NRFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKALQG  170



>ref|XP_008084885.1| hypothetical protein GLAREA_04317 [Glarea lozoyensis ATCC 20868]
 gb|EPE27526.1| hypothetical protein GLAREA_04317 [Glarea lozoyensis ATCC 20868]
Length=424

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +P+LL+    L     +  +Y    
Sbjct  38   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPILLSLFSLLP----NSTTYPSFT  93

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             L+ +V D +SA        +L + SE               D   +    A  +L+NPF
Sbjct  94   YLLYIVIDVLSA-------NALMKISESGEAGSSKLYTSPRKDKKWTSYAIAAAFLFNPF  146

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+G  T+      ++ ++  A  G +  + F   +AS+LS
Sbjct  147  TIATCIGRPTSVFTTCAILHAVSAAIAGQSFTSMFTLAIASYLS  190



>gb|EEH18057.1| hypothetical protein PABG_00620 [Paracoccidioides brasiliensis 
Pb03]
Length=423

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 88/187 (47%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
              +I  R++L   FP   +  T R EVSTP +S +RL EG +L   ++SPY G +YH +P
Sbjct  12   GGAIALRILLFTLFPTLPDLLTGRVEVSTPASSFKRLQEGVFLYTRNVSPYDGGVYHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            +LL     L        S+ LL  LV ++ D ++A  +     S +    +   S     
Sbjct  72   ILLPIFSLLP----QSSSHPLLTGLVYILVDLLNAAALVTISNSAESVVSRLYTS-----  122

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 DI   G   A  YL+NPFTI TC+G +     N  ++ +I  A       +AF  
Sbjct  123  --PRKDIRWDGVSIAAGYLFNPFTIATCLGRSPNAFTNSAILYAISNAVMRNTFSSAFAL  180

Query  639  TVASHLS  659
              AS+LS
Sbjct  181  AFASYLS  187



>gb|EGU78379.1| hypothetical protein FOXB_11130 [Fusarium oxysporum Fo5176]
Length=421

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  10   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  ++ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  70   PLLLPLFSLLP----DVKNWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  126  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  ISFASYLS  186



>ref|XP_010758248.1| hypothetical protein PADG_03052 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH46954.2| hypothetical protein PADG_03052 [Paracoccidioides brasiliensis 
Pb18]
Length=423

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 88/187 (47%), Gaps = 13/187 (7%)
 Frame = +3

Query  105  AASIVFRLVLI-YFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
              +I  R++L   FP   +  T R EVSTP +S +RL EG +L   ++SPY G +YH +P
Sbjct  12   GGAIALRILLFTLFPTLPDLLTGRVEVSTPASSFKRLQEGVFLYTRNVSPYDGGVYHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            +LL     L        S+ LL  LV ++ D ++A  +     S +    +   S     
Sbjct  72   ILLPIFSLLP----QSSSHPLLTGLVYILVDLLNAAALVTISNSAESVVSRLYTS-----  122

Query  459  lFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGW  638
                 DI   G   A  YL+NPFTI TC+G +     N  ++ +I  A       +AF  
Sbjct  123  --PRKDIRWDGVSIAAGYLFNPFTIATCLGRSPNAFTNSAILYAISNAVMRNTFSSAFAL  180

Query  639  TVASHLS  659
              AS+LS
Sbjct  181  AFASYLS  187



>gb|EXA51889.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
pisi HDV247]
 gb|EXK96215.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
raphani 54005]
 gb|EXL89351.1| phosphatidylinositol glycan, class U [Fusarium oxysporum f. sp. 
conglutinans race 2 54008]
Length=425

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  ++ + FP   +  T R E+STPVTS +RL EG +L  +++SPY G ++H +
Sbjct  14   FAGAALLRLILFLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYTNNVSPYDGGVFHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L     D  ++ +   L+ +  D +SA  +    +S    + K   S    
Sbjct  74   PLLLPLFSLLP----DVKNWPIFTHLLYIAVDLLSADALYKIAESGVAGNSKLFTSPRRA  129

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
              F  + I       A  +L+NP+TI TC+G +T    N  ++++I  A +G    A   
Sbjct  130  NKFGSAAI-------AAGFLFNPYTIATCIGRSTGVFTNCAILLAIAKAIQGSPFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  ISFASYLS  190



>ref|XP_011113226.1| hypothetical protein H072_7472 [Dactylellina haptotyla CBS 200.50]
 gb|EPS38775.1| hypothetical protein H072_7472 [Dactylellina haptotyla CBS 200.50]
Length=415

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 83/166 (50%), Gaps = 14/166 (8%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            A R E+STPVTS +RL EG +L    +SPY G ++H +PLLL+    L  + I       
Sbjct  31   AQRVEISTPVTSYKRLQEGLFLYTHGVSPYDGGVFHQAPLLLSLFSILPDSTI-------  83

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
            L ++  V+AD +SA+ +      +Q AS                +  P   IAA V+L+N
Sbjct  84   LTNVFYVLADLLSAVSL------VQIASSGVSGVTPHHVSPRKDNRWPPWAIAA-VFLFN  136

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            PF+I TC+   T    N  V+ SI  A +G    A     +AS+LS
Sbjct  137  PFSIATCIARPTIVFTNSIVLHSIANAVQGNRAPAFVSLAMASYLS  182



>gb|KFA65733.1| hypothetical protein S40285_04875 [Stachybotrys chlorohalonata 
IBT 40285]
Length=421

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 77/164 (47%), Gaps = 11/164 (7%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STP+TS +RL EG +L   ++SPY G +YH +PLLL           D  ++ +  
Sbjct  34   RVEISTPITSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFS----LLPDVKAWPIFT  89

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            SL+ ++ D +SA        +L   +E                   SG + A  YL+NP 
Sbjct  90   SLLYILVDLLSA-------DALINIAESGEAGQSKHFTSPRRGKRASGLLVAAAYLFNPL  142

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+G  T+   N  ++ +I     G    A    + AS+LS
Sbjct  143  TIATCVGRPTSVFTNCAILQAISKVIAGSPFSAVVALSFASYLS  186



>emb|CEJ89134.1| Putative Phosphatidylinositol glycan anchor biosynthesis class 
U protein [Torrubiella hemipterigena]
Length=421

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 82/165 (50%), Gaps = 13/165 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L  ++++PY G ++H +PLLL     L     D  ++ L  
Sbjct  34   RVEISTPVTSFKRLQEGLFLYNNNVNPYDGGVFHQAPLLLPLFSFLP----DVKAWPLFT  89

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            + + +  D ISA        +L   SE                   SG + A  +L+NP+
Sbjct  90   AALFIAVDLISA-------SALWNISESGEAGQSKQYTSPRRSKRSSGLLVAASFLFNPY  142

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAF-GWTVASHLS  659
            TI TC+G +T+      ++ ++  A  G AP +A    + AS+LS
Sbjct  143  TIATCLGRSTSSFSTCAILQAVSAAING-APFSAMVALSFASYLS  186



>ref|XP_002415929.1| phosphatidylinositol glycan anchor biosynthesis class U protein, 
putative [Ixodes scapularis]
 gb|EEC19596.1| phosphatidylinositol glycan anchor biosynthesis class U protein, 
putative [Ixodes scapularis]
Length=493

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 74/160 (46%), Gaps = 10/160 (6%)
 Frame = +3

Query  108  ASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplll  287
            +  + RL LIY       + R EVSTP+ S RR+ EG +L++  MSPY G ++H  PL L
Sbjct  12   SGFLLRLALIYTSIGKRISDRVEVSTPLNSWRRVTEGLYLQRMQMSPYDGDVFHEPPLSL  71

Query  288  aalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQS-----LQRASEkslkslgl  452
            A    LT    D +       L  V+ D ++A+L+    +      + + ++        
Sbjct  72   ALYDGLTRTLGDHY-----LPLFFVICDLVTALLLSGAAKKGMQFMVAQENQIGKAKSAE  126

Query  453  gklFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLEN  572
                 +  +     +   VYL +P++++ C+G  TT   N
Sbjct  127  YMRLTEKSVPSVPKLVLAVYLLSPYSLLNCVGMATTTFSN  166



>ref|XP_010066093.1| PREDICTED: uncharacterized protein LOC104453267 [Eucalyptus grandis]
Length=120

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  PKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMS  245
            P+NL  +TRPEV+TP+TS+RRL EGYWLKQS MS
Sbjct  16   PRNLRLSTRPEVATPLTSIRRLGEGYWLKQSVMS  49



>gb|EMF16367.1| CDC91 cell division cycle 91-like protein [Sphaerulina musiva 
SO2202]
Length=457

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 93/188 (49%), Gaps = 13/188 (7%)
 Frame = +3

Query  105  AASIVFRLVL-IYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
            +A++  R+ L + FP   +  T R E+STPV S +RL EG +L +  + PY G ++H +P
Sbjct  18   SAAVTLRITLALAFPGLPDLLTGRAEISTPVNSFKRLQEGLFLYERGLDPYDGGIFHQAP  77

Query  279  lllaalgpl-TGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            L L     L + +   G    L   L+    D ++A  I     S   A+     S    
Sbjct  78   LFLPLFALLPSASTWLGR---LATILIYTGLDVLTADCIYDIASSGAAAASLLFTSPRAD  134

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            ++++ + +       A VYL+NPFT+V C G  TT     F ++S+  AC+     AAF 
Sbjct  135  RVWQPASV-------AAVYLFNPFTLVACFGRPTTAFAAFFTLLSVKHACQAKVMTAAFA  187

Query  636  WTVASHLS  659
              +AS++S
Sbjct  188  LAIASYIS  195



>ref|XP_002839852.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84043.1| unnamed protein product [Tuber melanosporum]
Length=417

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 85/170 (50%), Gaps = 16/170 (9%)
 Frame = +3

Query  108  ASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgspl  281
            A++V RLVL   FP   +  T R E+STPVTS +RL EG +L    +SPY G ++H +PL
Sbjct  11   AAVVLRLVLFTAFPSLPDLLTNRVELSTPVTSFKRLQEGLFLYTHGLSPYDGGVFHQAPL  70

Query  282  llaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgkl  461
            LLA    L  N I       +  LV +++D +SA  +      +Q A+     S      
Sbjct  71   LLAFFTTLPSNPI-------VVYLVYILSDVLSAHSL------IQIATSGVSVSTPYHTS  117

Query  462  FEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
               S   P   +AA  +L+NPF+I TC+   T    N  ++ +I    +G
Sbjct  118  PRKSSTWPPWAVAA-AFLFNPFSIATCIARPTIVFTNTVILTAIAKGVQG  166



>gb|EPE09569.1| gpi transamidase subunit pig-u [Ophiostoma piceae UAMH 11346]
Length=426

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PLLL            G +  L  
Sbjct  40   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFS----LLPSGTAQPLFT  95

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
             L+ +  D +SA        +L + ++               +   SG + A V+L +PF
Sbjct  96   YLLYIAVDLLSA-------NALTKIADSGEAGASALFSSPRREKRWSGFVVAAVFLLSPF  148

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            TI  C+G +TT      ++ +I  A  G APL A
Sbjct  149  TIANCIGRSTTVFSTCTILYAIAKAVAG-APLGA  181



>emb|CCU74807.1| GPI transamidase component PIG-U [Blumeria graminis f. sp. hordei 
DH14]
Length=420

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 77/166 (46%), Gaps = 11/166 (7%)
 Frame = +3

Query  162  ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHL  341
            + R E+STPVTS +RL EG +L +  +SPY G +YH        L PL     D  +Y +
Sbjct  32   SARVEISTPVTSFKRLQEGLFLYRHHVSPYDGGVYH----QAPLLLPLLSILPDSTTYPI  87

Query  342  LCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWN  521
               ++ ++ D  SA        +L + S                D   S       +L+N
Sbjct  88   FTYILYIIVDLWSA-------NALSKISSSGEAVSSKLFTSPRKDKRWSSLAITAAFLFN  140

Query  522  PFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            PFT+ TC+G  ++      ++I+I  A  G +  + F  ++A++LS
Sbjct  141  PFTVATCVGRPSSVFTTCAILIAIAKAVAGASFSSMFAISIAAYLS  186



>gb|KHJ30205.1| putative gpi transamidase component pig-u [Erysiphe necator]
Length=421

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 89/186 (48%), Gaps = 13/186 (7%)
 Frame = +3

Query  102  AAASIVFRLVLIYFPKNLNFATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgspl  281
            AA  I+   + +  P  L    R E+STPVTS +RL EG +L + ++SPY G +YH +PL
Sbjct  15   AAVRILLFTLFVGLPDLLT--ARVEISTPVTSFKRLQEGLYLYKHNVSPYDGGVYHQAPL  72

Query  282  llaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgkl  461
            LL  L  L    I    Y    +L+ ++ D +SA        SL R ++    +      
Sbjct  73   LLPLLSLLPDYSI----YPAFTNLLYILMDLMSA-------NSLMRIADSGEAASSKLYT  121

Query  462  FEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWT  641
                +   S    A  +L NPFTI TC+G  ++      ++ +I  A  G +  + F  +
Sbjct  122  SPRKNKGWSSLAVAAAFLLNPFTIATCIGRPSSVFTTCAILFAISKAVVGASFSSMFALS  181

Query  642  VASHLS  659
            +A +LS
Sbjct  182  IAGYLS  187



>ref|XP_661430.1| hypothetical protein AN3826.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59091.1| hypothetical protein AN3826.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF75296.1| TPA: GPI transamidase component PIG-U, putative (AFU_orthologue; 
AFUA_4G08200) [Aspergillus nidulans FGSC A4]
Length=407

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 76/164 (46%), Gaps = 27/164 (16%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R EVSTPVTS +RL EG +L   ++SPY G ++                    H Y +  
Sbjct  35   RVEVSTPVTSFKRLQEGLFLYNRNVSPYDGGVF--------------------HQYPIPT  74

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            +L+  + D ++A  +     S Q  S +   S      ++       G   A  +L+NPF
Sbjct  75   ALLYSLVDLLNANALVTISDSAQAVSGRLYTSSRKLIKWD-------GIAVAAWFLFNPF  127

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFGWTVASHLS  659
            TI TC+G +T    +  ++ +I  A +G +  A F   +AS+LS
Sbjct  128  TIATCLGRSTAVFTSTGILYAISAAVQGESLNAMFALGLASYLS  171



>ref|XP_009657441.1| GPI transamidase component GAB1 [Verticillium dahliae VdLs.17]
 gb|EGY15278.1| GPI transamidase component GAB1 [Verticillium dahliae VdLs.17]
Length=426

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 84/164 (51%), Gaps = 13/164 (8%)
 Frame = +3

Query  141  FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNK  317
            FP+  +  T R E+STPVTS +RL EG +L   ++SPY G +YH +PLLL     L   K
Sbjct  29   FPQLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFSLLPDLK  88

Query  318  IDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDI  497
                ++ +  SL+ +V D +SA  +     S +  + K   S      +       +G  
Sbjct  89   ----AWPIFASLLYIVVDLLSADALAKIADSGEAGASKHFTSPRRATRW-------NGVA  137

Query  498  AALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
             A  +L+NPFTI TC+G +T       ++ ++  A  G AP++A
Sbjct  138  VAAAFLFNPFTIATCLGRSTGVFSTCAILHAMAKAIGG-APVSA  180



>ref|XP_003300377.1| hypothetical protein PTT_11613 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91522.1| hypothetical protein PTT_11613 [Pyrenophora teres f. teres 0-1]
Length=423

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 12/172 (7%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+ V  L+   FP   +  A R EVSTPVTS +RL EG +L   ++SPY G ++H +
Sbjct  12   FGAAAAVRLLLFTVFPALPDLLAGRVEVSTPVTSFKRLQEGVFLYTHNVSPYDGGVFHQA  71

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L           L  ++   + D +SA        +L + +E    S+   
Sbjct  72   PLLLPLFSLLPDPS----RAPLATNIFYTIVDLLSA-------NALYQVAETGFSSVTRL  120

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKG  611
                  D+  S       +L+NPFT++TC+  +T+ L N+F++ ++  A +G
Sbjct  121  FASPRKDLRWSSMAITAGFLFNPFTVLTCIARSTSALTNLFILTAMTKASQG  172



>ref|XP_001937251.1| CDC91 cell division cycle 91-like protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU49838.1| CDC91 cell division cycle 91-like protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=423

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 95/188 (51%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNF-ATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            + AA+ V  L+   FP   +  A R EVSTPVTS +RL EG +L   ++SPY G ++H +
Sbjct  12   FGAAAAVRLLLFTVFPALPDLLAGRVEVSTPVTSFKRLQEGVFLHTHNVSPYDGGVFHQA  71

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L        + ++L ++V    D +SA        +L + +E    S+   
Sbjct  72   PLLLPLFSLLPNPSRAPLATNILYTIV----DLLSA-------NALYQVAESGFSSVTRL  120

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                  D+  S       +L++PFT++TC+  +T+ L N+F++ ++  A +G +    F 
Sbjct  121  FASPRKDLRWSSMAITAGFLFSPFTVLTCIARSTSSLTNLFILTAMAKASQGASFTFIFA  180

Query  636  WTVASHLS  659
               AS+ +
Sbjct  181  TAFASYFA  188



>ref|XP_007816955.1| GPI transamidase subunit PIG-U [Metarhizium robertsii ARSEF 23]
 gb|EFZ03692.1| GPI transamidase subunit PIG-U [Metarhizium robertsii ARSEF 23]
 gb|EXV02057.1| GPI transamidase subunit PIG-U [Metarhizium robertsii]
Length=421

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  L+ + FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YAGAAVLRLLLTVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    ++ +  SL+ ++ D +SA  +     S +    K   S    
Sbjct  70   PLLLPLFSLLPSVK----TWPIFTSLLYILVDLLSADALCTIANSGEAGQSKLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K          G   A  +L+NPFTI +C+G +T+      ++ +I  A +G A  A   
Sbjct  126  KR-------ACGLAVAAAFLFNPFTIASCIGRSTSIFTTCAILHAISKAIQGSAFNAMIA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>gb|KFG78421.1| cell division control protein CDC91 [Metarhizium anisopliae]
 gb|KID60372.1| cell division control protein CDC91, partial [Metarhizium anisopliae 
ARSEF 549]
Length=421

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  L+ + FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YAGAAVLRLLLTVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    ++ +  SL+ ++ D +SA  +     S +    +   S    
Sbjct  70   PLLLPLFSLLPSVK----TWPIFTSLLYILVDLLSADALCTIANSGEAGQSRLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K          G   A  +L+NPFTI +C+G +T+      ++ +I  A +G A  A   
Sbjct  126  KR-------ACGLAVAAAFLFNPFTIASCIGRSTSIFTTCAILHAISKAIQGSAFNAMIA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>gb|KDB11111.1| putative cell division control protein CDC91 [Ustilaginoidea 
virens]
Length=425

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A+A+++  ++++ FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  14   YASAALLRLMLVVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYMHNVWPYDGGVYHQA  73

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            P+LL     L     D  ++ +  S + ++ D + A        +L R ++    S    
Sbjct  74   PILLPLFSLLP----DVKAWPIFTSALYILVDILGA-------DALLRIADSGEASQSKL  122

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                      +G   A  +L+NPFTI TC+G +T+      ++ +I  A  G A  A   
Sbjct  123  FTSPRRAKRATGLAVAAAFLFNPFTIATCIGRSTSVFTTCAILHAILRAVSGSAFNAMVA  182

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  183  LSFASYLS  190



>ref|XP_006697629.1| GPI transamidase component-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS17047.1| GPI transamidase component-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=425

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 75/154 (49%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PL L     L        ++  L 
Sbjct  39   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLFLPLFSLLPSYA----TFPFLT  94

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
            + + V+ D +SA        +L + +E               +   SG + A  +L+NPF
Sbjct  95   NFLYVIVDLLSA-------NALWKIAESGEAGASAHFTSPRREKRWSGFVIAATFLFNPF  147

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            T+ TC+G +T+      ++ ++  A  G AP  A
Sbjct  148  TVATCIGRSTSVFTTCAILHAVAKAVSG-APFGA  180



>dbj|GAO19754.1| hypothetical protein UVI_073880 [Ustilaginoidea virens]
Length=421

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A+A+++  ++++ FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YASAALLRLMLVVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYMHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            P+LL     L     D  ++ +  S + ++ D + A        +L R ++    S    
Sbjct  70   PILLPLFSLLP----DVKAWPIFTSALYILVDILGA-------DALLRIADSGEASQSKL  118

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
                      +G   A  +L+NPFTI TC+G +T+      ++ +I  A  G A  A   
Sbjct  119  FTSPRRAKRATGLAVAAAFLFNPFTIATCIGRSTSVFTTCAILHAILRAVSGSAFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>ref|XP_004527292.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class 
U protein-like [Ceratitis capitata]
Length=426

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (48%), Gaps = 18/167 (11%)
 Frame = +3

Query  138  YFPKNLN-FATRPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGN  314
            Y+ +N +    R EVSTP+ S +R+ EG +L ++ + PY G + H    ++  L     N
Sbjct  17   YYLQNFHWIGERVEVSTPINSFKRVQEGVYLYENGIDPYLGDVVH-ELPVILVLLVRIFN  75

Query  315  KIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQR---------ASEkslkslglgklFE  467
             I          L+ V+ D ++A+L+    Q   R         +SE ++ +  L     
Sbjct  76   SISN-----FVPLLYVLIDLMTAILLYKMAQQFVRSKLTEQKFESSEYAVGTEELQVQAT  130

Query  468  DSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACK  608
            D +++P   I A  YL+NP ++++C G  +T   N  + +++Y   K
Sbjct  131  DMNVVPRCVILA--YLFNPLSLLSCAGLTSTVFSNFLIALTLYFLVK  175



>emb|CCF39294.1| GPI transamidase subunit PIG-U [Colletotrichum higginsianum]
Length=427

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 74/154 (48%), Gaps = 12/154 (8%)
 Frame = +3

Query  168  RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsplllaalgplTGNKIDGHSYHLLC  347
            R E+STPVTS +RL EG +L   ++SPY G +YH +PL L           D  S  +  
Sbjct  40   RVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLFLPLFS----LLPDLKSLPVFA  95

Query  348  SLVLVVADFISAMLIRATGQSLQRASEkslkslglgklFEDSDILPSGDIAALVYLWNPF  527
              + ++ D ++A        +L R ++                   SG + A ++L+NPF
Sbjct  96   YFLYILVDILTA-------DALSRIADSGEAGSSRLFTSPRRGKRWSGLVVASLFLFNPF  148

Query  528  TIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
            TI TC+G +T+      ++ ++  A  G APL A
Sbjct  149  TIATCIGRSTSVFSTCAILHAVAKAISG-APLGA  181



>gb|KID89840.1| cell division control protein CDC91 [Metarhizium guizhouense 
ARSEF 977]
Length=421

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 94/188 (50%), Gaps = 12/188 (6%)
 Frame = +3

Query  99   WAAASIVFRLVLIYFPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgs  275
            +A A+++  L+ + FP   +  T R E+STPVTS +RL EG +L   ++ PY G +YH +
Sbjct  10   YAGAAVLRLLLTVAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVWPYDGGVYHQA  69

Query  276  plllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglg  455
            PLLL     L   K    ++ +  SL+ ++ D +SA  +     S +    +   S    
Sbjct  70   PLLLPLFSLLPSVK----TWPIFTSLLYILVDLLSADALCTIANSGEAGQSRLFTSPRRA  125

Query  456  klFEDSDILPSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAAFG  635
            K          G   A  +L+NPFTI +C+G +T+      ++ +I  A +G A  A   
Sbjct  126  KR-------ACGLAVAAAFLFNPFTIASCIGRSTSIFTTCAILHAIAKAIQGSAFNAMVA  178

Query  636  WTVASHLS  659
             + AS+LS
Sbjct  179  LSFASYLS  186



>ref|XP_003175300.1| hypothetical protein MGYG_02829 [Microsporum gypseum CBS 118893]
 gb|EFQ99817.1| hypothetical protein MGYG_02829 [Microsporum gypseum CBS 118893]
Length=427

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 93/190 (49%), Gaps = 15/190 (8%)
 Frame = +3

Query  105  AASIVFRLVLIY-FPKNLNFAT-RPEVSTPVTSLRRLAEGYWLKQSSMSPYAGSMYHgsp  278
             A++  RLVLI  FP   +  T R EVSTP++S +RL EG +L   ++SPY G ++H +P
Sbjct  12   GAAVALRLVLILLFPGLPDLLTGRVEVSTPISSFKRLQEGLFLYLRNVSPYDGGVFHQAP  71

Query  279  lllaalgplTGNKIDGHSYHLLCSLVLVVADFISAMLIRATGQSLQRASEkslkslglgk  458
            + L     L       H Y LL  LV  + D I+A  +     S +    +   S     
Sbjct  72   IFLPLFSLLP----QSHGYTLLTVLVYTLLDLINANALIEISNSGESVVSRLFTSPRKKI  127

Query  459  lFEDSDIL---PSGDIAALVYLWNPFTIVTCMGFNTTPLENMFVIISIYGACKGLAPLAA  629
             ++   I+   PS       YL+NPFTI TC+G  TT   N  +I +I  A  G +  + 
Sbjct  128  RWDGVAIVIGYPSR------YLFNPFTIATCLGRPTTAFTNTAIIFAISSAITGRSVNSM  181

Query  630  FGWTVASHLS  659
                +AS+LS
Sbjct  182  LALGLASYLS  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378