BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6421

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010271213.1|  PREDICTED: protein unc-50 homolog isoform X2     93.2    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010271205.1|  PREDICTED: protein unc-50 homolog isoform X1     93.6    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009629275.1|  PREDICTED: protein unc-50 homolog                91.3    2e-18   Nicotiana tomentosiformis
ref|XP_009801486.1|  PREDICTED: protein unc-50 homolog                91.3    2e-18   Nicotiana sylvestris
emb|CDO97222.1|  unnamed protein product                              90.1    4e-18   Coffea canephora [robusta coffee]
ref|XP_010928387.1|  PREDICTED: protein unc-50 homolog isoform X2     89.0    7e-18   
ref|XP_010928388.1|  PREDICTED: protein unc-50 homolog isoform X3     88.2    1e-17   Elaeis guineensis
ref|XP_010928386.1|  PREDICTED: protein unc-50 homolog isoform X1     88.6    1e-17   Elaeis guineensis
ref|XP_008799595.1|  PREDICTED: protein unc-50 homolog isoform X2     88.6    1e-17   Phoenix dactylifera
gb|ABK21352.1|  unknown                                               87.4    4e-17   Picea sitchensis
ref|XP_007042529.1|  UNC-50 family protein isoform 2                  87.0    4e-17   
ref|XP_007042530.1|  UNC-50 family protein isoform 3                  86.3    4e-17   
ref|XP_006346362.1|  PREDICTED: protein unc-50 homolog                87.0    4e-17   Solanum tuberosum [potatoes]
ref|XP_007042528.1|  UNC-50 family protein isoform 1                  87.0    4e-17   
gb|EYU42697.1|  hypothetical protein MIMGU_mgv1a012334mg              86.3    8e-17   Erythranthe guttata [common monkey flower]
ref|XP_002518676.1|  conserved hypothetical protein                   84.3    9e-17   
ref|XP_004230735.1|  PREDICTED: protein unc-50 homolog                85.9    1e-16   Solanum lycopersicum
ref|XP_012075870.1|  PREDICTED: protein unc-50 homolog                85.5    2e-16   Jatropha curcas
ref|XP_002282581.2|  PREDICTED: protein unc-50 homolog                85.5    2e-16   Vitis vinifera
ref|XP_011092536.1|  PREDICTED: protein unc-50 homolog isoform X1     85.5    2e-16   Sesamum indicum [beniseed]
emb|CBI40262.3|  unnamed protein product                              85.5    2e-16   Vitis vinifera
ref|XP_011092537.1|  PREDICTED: protein unc-50 homolog isoform X2     84.7    2e-16   
ref|XP_006844040.1|  PREDICTED: protein unc-50 homolog                84.7    3e-16   Amborella trichopoda
gb|KHG13402.1|  Protein unc-50                                        83.6    6e-16   Gossypium arboreum [tree cotton]
gb|KJB47364.1|  hypothetical protein B456_008G022900                  82.8    6e-16   Gossypium raimondii
gb|KJB47362.1|  hypothetical protein B456_008G022900                  83.6    7e-16   Gossypium raimondii
gb|KJB47366.1|  hypothetical protein B456_008G022900                  83.6    8e-16   Gossypium raimondii
gb|KJB47365.1|  hypothetical protein B456_008G022900                  83.2    9e-16   Gossypium raimondii
ref|XP_009396396.1|  PREDICTED: protein unc-50 homolog                82.8    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA60643.1|  TPA: hypothetical protein ZEAMMB73_532880            78.6    2e-15   
ref|NP_001146770.1|  uncharacterized protein LOC100280372             80.1    2e-15   
gb|KJB11965.1|  hypothetical protein B456_002G009400                  82.0    2e-15   Gossypium raimondii
gb|KJB11964.1|  hypothetical protein B456_002G009400                  80.9    3e-15   Gossypium raimondii
gb|KJB11966.1|  hypothetical protein B456_002G009400                  81.3    3e-15   Gossypium raimondii
gb|ACN35099.1|  unknown                                               80.5    8e-15   Zea mays [maize]
ref|XP_008651375.1|  PREDICTED: uncharacterized protein LOC100280...  80.5    9e-15   
tpg|DAA60647.1|  TPA: hypothetical protein ZEAMMB73_532880            79.7    1e-14   
ref|XP_006660415.1|  PREDICTED: protein unc-50 homolog                79.7    1e-14   Oryza brachyantha
ref|XP_004956281.1|  PREDICTED: protein unc-50 homolog                79.3    2e-14   Setaria italica
ref|XP_003576742.1|  PREDICTED: protein unc-50 homolog                79.3    2e-14   Brachypodium distachyon [annual false brome]
ref|NP_001062566.1|  Os09g0109500                                     79.3    2e-14   
ref|XP_006422931.1|  hypothetical protein CICLE_v10029109mg           77.8    6e-14   
emb|CDY63605.1|  BnaCnng42360D                                        77.8    7e-14   Brassica napus [oilseed rape]
ref|XP_006487004.1|  PREDICTED: protein unc-50 homolog                77.4    8e-14   Citrus sinensis [apfelsine]
ref|XP_006422929.1|  hypothetical protein CICLE_v10029109mg           77.4    9e-14   Citrus clementina [clementine]
ref|XP_010691673.1|  PREDICTED: protein unc-50 homolog                77.4    9e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011001154.1|  PREDICTED: protein unc-50 homolog                77.0    1e-13   Populus euphratica
ref|XP_010547979.1|  PREDICTED: protein unc-50 homolog isoform X2     76.6    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_010518032.1|  PREDICTED: protein unc-50 homolog                77.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002462031.1|  hypothetical protein SORBIDRAFT_02g013040        77.0    1e-13   Sorghum bicolor [broomcorn]
ref|XP_010488944.1|  PREDICTED: protein unc-50 homolog                77.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010467286.1|  PREDICTED: protein unc-50 homolog                77.0    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002885951.1|  hypothetical protein ARALYDRAFT_899735           77.0    1e-13   Arabidopsis lyrata subsp. lyrata
gb|AAM61449.1|  unknown                                               77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565370.1|  UNC-50 family protein                               77.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409583.1|  hypothetical protein EUTSA_v10022824mg           76.6    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010547978.1|  PREDICTED: protein unc-50 homolog isoform X1     76.3    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_006296617.1|  hypothetical protein CARUB_v10014338mg           76.6    2e-13   
ref|XP_008356380.1|  PREDICTED: protein unc-50 homolog                76.3    2e-13   Malus domestica [apple tree]
ref|XP_001783677.1|  predicted protein                                75.5    4e-13   
ref|XP_010530733.1|  PREDICTED: protein unc-50 homolog                75.5    4e-13   Tarenaya hassleriana [spider flower]
ref|XP_004136958.1|  PREDICTED: protein unc-50 homolog                75.1    6e-13   Cucumis sativus [cucumbers]
ref|XP_001773436.1|  predicted protein                                74.3    9e-13   
emb|CDX98085.1|  BnaA06g08360D                                        72.4    1e-12   
ref|XP_007201388.1|  hypothetical protein PRUPE_ppa010309mg           73.6    2e-12   Prunus persica
ref|XP_008236376.1|  PREDICTED: protein unc-50 homolog                73.6    2e-12   Prunus mume [ume]
ref|XP_009102331.1|  PREDICTED: protein unc-50 homolog                73.2    2e-12   Brassica rapa
emb|CDY48219.1|  BnaA07g03880D                                        73.2    3e-12   Brassica napus [oilseed rape]
ref|XP_010057258.1|  PREDICTED: protein unc-50 homolog                72.8    3e-12   Eucalyptus grandis [rose gum]
ref|XP_011030395.1|  PREDICTED: protein unc-50 homolog                72.8    3e-12   Populus euphratica
ref|XP_002298750.2|  hypothetical protein POPTR_0001s30740g           72.8    3e-12   Populus trichocarpa [western balsam poplar]
emb|CDY52420.1|  BnaCnng22410D                                        72.8    4e-12   Brassica napus [oilseed rape]
ref|XP_009123230.1|  PREDICTED: protein unc-50 homolog                72.8    4e-12   Brassica rapa
ref|XP_008454998.1|  PREDICTED: protein unc-50 homolog                72.8    4e-12   Cucumis melo [Oriental melon]
gb|EPS67574.1|  hypothetical protein M569_07201                       72.4    4e-12   Genlisea aurea
gb|AFK38140.1|  unknown                                               72.0    6e-12   Lotus japonicus
gb|ACU18710.1|  unknown                                               70.1    7e-12   Glycine max [soybeans]
ref|XP_011467754.1|  PREDICTED: protein unc-50 homolog                71.6    9e-12   Fragaria vesca subsp. vesca
ref|NP_001235443.1|  uncharacterized protein LOC100500001             71.6    1e-11   Glycine max [soybeans]
ref|XP_007143055.1|  hypothetical protein PHAVU_007G039900g           71.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_008338222.1|  PREDICTED: protein unc-50 homolog                69.3    1e-11   
ref|XP_002963517.1|  hypothetical protein SELMODRAFT_165762           70.1    3e-11   Selaginella moellendorffii
ref|XP_003555962.1|  PREDICTED: protein unc-50 homolog                70.1    3e-11   Glycine max [soybeans]
gb|KHN42364.1|  Protein unc-50 like                                   69.7    4e-11   Glycine soja [wild soybean]
ref|XP_006379181.1|  UNC-50 family protein                            69.7    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009335832.1|  PREDICTED: protein unc-50 homolog                68.9    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_002981564.1|  hypothetical protein SELMODRAFT_114708           68.2    1e-10   Selaginella moellendorffii
gb|KEH44101.1|  UNC-50 family protein                                 67.4    3e-10   Medicago truncatula
gb|AFK46272.1|  unknown                                               67.4    3e-10   Medicago truncatula
ref|XP_004496941.1|  PREDICTED: protein unc-50 homolog                62.8    1e-08   Cicer arietinum [garbanzo]
ref|XP_005652231.1|  UNC-50                                           60.5    9e-08   Coccomyxa subellipsoidea C-169
ref|XP_002503978.1|  unc-50 family protein                            55.5    6e-06   Micromonas commoda
ref|XP_629704.1|  UNC-50 family protein                               53.1    4e-05   Dictyostelium discoideum AX4
ref|XP_003294507.1|  hypothetical protein DICPUDRAFT_159511           52.0    9e-05   Dictyostelium purpureum
ref|XP_005716895.1|  unnamed protein product                          52.0    9e-05   Chondrus crispus [carageen]
gb|KFK32095.1|  hypothetical protein AALP_AA6G198500                  48.9    2e-04   Arabis alpina [alpine rockcress]
gb|KFK32094.1|  hypothetical protein AALP_AA6G198500                  48.5    2e-04   Arabis alpina [alpine rockcress]
gb|KFK32096.1|  hypothetical protein AALP_AA6G198500                  48.9    2e-04   Arabis alpina [alpine rockcress]
dbj|GAM19513.1|  hypothetical protein SAMD00019534_026880             50.4    4e-04   Acytostelium subglobosum LB1
ref|XP_003054963.1|  unc-50 family protein                            49.3    7e-04   Micromonas pusilla CCMP1545



>ref|XP_010271213.1| PREDICTED: protein unc-50 homolog isoform X2 [Nelumbo nucifera]
Length=216

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT S  RQNPVFPQY+RRIVKW+QMDIEYTFWQM +LCTSPK
Sbjct  1    MLPT-VSKGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPK  50



>ref|XP_010271205.1| PREDICTED: protein unc-50 homolog isoform X1 [Nelumbo nucifera]
Length=248

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT S  RQNPVFPQY+RRIVKW+QMDIEYTFWQM +LCTSPK
Sbjct  1    MLPT-VSKGRTHSNVRQNPVFPQYLRRIVKWEQMDIEYTFWQMFHLCTSPK  50



>ref|XP_009629275.1| PREDICTED: protein unc-50 homolog [Nicotiana tomentosiformis]
Length=251

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGRTSS+ R N V PQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-TSKGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_009801486.1| PREDICTED: protein unc-50 homolog [Nicotiana sylvestris]
Length=251

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGRTSS+ R N V PQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-TSKGRTSSHVRPNSVLPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  50



>emb|CDO97222.1| unnamed protein product [Coffea canephora]
Length=263

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGRTSS AR N  FP Y+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-TSKGRTSSNARPNSPFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_010928387.1| PREDICTED: protein unc-50 homolog isoform X2 [Elaeis guineensis]
Length=225

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT +  R +P+FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_010928388.1| PREDICTED: protein unc-50 homolog isoform X3 [Elaeis guineensis]
Length=216

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT +  R +P+FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_010928386.1| PREDICTED: protein unc-50 homolog isoform X1 [Elaeis guineensis]
Length=248

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT +  R +P+FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRTPTAVRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_008799595.1| PREDICTED: protein unc-50 homolog isoform X2 [Phoenix dactylifera]
Length=248

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGRT +  R +P+FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRTPAAVRTSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>gb|ABK21352.1| unknown [Picea sitchensis]
Length=249

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  S+GR  S  R +PVFPQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSRGRPPSTFRHSPVFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_007042529.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
 gb|EOX98360.1| UNC-50 family protein isoform 2, partial [Theobroma cacao]
Length=231

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>ref|XP_007042530.1| UNC-50 family protein isoform 3 [Theobroma cacao]
 gb|EOX98361.1| UNC-50 family protein isoform 3 [Theobroma cacao]
Length=200

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>ref|XP_006346362.1| PREDICTED: protein unc-50 homolog [Solanum tuberosum]
Length=253

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSSK-GRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S   GRTSS+ R N V PQY+R+I+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMLHLCTSPK  52



>ref|XP_007042528.1| UNC-50 family protein isoform 1 [Theobroma cacao]
 gb|EOX98359.1| UNC-50 family protein isoform 1 [Theobroma cacao]
Length=252

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRPSSSTSRPNPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|EYU42697.1| hypothetical protein MIMGU_mgv1a012334mg [Erythranthe guttata]
Length=253

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSS-KGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+SS K R+ S+ R N   P Y+RRIVKWQQMDIEYTFWQMLNLCTSPK
Sbjct  1    MLPTSSSAKARSGSHTRPNSFLPHYLRRIVKWQQMDIEYTFWQMLNLCTSPK  52



>ref|XP_002518676.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43601.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 3/53 (6%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA--RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT SSK RTSS +  R +P+FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-SSKIRTSSASTSRPSPMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  52



>ref|XP_004230735.1| PREDICTED: protein unc-50 homolog [Solanum lycopersicum]
Length=253

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSSK-GRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S   GRTSS+ R N V PQY+R+I+KWQQMDIEYTFWQM +LCTSPK
Sbjct  1    MLPTTSKGLGRTSSHVRPNSVLPQYLRKIIKWQQMDIEYTFWQMFHLCTSPK  52



>ref|XP_012075870.1| PREDICTED: protein unc-50 homolog [Jatropha curcas]
Length=252

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 2/52 (4%)
 Frame = +2

Query  137  MLPTNSSKGRTS-SYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT SSK RTS S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-SSKARTSFSSSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_002282581.2| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647895.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
 ref|XP_010647896.1| PREDICTED: protein unc-50 homolog [Vitis vinifera]
Length=251

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGR+ S +R NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_011092536.1| PREDICTED: protein unc-50 homolog isoform X1 [Sesamum indicum]
Length=253

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSS-KGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+SS K R   +AR N +FP Y+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPK  52



>emb|CBI40262.3| unnamed protein product [Vitis vinifera]
Length=258

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGR+ S +R NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRSPSNSRPNPMFLQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  50



>ref|XP_011092537.1| PREDICTED: protein unc-50 homolog isoform X2 [Sesamum indicum]
Length=212

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSS-KGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+SS K R   +AR N +FP Y+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTSSSAKVRPGPHARPNSLFPHYLRRIVKWQQMDIEYTFWQMLHLCTSPK  52



>ref|XP_006844040.1| PREDICTED: protein unc-50 homolog [Amborella trichopoda]
 gb|ERN05715.1| hypothetical protein AMTR_s00006p00238670 [Amborella trichopoda]
Length=248

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +S+GR  S  R N +FP Y+RR++KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASRGRPPSTMRANSIFPHYLRRVIKWQQMDIEYTFWQMLHLCTSPK  50



>gb|KHG13402.1| Protein unc-50 [Gossypium arboreum]
Length=241

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    T S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB47364.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=191

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    T S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB47362.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=252

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    T S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB47366.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=249

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    T S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB47365.1| hypothetical protein B456_008G022900 [Gossypium raimondii]
Length=257

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    T S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSTPSTSRPNSMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>ref|XP_009396396.1| PREDICTED: protein unc-50 homolog [Musa acuminata subsp. malaccensis]
Length=248

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGR +S  R  P F QY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRGTSAVRPAPGFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  50



>tpg|DAA60643.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=69

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +S +   P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGASRS-APPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|NP_001146770.1| uncharacterized protein LOC100280372 [Zea mays]
 gb|ACL54712.1| unknown [Zea mays]
 tpg|DAA60646.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=123

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +S +   P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGASRS-APPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>gb|KJB11965.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
 gb|KJB11967.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=252

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    + S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB11964.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=184

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    + S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|KJB11966.1| hypothetical protein B456_002G009400 [Gossypium raimondii]
Length=224

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    + S +R N +FPQY+RRIVKWQQMDIEYTFWQML+LCT+PK
Sbjct  1    MLPTVSKTRSSISTSRPNAMFPQYLRRIVKWQQMDIEYTFWQMLHLCTAPK  51



>gb|ACN35099.1| unknown [Zea mays]
 tpg|DAA60644.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=254

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +S +   P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGASRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_008651375.1| PREDICTED: uncharacterized protein LOC100280372 isoform X1 [Zea 
mays]
 gb|ACG33123.1| unc-50 [Zea mays]
 gb|ACR34211.1| unknown [Zea mays]
 tpg|DAA60645.1| TPA: Unc-50 [Zea mays]
Length=247

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +S     P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAS-RSAPPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>tpg|DAA60647.1| TPA: hypothetical protein ZEAMMB73_532880 [Zea mays]
Length=215

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +S     P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAS-RSAPPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_006660415.1| PREDICTED: protein unc-50 homolog [Oryza brachyantha]
Length=247

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR ++ +   P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRAATRSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_004956281.1| PREDICTED: protein unc-50 homolog [Setaria italica]
Length=247

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR ++     P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAA-RSAPPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_003576742.1| PREDICTED: protein unc-50 homolog [Brachypodium distachyon]
Length=247

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR ++ +   P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAARSAP-PLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|NP_001062566.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAD17579.1| putative UNC50 [Oryza sativa Japonica Group]
 dbj|BAF24480.1| Os09g0109500 [Oryza sativa Japonica Group]
 dbj|BAG90439.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84080.1| hypothetical protein OsI_30369 [Oryza sativa Indica Group]
Length=247

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR ++     P+F  Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAA-RSAPPLFGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_006422931.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36171.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
Length=254

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA-RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+ SKGR+SS A R NP+FPQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTSVSKGRSSSSASRTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  52



>emb|CDY63605.1| BnaCnng42360D [Brassica napus]
Length=252

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMDIEYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPK  51



>ref|XP_006487004.1| PREDICTED: protein unc-50 homolog [Citrus sinensis]
Length=253

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +2

Query  182  RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            R NP+FPQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  17   RTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  52



>ref|XP_006422929.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 ref|XP_006422930.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36169.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|ESR36170.1| hypothetical protein CICLE_v10029109mg [Citrus clementina]
 gb|KDO59817.1| hypothetical protein CISIN_1g025409mg [Citrus sinensis]
Length=253

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 1/52 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA-RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+ SKGR+SS A R NP+FPQY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTSVSKGRSSSSASRTNPMFPQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  52



>ref|XP_010691673.1| PREDICTED: protein unc-50 homolog [Beta vulgaris subsp. vulgaris]
Length=252

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+S    +S+  + NPVFP Y+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  1    MLPTSSKGRSSSTSRQPNPVFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPK  51



>ref|XP_011001154.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=247

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 5/51 (10%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +S+GR SS    +  FP Y+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  1    MLPT-TSRGRASS----SSTFPHYLRRIIKWQQMDVEYTFWQMLHLCTSPK  46



>ref|XP_010547979.1| PREDICTED: protein unc-50 homolog isoform X2 [Tarenaya hassleriana]
Length=229

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_010518032.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPLFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_002462031.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
 gb|EER98552.1| hypothetical protein SORBIDRAFT_02g013040 [Sorghum bicolor]
Length=247

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR ++ +   P+   Y+RRIVKWQQMDIEYTFWQM++LCTSPK
Sbjct  1    MLPTTASKGRGAARSAP-PLLGPYLRRIVKWQQMDIEYTFWQMVHLCTSPK  50



>ref|XP_010488944.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_010467286.1| PREDICTED: protein unc-50 homolog [Camelina sativa]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_002885951.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62210.1| hypothetical protein ARALYDRAFT_899735 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>gb|AAM61449.1| unknown [Arabidopsis thaliana]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|NP_565370.1| UNC-50 family protein [Arabidopsis thaliana]
 gb|AAK55675.1|AF378872_1 At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAK96450.1| At2g15240/F15A23.2 [Arabidopsis thaliana]
 gb|AAD25568.2| expressed protein [Arabidopsis thaliana]
 gb|AEC06378.1| UNC-50 family protein [Arabidopsis thaliana]
Length=252

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_006409583.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
 gb|ESQ51036.1| hypothetical protein EUTSA_v10022824mg [Eutrema salsugineum]
Length=252

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_010547978.1| PREDICTED: protein unc-50 homolog isoform X1 [Tarenaya hassleriana]
Length=252

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_006296617.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
 gb|EOA29515.1| hypothetical protein CARUB_v10014338mg, partial [Capsella rubella]
Length=282

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  31   MLPTTSRSRSSSSSSRANPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  81



>ref|XP_008356380.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=254

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRGRSSSSASRMNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_001783677.1| predicted protein [Physcomitrella patens]
 gb|EDQ51507.1| predicted protein [Physcomitrella patens]
Length=250

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 2/52 (4%)
 Frame = +2

Query  137  MLPT-NSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT N  +  T  Y R N V PQY+RRIVK++QMD+EYTFWQML+LCTSPK
Sbjct  1    MLPTVNRGRASTGGY-RNNSVLPQYLRRIVKYKQMDMEYTFWQMLHLCTSPK  51



>ref|XP_010530733.1| PREDICTED: protein unc-50 homolog [Tarenaya hassleriana]
Length=252

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S     SS +R NP+F QY RRIVKWQQMDIEYTFWQM +LCTSPK
Sbjct  1    MLPTTSRSRSQSSSSRANPMFLQYFRRIVKWQQMDIEYTFWQMFHLCTSPK  51



>ref|XP_004136958.1| PREDICTED: protein unc-50 homolog [Cucumis sativus]
 gb|KGN43880.1| hypothetical protein Csa_7G071690 [Cucumis sativus]
Length=252

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP++ QY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTASRGRSSSSTSRANPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_001773436.1| predicted protein [Physcomitrella patens]
 gb|EDQ61809.1| predicted protein [Physcomitrella patens]
Length=250

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA-RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  ++GR SS   R N V PQY+RRIVK+QQMD+EYTFWQM +LCTSPK
Sbjct  1    MLPT-VNRGRASSGGYRNNSVLPQYLRRIVKYQQMDMEYTFWQMRHLCTSPK  51



>emb|CDX98085.1| BnaA06g08360D [Brassica napus]
Length=124

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_007201388.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
 gb|EMJ02587.1| hypothetical protein PRUPE_ppa010309mg [Prunus persica]
Length=254

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_008236376.1| PREDICTED: protein unc-50 homolog [Prunus mume]
Length=254

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRGRSSSSTSRTNPMFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_009102331.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
Length=254

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY RRIVKWQQMDIEYTFWQMLNLCTSPK
Sbjct  20   NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPK  53



>emb|CDY48219.1| BnaA07g03880D [Brassica napus]
Length=254

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY RRIVKWQQMDIEYTFWQMLNLCTSPK
Sbjct  20   NPMFLQYFRRIVKWQQMDIEYTFWQMLNLCTSPK  53



>ref|XP_010057258.1| PREDICTED: protein unc-50 homolog [Eucalyptus grandis]
 gb|KCW74300.1| hypothetical protein EUGRSUZ_E02959 [Eucalyptus grandis]
Length=252

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R N +F QY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTASKGRSSSSASRSNNMFSQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_011030395.1| PREDICTED: protein unc-50 homolog [Populus euphratica]
Length=254

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 4/54 (7%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNP---VFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR SS +        FPQY+RRI+KWQQMDIEYTFWQML LCTSPK
Sbjct  1    MLPT-TSKGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPK  53



>ref|XP_002298750.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
 gb|EEE83555.2| hypothetical protein POPTR_0001s30740g [Populus trichocarpa]
Length=254

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 42/54 (78%), Gaps = 4/54 (7%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNP---VFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR SS +        FPQY+RRI+KWQQMDIEYTFWQML LCTSPK
Sbjct  1    MLPT-TSKGRASSSSTSRVNSSTFPQYLRRIIKWQQMDIEYTFWQMLYLCTSPK  53



>emb|CDY52420.1| BnaCnng22410D [Brassica napus]
Length=252

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_009123230.1| PREDICTED: protein unc-50 homolog [Brassica rapa]
 emb|CDY54469.1| BnaA09g52730D [Brassica napus]
Length=252

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY RRIVKWQQMD+EYTFWQMLNLCTSPK
Sbjct  18   NPMFLQYFRRIVKWQQMDVEYTFWQMLNLCTSPK  51



>ref|XP_008454998.1| PREDICTED: protein unc-50 homolog [Cucumis melo]
Length=252

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP++ QY+RRIVKWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTASRGRSSSSTSRTNPMYLQYLRRIVKWQQMDIEYTFWQMLHLCTSPK  51



>gb|EPS67574.1| hypothetical protein M569_07201, partial [Genlisea aurea]
Length=235

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 10/58 (17%)
 Frame = +2

Query  137  MLPTNSS-------KGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT+SS       KGR    AR++  FP Y+RRIVKW+QMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTSSSSSSSSSLKGRP---ARRSHFFPLYLRRIVKWRQMDIEYTFWQMLHLCTSPK  55



>gb|AFK38140.1| unknown [Lotus japonicus]
Length=252

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +2

Query  137  MLPTNSSKGR-TSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR +SS +R N     Y+R+I+KWQQMDIEYTFWQM +LCT+PK
Sbjct  1    MLPT-ASKGRASSSTSRPNSTLLPYLRKIIKWQQMDIEYTFWQMFHLCTAPK  51



>gb|ACU18710.1| unknown [Glycine max]
Length=131

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 8/58 (14%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYAR-------QNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR+SS +         NP+   Y+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASKGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPK  57



>ref|XP_011467754.1| PREDICTED: protein unc-50 homolog [Fragaria vesca subsp. vesca]
Length=253

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +2

Query  188  NPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NP+F QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  19   NPLFIQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  52



>ref|NP_001235443.1| uncharacterized protein LOC100500001 [Glycine max]
 gb|ACU14557.1| unknown [Glycine max]
Length=255

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYAR----QNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR+SS +      NP+   Y+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASKGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPK  54



>ref|XP_007143055.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
 gb|ESW15049.1| hypothetical protein PHAVU_007G039900g [Phaseolus vulgaris]
Length=255

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYAR----QNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR+SS +      NP+   Y+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASKGRSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPK  54



>ref|XP_008338222.1| PREDICTED: protein unc-50 homolog [Malus domestica]
Length=124

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+  QY+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDIEYTFWQMLHLCTSPK  51



>ref|XP_002963517.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
 gb|EFJ35388.1| hypothetical protein SELMODRAFT_165762 [Selaginella moellendorffii]
Length=246

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT + +G      +Q    P Y+RRIVKW+QMD+EYTFWQML+LCT+PK
Sbjct  1    MLPTTAGRGLRHPQQQQ---LPHYLRRIVKWRQMDVEYTFWQMLHLCTAPK  48



>ref|XP_003555962.1| PREDICTED: protein unc-50 homolog [Glycine max]
Length=258

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 8/58 (14%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYAR-------QNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR+SS +         NP+   Y+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASKGRSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPK  57



>gb|KHN42364.1| Protein unc-50 like [Glycine soja]
Length=259

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 9/59 (15%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYAR--------QNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +SKGR+SS +          NP+   Y+RRI+KWQQMDIEYTFWQML+LCTSPK
Sbjct  1    MLPT-ASKGRSSSSSSSSSSSSRPNNPMLLPYLRRIIKWQQMDIEYTFWQMLHLCTSPK  58



>ref|XP_006379181.1| UNC-50 family protein [Populus trichocarpa]
 gb|ERP56978.1| UNC-50 family protein [Populus trichocarpa]
Length=254

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  197  FPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            FPQY+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  23   FPQYLRRIIKWQQMDVEYTFWQMLHLCTSPK  53



>ref|XP_009335832.1| PREDICTED: protein unc-50 homolog [Pyrus x bretschneideri]
Length=254

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT S    +SS +R NP+  QY+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  1    MLPTTSRGRSSSSSSRTNPMPIQYLRRIIKWQQMDVEYTFWQMLHLCTSPK  51



>ref|XP_002981564.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
 gb|EFJ17379.1| hypothetical protein SELMODRAFT_114708 [Selaginella moellendorffii]
Length=248

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT + +G      +Q  + P Y+RRIVKW+QMD+EYTFWQML+LCT+PK
Sbjct  1    MLPTTAGRGLRHPQQQQQQL-PHYLRRIVKWRQMDVEYTFWQMLHLCTAPK  50



>gb|KEH44101.1| UNC-50 family protein [Medicago truncatula]
Length=257

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 7/57 (12%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA------RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGR+SS +      R N     Y+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPK  56



>gb|AFK46272.1| unknown [Medicago truncatula]
Length=257

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 7/57 (12%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYA------RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT  SKGR+SS +      R N     Y+RRI+KWQQMD+EYTFWQML+LCTSPK
Sbjct  1    MLPT-VSKGRSSSSSSSSSSSRPNSTLLPYLRRIIKWQQMDVEYTFWQMLHLCTSPK  56



>ref|XP_004496941.1| PREDICTED: protein unc-50 homolog [Cicer arietinum]
Length=256

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  182  RQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            R N     Y+RRI+KWQQMD+EYTFWQM +LCTSPK
Sbjct  20   RPNSTLLPYLRRIIKWQQMDVEYTFWQMFHLCTSPK  55



>ref|XP_005652231.1| UNC-50 [Coccomyxa subellipsoidea C-169]
 gb|EIE27687.1| UNC-50 [Coccomyxa subellipsoidea C-169]
Length=249

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  137  MLPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLPT +   R+S+  R+  V   Y+RRI+K +QMD EYTFW ML LC SPK
Sbjct  1    MLPTTNHGSRSSNPQRRLSVLSTYLRRIIKPKQMDFEYTFWLMLQLCISPK  51



>ref|XP_002503978.1| unc-50 family protein [Micromonas sp. RCC299]
 gb|ACO65236.1| unc-50 family protein [Micromonas sp. RCC299]
Length=249

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  179  ARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            A +   FP Y+RR++K++QMD+EYTFWQM  +CT+PK
Sbjct  15   AYRGSGFPTYVRRLMKFRQMDLEYTFWQMYLMCTNPK  51



>ref|XP_629704.1| UNC-50 family protein [Dictyostelium discoideum AX4]
 sp|Q54DD7.1|UNC50_DICDI RecName: Full=Protein unc-50 homolog [Dictyostelium discoideum]
 gb|EAL61284.1| UNC-50 family protein [Dictyostelium discoideum AX4]
Length=261

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 34/60 (57%), Gaps = 9/60 (15%)
 Frame = +2

Query  137  MLPT-----NSSK----GRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            MLP      NSS+    G  SS +R   + P+Y RRI  + QMDIEYTFW M  LC +P 
Sbjct  1    MLPISYTNLNSSRITRDGTASSASRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFNPS  60



>ref|XP_003294507.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
 gb|EGC28968.1| hypothetical protein DICPUDRAFT_159511 [Dictyostelium purpureum]
Length=255

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 27/47 (57%), Gaps = 0/47 (0%)
 Frame = +2

Query  149  NSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            NS   R  S +R   + P+Y RRI  + QMDIEYTFW M  LC  P 
Sbjct  11   NSRITRDGSSSRYRRLIPEYFRRIFHYPQMDIEYTFWIMFYLCFGPS  57



>ref|XP_005716895.1| unnamed protein product [Chondrus crispus]
 emb|CDF37076.1| unnamed protein product [Chondrus crispus]
Length=253

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +2

Query  140  LPTNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            LP   +K   +S    +   P+Y+RR  ++ QMD++YT WQML LC +P 
Sbjct  6    LPLYGAKSGATSLGGSSVQMPEYVRRFFQYPQMDMDYTLWQMLYLCVAPS  55



>gb|KFK32095.1| hypothetical protein AALP_AA6G198500 [Arabis alpina]
Length=80

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  218  IVKWQQMDIEYTFWQMLNLCTSPK  289
            I  WQQMD+EYTFWQMLNLC SPK
Sbjct  33   IFVWQQMDVEYTFWQMLNLCLSPK  56



>gb|KFK32094.1| hypothetical protein AALP_AA6G198500 [Arabis alpina]
Length=77

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  218  IVKWQQMDIEYTFWQMLNLCTSPK  289
            I  WQQMD+EYTFWQMLNLC SPK
Sbjct  33   IFVWQQMDVEYTFWQMLNLCLSPK  56



>gb|KFK32096.1| hypothetical protein AALP_AA6G198500 [Arabis alpina]
Length=88

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  218  IVKWQQMDIEYTFWQMLNLCTSPK  289
            I  WQQMD+EYTFWQMLNLC SPK
Sbjct  33   IFVWQQMDVEYTFWQMLNLCLSPK  56



>dbj|GAM19513.1| hypothetical protein SAMD00019534_026880, partial [Acytostelium 
subglobosum LB1]
Length=252

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = +2

Query  146  TNSSKGRTSSYARQNPVFPQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            T +S    S   R     P+Y RRI+ + QMDIEYTFW M  LC +P 
Sbjct  6    TRTSSSLNSDSVRFKRFVPEYFRRIMHYPQMDIEYTFWIMFYLCFNPA  53



>ref|XP_003054963.1| unc-50 family protein [Micromonas pusilla CCMP1545]
 gb|EEH60215.1| unc-50 family protein [Micromonas pusilla CCMP1545]
Length=234

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  200  PQYIRRIVKWQQMDIEYTFWQMLNLCTSPK  289
            P Y+RR +KW+QMD+EY  WQM  +CT+PK
Sbjct  8    PPYLRRAMKWKQMDLEYAMWQMWLMCTNPK  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1063448340092