BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6404

Length=1420
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767215.1|  PREDICTED: porphobilinogen deaminase, chloro...    558   0.0      Nicotiana sylvestris
ref|XP_009610066.1|  PREDICTED: porphobilinogen deaminase, chloro...    555   0.0      Nicotiana tomentosiformis
ref|XP_009792144.1|  PREDICTED: porphobilinogen deaminase, chloro...    555   0.0      Nicotiana sylvestris
ref|XP_009602647.1|  PREDICTED: porphobilinogen deaminase, chloro...    551   0.0      Nicotiana tomentosiformis
ref|XP_004243981.1|  PREDICTED: porphobilinogen deaminase, chloro...    544   0.0      Solanum lycopersicum
ref|XP_006346038.1|  PREDICTED: porphobilinogen deaminase, chloro...    543   0.0      Solanum tuberosum [potatoes]
ref|XP_002520359.1|  porphobilinogen deaminase, putative                540   0.0      Ricinus communis
emb|CDP13602.1|  unnamed protein product                                536   0.0      Coffea canephora [robusta coffee]
ref|XP_011006773.1|  PREDICTED: porphobilinogen deaminase, chloro...    532   0.0      Populus euphratica
ref|XP_002310073.2|  hypothetical protein POPTR_0007s07680g             530   0.0      
ref|XP_007225744.1|  hypothetical protein PRUPE_ppa007124mg             528   0.0      Prunus persica
emb|CBI18797.3|  unnamed protein product                                525   0.0      Vitis vinifera
ref|XP_012072847.1|  PREDICTED: porphobilinogen deaminase, chloro...    527   0.0      Jatropha curcas
gb|KDP37560.1|  hypothetical protein JCGZ_05999                         526   0.0      Jatropha curcas
ref|XP_010647324.1|  PREDICTED: porphobilinogen deaminase, chloro...    526   0.0      Vitis vinifera
ref|XP_011022037.1|  PREDICTED: porphobilinogen deaminase, chloro...    528   0.0      Populus euphratica
ref|XP_008221067.1|  PREDICTED: porphobilinogen deaminase, chloro...    526   0.0      Prunus mume [ume]
ref|XP_008361909.1|  PREDICTED: porphobilinogen deaminase, chloro...    525   0.0      Malus domestica [apple tree]
ref|XP_009351734.1|  PREDICTED: porphobilinogen deaminase, chloro...    521   8e-180   Pyrus x bretschneideri [bai li]
ref|XP_010112535.1|  Porphobilinogen deaminase                          521   1e-179   Morus notabilis
ref|XP_011097642.1|  PREDICTED: porphobilinogen deaminase, chloro...    520   1e-179   Sesamum indicum [beniseed]
ref|NP_001240888.1|  uncharacterized protein LOC100779132               517   1e-178   Glycine max [soybeans]
ref|XP_003537739.1|  PREDICTED: porphobilinogen deaminase, chloro...    514   7e-178   Glycine max [soybeans]
ref|XP_010046969.1|  PREDICTED: porphobilinogen deaminase, chloro...    516   9e-178   Eucalyptus grandis [rose gum]
gb|KHN20627.1|  Porphobilinogen deaminase, chloroplastic                513   2e-177   Glycine soja [wild soybean]
ref|NP_001242644.1|  uncharacterized protein LOC100812733               511   2e-176   
gb|ACU17610.1|  unknown                                                 510   6e-176   Glycine max [soybeans]
ref|XP_006437594.1|  hypothetical protein CICLE_v10031858mg             511   6e-176   Citrus clementina [clementine]
ref|XP_003607331.1|  Porphobilinogen deaminase                          509   2e-175   Medicago truncatula
ref|XP_007156992.1|  hypothetical protein PHAVU_002G034500g             510   2e-175   Phaseolus vulgaris [French bean]
ref|XP_004505653.1|  PREDICTED: porphobilinogen deaminase, chloro...    509   2e-175   Cicer arietinum [garbanzo]
gb|EYU27543.1|  hypothetical protein MIMGU_mgv1a008527mg                508   1e-174   Erythranthe guttata [common monkey flower]
ref|XP_007133420.1|  hypothetical protein PHAVU_011G1771000g            503   1e-173   Phaseolus vulgaris [French bean]
sp|Q43082.1|HEM3_PEA  RecName: Full=Porphobilinogen deaminase, ch...    504   1e-173   Pisum sativum [garden pea]
gb|KGN58555.1|  hypothetical protein Csa_3G682170                       499   1e-171   Cucumis sativus [cucumbers]
ref|XP_004149732.1|  PREDICTED: porphobilinogen deaminase, chloro...    498   6e-171   Cucumis sativus [cucumbers]
ref|XP_004306458.1|  PREDICTED: porphobilinogen deaminase, chloro...    498   7e-171   Fragaria vesca subsp. vesca
ref|XP_004297733.1|  PREDICTED: porphobilinogen deaminase, chloro...    496   4e-170   Fragaria vesca subsp. vesca
gb|KJB31849.1|  hypothetical protein B456_005G211000                    495   8e-170   Gossypium raimondii
ref|XP_002873350.1|  hypothetical protein ARALYDRAFT_908776             495   1e-169   Arabidopsis lyrata subsp. lyrata
ref|XP_006287933.1|  hypothetical protein CARUB_v10001168mg             494   3e-169   Capsella rubella
ref|NP_196445.1|  Porphobilinogen deaminase                             493   6e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276152.1|  PREDICTED: porphobilinogen deaminase, chloro...    493   1e-168   Nelumbo nucifera [Indian lotus]
gb|EPS63046.1|  hypothetical protein M569_11740                         491   1e-168   Genlisea aurea
ref|XP_009125721.1|  PREDICTED: porphobilinogen deaminase, chloro...    492   2e-168   Brassica rapa
ref|XP_011626606.1|  PREDICTED: porphobilinogen deaminase, chloro...    491   3e-168   Amborella trichopoda
ref|XP_006399317.1|  hypothetical protein EUTSA_v10013814mg             491   3e-168   Eutrema salsugineum [saltwater cress]
ref|XP_010522127.1|  PREDICTED: porphobilinogen deaminase, chloro...    491   3e-168   Tarenaya hassleriana [spider flower]
emb|CDX69959.1|  BnaA10g23080D                                          491   6e-168   
ref|XP_009122439.1|  PREDICTED: porphobilinogen deaminase, chloro...    491   7e-168   Brassica rapa
emb|CDY21529.1|  BnaC09g47630D                                          490   8e-168   Brassica napus [oilseed rape]
ref|XP_010670537.1|  PREDICTED: porphobilinogen deaminase, chloro...    489   1e-167   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM64573.1|  hydroxymethylbilane synthase                            490   1e-167   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44763.1|  BnaC02g01240D                                          489   2e-167   Brassica napus [oilseed rape]
gb|EYU33770.1|  hypothetical protein MIMGU_mgv1a008233mg                489   2e-167   Erythranthe guttata [common monkey flower]
ref|XP_010423118.1|  PREDICTED: porphobilinogen deaminase, chloro...    489   2e-167   Camelina sativa [gold-of-pleasure]
gb|ERN14810.1|  hypothetical protein AMTR_s00032p00091590               492   2e-167   Amborella trichopoda
emb|CDY40758.1|  BnaAnng06210D                                          489   2e-167   Brassica napus [oilseed rape]
pdb|4HTG|A  Chain A, Porphobilinogen Deaminase From Arabidopsis T...    486   3e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491454.1|  PREDICTED: porphobilinogen deaminase, chloro...    489   4e-167   Camelina sativa [gold-of-pleasure]
emb|CDX81090.1|  BnaC03g03440D                                          488   9e-167   
ref|XP_009131051.1|  PREDICTED: porphobilinogen deaminase, chloro...    486   3e-166   
emb|CDX78330.1|  BnaA03g02420D                                          484   1e-165   
ref|XP_010547710.1|  PREDICTED: LOW QUALITY PROTEIN: porphobilino...    484   2e-165   Tarenaya hassleriana [spider flower]
ref|XP_007043279.1|  Hydroxymethylbilane synthase isoform 1             482   8e-165   
gb|KHG03036.1|  Porphobilinogen deaminase, chloroplastic                482   1e-164   Gossypium arboreum [tree cotton]
gb|KJB77369.1|  hypothetical protein B456_012G134300                    481   4e-164   Gossypium raimondii
ref|XP_008793588.1|  PREDICTED: porphobilinogen deaminase, chloro...    476   2e-162   Phoenix dactylifera
ref|XP_009414508.1|  PREDICTED: porphobilinogen deaminase, chloro...    476   3e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813288.1|  PREDICTED: porphobilinogen deaminase, chloro...    475   5e-162   Phoenix dactylifera
ref|XP_002306378.2|  hypothetical protein POPTR_0005s09400g             474   7e-162   
ref|XP_008793587.1|  PREDICTED: porphobilinogen deaminase, chloro...    473   3e-161   Phoenix dactylifera
ref|XP_010927101.1|  PREDICTED: LOW QUALITY PROTEIN: porphobilino...    472   6e-161   
ref|XP_010941629.1|  PREDICTED: porphobilinogen deaminase, chloro...    471   1e-160   Elaeis guineensis
ref|XP_008793589.1|  PREDICTED: porphobilinogen deaminase, chloro...    450   2e-152   
gb|ABK26871.1|  unknown                                                 449   2e-151   Picea sitchensis
gb|ABR17705.1|  unknown                                                 448   3e-151   Picea sitchensis
ref|XP_001781636.1|  predicted protein                                  445   1e-149   
ref|XP_008461840.1|  PREDICTED: porphobilinogen deaminase, chloro...    439   3e-149   Cucumis melo [Oriental melon]
ref|XP_004951778.1|  PREDICTED: porphobilinogen deaminase, chloro...    441   9e-149   Setaria italica
ref|XP_007043280.1|  Hydroxymethylbilane synthase isoform 2             431   9e-146   
ref|NP_001046017.1|  Os02g0168800                                       431   1e-144   
ref|XP_010276153.1|  PREDICTED: porphobilinogen deaminase, chloro...    427   2e-144   Nelumbo nucifera [Indian lotus]
ref|XP_002961888.1|  hypothetical protein SELMODRAFT_164683             430   2e-144   Selaginella moellendorffii
ref|XP_006648352.1|  PREDICTED: porphobilinogen deaminase, chloro...    429   4e-144   
ref|XP_008813290.1|  PREDICTED: porphobilinogen deaminase, chloro...    426   7e-144   Phoenix dactylifera
ref|XP_002990245.1|  hypothetical protein SELMODRAFT_447969             428   7e-144   Selaginella moellendorffii
gb|EEC72572.1|  hypothetical protein OsI_06012                          428   1e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_003570067.1|  PREDICTED: porphobilinogen deaminase, chloro...    428   1e-143   Brachypodium distachyon [annual false brome]
ref|XP_001769569.1|  predicted protein                                  427   3e-143   
ref|XP_008793590.1|  PREDICTED: porphobilinogen deaminase, chloro...    420   8e-142   Phoenix dactylifera
ref|XP_010456444.1|  PREDICTED: porphobilinogen deaminase, chloro...    423   1e-141   
ref|XP_001780954.1|  predicted protein                                  418   1e-140   
ref|XP_002451613.1|  hypothetical protein SORBIDRAFT_04g004630          414   3e-138   Sorghum bicolor [broomcorn]
gb|AFW66382.1|  porphobilinogen deaminase                               413   7e-138   
ref|XP_008680937.1|  PREDICTED: uncharacterized protein LOC100191...    413   7e-138   
gb|AAL12220.1|  porphobilinogen deaminase                               411   1e-137   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001150986.1|  LOC100284619                                       411   4e-137   Zea mays [maize]
gb|EMT29771.1|  Porphobilinogen deaminase, chloroplastic                404   1e-134   
ref|XP_002451614.1|  hypothetical protein SORBIDRAFT_04g004640          400   6e-133   
ref|NP_001130048.1|  uncharacterized protein LOC100191140               401   1e-132   
ref|XP_008677339.1|  PREDICTED: LOC100284619 isoform X2                 394   6e-131   Zea mays [maize]
gb|AFW70271.1|  camouflage1                                             394   1e-130   
ref|XP_001701485.1|  porphobilinogen deaminase                          394   2e-130   Chlamydomonas reinhardtii
gb|ABF70028.1|  porphobilinogen deaminase, chloroplast (hydroxyme...    396   3e-130   Musa acuminata [banana]
ref|XP_008677338.1|  PREDICTED: LOC100284619 isoform X1                 393   4e-130   Zea mays [maize]
dbj|BAD25718.1|  putative porphobilinogen deaminase                     388   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002950840.1|  hypothetical protein VOLCADRAFT_85406              390   6e-129   Volvox carteri f. nagariensis
ref|XP_003607332.1|  Porphobilinogen deaminase                          381   3e-127   
ref|XP_005649123.1|  porphobilinogen deaminase                          385   6e-127   Coccomyxa subellipsoidea C-169
ref|XP_011396337.1|  Porphobilinogen deaminase, chloroplastic           376   3e-123   Auxenochlorella protothecoides
ref|XP_007509251.1|  porphobilinogen deaminase                          374   2e-122   Bathycoccus prasinos
ref|XP_005843555.1|  hypothetical protein CHLNCDRAFT_33052              368   3e-120   Chlorella variabilis
ref|XP_002507564.1|  hydroxymethylbilane synthase                       367   5e-120   Micromonas commoda
gb|KHN35094.1|  Porphobilinogen deaminase, chloroplastic                363   5e-120   Glycine soja [wild soybean]
ref|XP_006591520.1|  PREDICTED: porphobilinogen deaminase, chloro...    363   1e-119   
gb|ABF70029.1|  porphobilinogen deaminase, chloroplast (hydroxyme...    361   6e-118   Musa acuminata [banana]
gb|EMS48955.1|  Porphobilinogen deaminase, chloroplastic                357   9e-117   Triticum urartu
gb|ACJ83604.1|  unknown                                                 353   1e-116   Medicago truncatula
ref|XP_008360135.1|  PREDICTED: porphobilinogen deaminase, chloro...    352   9e-115   
dbj|BAB41183.1|  porphobilinogen deaminase                              348   1e-114   Amaranthus tricolor [Chinese spinach]
ref|XP_003056550.1|  porphobilinogen deaminase, chloroplast precu...    354   2e-114   Micromonas pusilla CCMP1545
gb|AFK34523.1|  unknown                                                 348   9e-114   Lotus japonicus
gb|KDO52734.1|  hypothetical protein CISIN_1g020472mg                   347   1e-112   Citrus sinensis [apfelsine]
emb|CEF97893.1|  Porphobilinogen deaminase, C-terminal                  346   1e-111   Ostreococcus tauri
gb|EWM30321.1|  porphobilinogen deaminase                               346   1e-111   Nannochloropsis gaditana
ref|XP_001417948.1|  predicted protein                                  343   5e-111   Ostreococcus lucimarinus CCE9901
ref|WP_008616862.1|  porphobilinogen deaminase                          341   2e-110   Magnetospirillum caucaseum
ref|XP_003079219.1|  putative porphobilinogen deaminase (ISS)           344   7e-110   
ref|WP_009869955.1|  Porphobilinogen deaminase                          339   2e-109   Magnetospirillum magnetotacticum
ref|WP_043745666.1|  porphobilinogen deaminase                          337   1e-108   Magnetospirillum magneticum
ref|WP_024079153.1|  hydroxymethylbilane synthase                       336   2e-108   Magnetospirillum gryphiswaldense
ref|WP_014415752.1|  porphobilinogen deaminase                          328   2e-105   Pararhodospirillum photometricum
ref|WP_021132426.1|  porphobilinogen deaminase                          328   4e-105   Phaeospirillum fulvum
gb|KJB31851.1|  hypothetical protein B456_005G211000                    325   9e-105   Gossypium raimondii
ref|XP_002179459.1|  hydroxymethylbilane synthase                       327   1e-104   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002292986.1|  porphobilinogen deaminase                          327   2e-104   Thalassiosira pseudonana CCMP1335
ref|WP_002729267.1|  porphobilinogen deaminase                          326   2e-104   Phaeospirillum molischianum
ref|WP_019645838.1|  hypothetical protein                               325   3e-104   Novispirillum itersonii
gb|EJK45103.1|  hypothetical protein THAOC_36301                        324   3e-103   Thalassiosira oceanica
gb|KIY94897.1|  hydroxymethylbilane synthase                            322   9e-103   Monoraphidium neglectum
gb|ABD51930.1|  chloroplast hydroxymethylbilane synthase                323   9e-103   Guillardia theta
ref|WP_046022495.1|  porphobilinogen deaminase                          321   2e-102   Magnetospira sp. QH-2
ref|XP_005834478.1|  hypothetical protein GUITHDRAFT_162740             323   2e-102   Guillardia theta CCMP2712
emb|CBJ30046.1|  hydroxymethylbilane synthase, putative chloropla...    323   2e-102   Ectocarpus siliculosus
ref|WP_011391315.1|  porphobilinogen deaminase                          318   2e-101   Rhodospirillum rubrum
gb|AFW66383.1|  hypothetical protein ZEAMMB73_808224                    315   1e-100   
ref|XP_009037531.1|  hypothetical protein AURANDRAFT_27306              316   2e-100   Aureococcus anophagefferens
ref|WP_038012779.1|  porphobilinogen deaminase                          311   9e-99    Terasakiella pusilla
ref|XP_005782931.1|  hypothetical protein EMIHUDRAFT_423968             314   1e-98    Emiliania huxleyi CCMP1516
dbj|BAH84857.1|  putative porphobilinogen deaminase                     306   1e-98    Cucumis sativus [cucumbers]
dbj|BAE53224.1|  Porphobilinogen deaminase                              304   1e-96    Magnetospirillum magneticum AMB-1
ref|WP_045664149.1|  porphobilinogen deaminase                          305   3e-96    
ref|WP_022732749.1|  porphobilinogen deaminase                          302   4e-95    Thalassospira lucentensis
gb|AEQ18820.1|  porphobilinogen deaminase                               303   6e-95    Chromera velia
ref|WP_009539461.1|  Porphobilinogen deaminase                          301   9e-95    Caenispirillum salinarum
gb|KIZ01397.1|  hypothetical protein MNEG_6565                          304   1e-94    Monoraphidium neglectum
ref|WP_008888587.1|  porphobilinogen deaminase                          297   3e-93    Thalassospira profundimaris
ref|WP_033070431.1|  porphobilinogen deaminase                          297   3e-93    Thalassospira australica
gb|KDO52735.1|  hypothetical protein CISIN_1g020472mg                   292   2e-92    Citrus sinensis [apfelsine]
ref|WP_044829765.1|  porphobilinogen deaminase                          295   2e-92    Thalassospira sp. HJ
ref|WP_044558528.1|  porphobilinogen deaminase                          295   3e-92    Azospirillum sp. B4
ref|WP_007088688.1|  porphobilinogen deaminase                          287   3e-89    Thalassospira xiamenensis
ref|WP_037988369.1|  porphobilinogen deaminase                          286   4e-89    Thalassospira permensis
ref|WP_013950414.1|  MULTISPECIES: porphobilinogen deaminase            285   1e-88    Hyphomicrobium
ref|WP_026987992.1|  porphobilinogen deaminase                          284   3e-88    Fodinicurvata fenggangensis
ref|WP_036561184.1|  porphobilinogen deaminase                          283   6e-88    Oceanicola sp. MCTG156(1a)
ref|WP_045999655.1|  porphobilinogen deaminase                          283   7e-88    Paracoccus sp. 228
ref|WP_013419820.1|  porphobilinogen deaminase                          283   9e-88    Rhodomicrobium vannielii
ref|WP_036699861.1|  porphobilinogen deaminase                          283   1e-87    
ref|WP_015599949.1|  porphobilinogen deaminase                          283   1e-87    Hyphomicrobium denitrificans
ref|WP_023785686.1|  porphobilinogen deaminase                          282   2e-87    Hyphomicrobium nitrativorans
ref|WP_022708022.1|  porphobilinogen deaminase                          282   2e-87    Paracoccus zeaxanthinifaciens
ref|WP_045980881.1|  porphobilinogen deaminase                          282   2e-87    Paracoccus sp. S4493
ref|XP_005704560.1|  hydroxymethylbilane synthase                       284   3e-87    Galdieria sulphuraria
ref|WP_037927918.1|  porphobilinogen deaminase                          281   3e-87    Sulfitobacter pseudonitzschiae
ref|WP_008943976.1|  porphobilinogen deaminase                          281   4e-87    Oceanibaculum indicum
emb|CFX11370.1|  hydroxymethylbilane synthase                           281   4e-87    Candidatus Filomicrobium marinum
ref|WP_037233090.1|  porphobilinogen deaminase                          281   5e-87    Rhodomicrobium udaipurense
ref|WP_028957118.1|  porphobilinogen deaminase                          280   9e-87    Sulfitobacter sp. 20_GPM-1509m
ref|WP_036736121.1|  porphobilinogen deaminase                          279   2e-86    
ref|WP_045837491.1|  porphobilinogen deaminase                          279   2e-86    Hyphomicrobium sp. 99
ref|WP_037451402.1|  porphobilinogen deaminase                          279   2e-86    
gb|KAI96092.1|  porphobilinogen deaminase                               279   3e-86    Rhodomicrobium udaipurense JA643
ref|WP_036711670.1|  MULTISPECIES: porphobilinogen deaminase            278   4e-86    
ref|WP_041527873.1|  porphobilinogen deaminase                          278   4e-86    Paracoccus aminophilus
ref|WP_007255416.1|  porphobilinogen deaminase                          278   5e-86    Oceanicola granulosus
ref|WP_038132319.1|  porphobilinogen deaminase                          278   6e-86    
ref|WP_039540721.1|  porphobilinogen deaminase                          278   7e-86    Ruegeria sp. ANG-R
gb|KEO55605.1|  porphobilinogen deaminase                               278   7e-86    Thioclava indica
ref|WP_024810783.1|  porphobilinogen deaminase                          278   8e-86    Oceanicola sp. HL-35
ref|WP_023851157.1|  porphobilinogen deaminase                          277   1e-85    Rhodobacteraceae bacterium PD-2
ref|WP_022729432.1|  porphobilinogen deaminase                          277   2e-85    Fodinicurvata sediminis
ref|WP_029058080.1|  porphobilinogen deaminase                          276   2e-85    Stappia stellulata
ref|WP_026758124.1|  porphobilinogen deaminase                          276   3e-85    Sediminimonas qiaohouensis
ref|WP_011539846.1|  porphobilinogen deaminase                          276   5e-85    Ruegeria sp. TM1040
ref|WP_007793611.1|  porphobilinogen deaminase                          275   8e-85    Salipiger bermudensis
ref|WP_027287453.1|  porphobilinogen deaminase                          275   1e-84    Rhodovibrio salinarum
ref|WP_043767487.1|  porphobilinogen deaminase                          275   2e-84    Roseivivax isoporae
ref|WP_009177806.1|  porphobilinogen deaminase                          275   2e-84    Silicibacter sp. TrichCH4B
ref|WP_009798520.1|  porphobilinogen deaminase                          274   4e-84    Nitrobacter sp. Nb-311A
ref|WP_046002114.1|  porphobilinogen deaminase                          273   7e-84    Epibacterium mobile
ref|WP_045369227.1|  porphobilinogen deaminase                          273   8e-84    
ref|WP_028030585.1|  porphobilinogen deaminase                          273   1e-83    Gemmobacter nectariphilus
ref|WP_038072126.1|  porphobilinogen deaminase                          272   2e-83    
ref|WP_036722300.1|  porphobilinogen deaminase                          271   2e-83    
ref|WP_013217400.1|  porphobilinogen deaminase                          271   2e-83    Hyphomicrobium denitrificans
ref|WP_011313802.1|  porphobilinogen deaminase                          271   2e-83    Nitrobacter winogradskyi
ref|WP_009818330.1|  porphobilinogen deaminase                          271   2e-83    Roseovarius sp. 217
ref|WP_011456959.1|  porphobilinogen deaminase                          271   2e-83    Jannaschia sp. CCS1
ref|WP_037260363.1|  porphobilinogen deaminase                          271   3e-83    Roseivivax halodurans
ref|WP_010443568.1|  porphobilinogen deaminase                          271   4e-83    Ruegeria conchae
ref|WP_025310957.1|  porphobilinogen deaminase                          271   4e-83    Roseibacterium elongatum
ref|WP_036346454.1|  porphobilinogen deaminase                          271   5e-83    Microvirga sp. BSC39
ref|WP_024351921.1|  porphobilinogen deaminase                          270   6e-83    Aurantimonas coralicida
ref|WP_037242990.1|  porphobilinogen deaminase                          270   6e-83    Roseovarius sp. MCTG156(2b)
ref|WP_008559063.1|  porphobilinogen deaminase                          271   7e-83    Ruegeria sp. R11
ref|WP_008282440.1|  porphobilinogen deaminase                          270   8e-83    Roseovarius sp. TM1035
ref|WP_009806314.1|  porphobilinogen deaminase                          270   9e-83    Pseudooceanicola batsensis
ref|WP_035707557.1|  porphobilinogen deaminase                          270   9e-83    Niveispirillum irakense
ref|WP_006327152.1|  hydroxymethylbilane synthase                       270   1e-82    Mesorhizobium sp. STM 4661
gb|ESR22575.1|  Porphobilinogen deaminase                               270   1e-82    Lutibaculum baratangense AMV1
ref|WP_040486198.1|  porphobilinogen deaminase                          270   1e-82    
ref|WP_038148380.1|  porphobilinogen deaminase                          269   3e-82    
ref|WP_045681231.1|  porphobilinogen deaminase                          269   3e-82    
gb|KFE33690.1|  porphobilinogen deaminase                               269   3e-82    Thioclava atlantica
ref|WP_008208997.1|  porphobilinogen deaminase                          268   4e-82    Roseobacter sp. SK209-2-6
ref|WP_009493632.1|  porphobilinogen deaminase                          268   6e-82    Microvirga lotononidis
ref|WP_009211454.1|  porphobilinogen deaminase                          268   7e-82    Aurantimonas manganoxydans
ref|WP_008384225.1|  porphobilinogen deaminase                          268   7e-82    Rhodovulum sp. PH10
ref|WP_039682060.1|  porphobilinogen deaminase                          268   7e-82    Tateyamaria sp. ANG-S1
ref|WP_046120534.1|  porphobilinogen deaminase                          268   7e-82    Sinorhizobium/Ensifer group
ref|WP_008757068.1|  porphobilinogen deaminase                          268   8e-82    Rhodobacteraceae bacterium KLH11
ref|WP_011509156.1|  porphobilinogen deaminase                          268   9e-82    Nitrobacter hamburgensis
ref|WP_038034928.1|  porphobilinogen deaminase                          267   1e-81    Thermopetrobacter sp. TC1
ref|WP_027316789.1|  porphobilinogen deaminase                          267   1e-81    Microvirga flocculans
ref|WP_008192927.1|  porphobilinogen deaminase                          267   1e-81    Labrenzia alexandrii
ref|WP_042250405.1|  porphobilinogen deaminase                          268   1e-81    
gb|EDM70283.1|  porphobilinogen deaminase                               267   1e-81    Roseobacter sp. AzwK-3b
gb|ACJ85312.1|  unknown                                                 265   1e-81    Medicago truncatula
ref|WP_036485948.1|  porphobilinogen deaminase                          267   1e-81    Nitratireductor basaltis
gb|EAP75274.1|  porphobilinogen deaminase                               266   2e-81    Roseovarius nubinhibens ISM
ref|WP_039149675.1|  porphobilinogen deaminase                          267   2e-81    Leisingera sp. ANG-DT
ref|WP_040618046.1|  porphobilinogen deaminase                          266   2e-81    Roseovarius nubinhibens
ref|WP_009466433.1|  porphobilinogen deaminase                          266   2e-81    Roseibium sp. TrichSKD4
ref|WP_008873487.1|  hydroxymethylbilane synthase                       266   2e-81    Mesorhizobium metallidurans
ref|WP_037296007.1|  porphobilinogen deaminase                          266   2e-81    Roseobacter sp. AzwK-3b
ref|WP_008551662.1|  porphobilinogen deaminase                          266   2e-81    Pseudovibrio sp. JE062
gb|KFI30717.1|  porphobilinogen deaminase                               266   2e-81    Paenirhodobacter enshiensis
ref|WP_039173953.1|  porphobilinogen deaminase                          266   2e-81    Leisingera sp. ANG-S5
ref|WP_014287098.1|  porphobilinogen deaminase                          266   2e-81    Pseudovibrio sp. FO-BEG1
ref|WP_036634250.1|  porphobilinogen deaminase                          266   3e-81    Paenirhodobacter enshiensis
ref|WP_026615491.1|  porphobilinogen deaminase                          266   3e-81    Ensifer aridi
ref|WP_043744585.1|  porphobilinogen deaminase                          266   4e-81    Pseudooceanicola atlanticus
ref|WP_039181587.1|  porphobilinogen deaminase                          266   4e-81    Leisingera sp. ANG-M7
ref|WP_036353217.1|  porphobilinogen deaminase                          266   4e-81    
ref|WP_027235204.1|  porphobilinogen deaminase                          266   4e-81    Leisingera caerulea
ref|WP_007067943.1|  porphobilinogen deaminase                          266   5e-81    Fulvimarina pelagi
ref|WP_027248634.1|  porphobilinogen deaminase                          266   5e-81    Phaeobacter inhibens
ref|WP_027256500.1|  porphobilinogen deaminase                          266   5e-81    Leisingera aquimarina
ref|WP_039159977.1|  porphobilinogen deaminase                          266   5e-81    Leisingera sp. ANG-M1
ref|WP_029204908.1|  MULTISPECIES: porphobilinogen deaminase            266   5e-81    Leisingera
ref|WP_024088872.1|  porphobilinogen deaminase                          266   6e-81    Leisingera methylohalidivorans
ref|WP_014881145.1|  porphobilinogen deaminase                          266   6e-81    Phaeobacter inhibens
ref|WP_039133986.1|  porphobilinogen deaminase                          265   6e-81    Leisingera sp. ANG-Vp
gb|EDZ47977.1|  porphobilinogen deaminase                               266   6e-81    Rhodobacterales bacterium Y4I
ref|WP_014875875.1|  porphobilinogen deaminase                          265   6e-81    Phaeobacter inhibens
ref|WP_013963330.1|  porphobilinogen deaminase                          265   6e-81    Roseobacter litoralis
ref|WP_039949858.1|  porphobilinogen deaminase                          265   7e-81    Rhodobacterales bacterium Y4I
ref|WP_040440758.1|  porphobilinogen deaminase                          265   8e-81    Labrenzia aggregata
ref|WP_025046865.1|  porphobilinogen deaminase                          265   8e-81    Sulfitobacter mediterraneus
ref|WP_038064735.1|  porphobilinogen deaminase                          265   9e-81    
ref|WP_020085727.1|  hypothetical protein                               265   9e-81    Hyphomicrobium zavarzinii
ref|WP_010139096.1|  porphobilinogen deaminase                          265   1e-80    Oceanicola sp. S124
ref|WP_040181230.1|  porphobilinogen deaminase                          265   1e-80    Phaeobacter sp. S60
gb|EAV41949.1|  porphobilinogen deaminase                               264   1e-80    Labrenzia aggregata IAM 12614
ref|WP_037228429.1|  porphobilinogen deaminase                          265   1e-80    Roseobacter sp. GAI101
ref|WP_014330123.1|  porphobilinogen deaminase                          264   1e-80    Sinorhizobium fredii
ref|WP_039191807.1|  porphobilinogen deaminase                          264   2e-80    Leisingera sp. ANG-M6
ref|WP_041375316.1|  porphobilinogen deaminase                          264   2e-80    
ref|WP_037393857.1|  porphobilinogen deaminase                          264   2e-80    
ref|WP_028737157.1|  porphobilinogen deaminase                          264   2e-80    
gb|ADZ68810.1|  Porphobilinogen deaminase                               263   2e-80    
ref|WP_023760927.1|  porphobilinogen deaminase                          263   3e-80    
ref|WP_027241609.1|  porphobilinogen deaminase                          264   3e-80    
ref|WP_012330392.1|  MULTISPECIES: porphobilinogen deaminase            263   3e-80    
ref|WP_026261137.1|  porphobilinogen deaminase                          263   3e-80    
ref|WP_027244659.1|  porphobilinogen deaminase                          263   3e-80    
ref|WP_043619941.1|  porphobilinogen deaminase                          263   3e-80    
ref|WP_040777004.1|  porphobilinogen deaminase                          263   3e-80    
ref|WP_037429512.1|  porphobilinogen deaminase                          263   3e-80    
ref|XP_005535635.1|  porphobilinogen deaminase                          266   4e-80    
ref|WP_011049329.1|  porphobilinogen deaminase                          263   4e-80    
ref|WP_009809739.1|  porphobilinogen deaminase                          263   4e-80    
ref|WP_042645556.1|  porphobilinogen deaminase                          263   5e-80    
ref|WP_028094134.1|  porphobilinogen deaminase                          263   5e-80    
ref|WP_023670483.1|  MULTISPECIES: porphobilinogen deaminase            263   6e-80    
ref|WP_027037391.1|  porphobilinogen deaminase                          263   6e-80    
ref|WP_043846497.1|  porphobilinogen deaminase                          263   6e-80    
ref|WP_037910935.1|  porphobilinogen deaminase                          263   7e-80    
ref|WP_026356015.1|  porphobilinogen deaminase                          262   8e-80    
ref|WP_024503042.1|  porphobilinogen deaminase                          262   9e-80    
ref|WP_027042906.1|  porphobilinogen deaminase                          262   9e-80    
ref|WP_027144599.1|  porphobilinogen deaminase                          262   1e-79    
ref|WP_005850014.1|  MULTISPECIES: porphobilinogen deaminase            262   1e-79    
ref|WP_043141056.1|  porphobilinogen deaminase                          262   1e-79    
ref|WP_023824345.1|  porphobilinogen deaminase                          261   1e-79    
ref|WP_040174551.1|  porphobilinogen deaminase                          262   1e-79    
ref|WP_027163059.1|  porphobilinogen deaminase                          261   1e-79    
ref|WP_035683980.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_040961994.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_013528908.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_009506946.1|  porphobilinogen deaminase                          262   2e-79    
ref|WP_023771864.1|  MULTISPECIES: porphobilinogen deaminase            261   2e-79    
ref|WP_024923093.1|  MULTISPECIES: porphobilinogen deaminase            261   2e-79    
gb|ERP87798.1|  porphobilinogen deaminase                               261   2e-79    
ref|WP_008834613.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_044428213.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_031270219.1|  MULTISPECIES: porphobilinogen deaminase            261   2e-79    
ref|WP_019956039.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_027301693.1|  porphobilinogen deaminase                          261   2e-79    
ref|WP_025053790.1|  porphobilinogen deaminase                          261   3e-79    
ref|WP_020041879.1|  porphobilinogen deaminase                          261   3e-79    
ref|WP_040104272.1|  porphobilinogen deaminase                          261   3e-79    
ref|WP_017997771.1|  porphobilinogen deaminase                          261   3e-79    
ref|WP_027169099.1|  porphobilinogen deaminase                          260   3e-79    
ref|WP_042775898.1|  porphobilinogen deaminase                          261   3e-79    
ref|WP_026060125.1|  porphobilinogen deaminase                          260   4e-79    
ref|WP_037091270.1|  porphobilinogen deaminase                          260   5e-79    
ref|WP_027050511.1|  porphobilinogen deaminase                          260   5e-79    
ref|WP_024898562.1|  porphobilinogen deaminase                          260   5e-79    
ref|WP_026790805.1|  porphobilinogen deaminase                          260   6e-79    
ref|WP_023687735.1|  porphobilinogen deaminase                          260   6e-79    
gb|AAG50298.1|  porphobilinogen deaminase                               260   6e-79    
ref|WP_024586872.1|  porphobilinogen deaminase                          260   7e-79    
ref|WP_037164804.1|  MULTISPECIES: porphobilinogen deaminase            259   8e-79    
ref|WP_023784154.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_034802595.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_009825369.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_026227654.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_021694013.1|  porphobilinogen deaminase                          259   1e-78    
gb|AHD08217.1|  hydroxymethylbilane synthase                            260   1e-78    
ref|WP_036759768.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_040974571.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_025051088.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_008883559.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_037269270.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_029617466.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_040996446.1|  porphobilinogen deaminase                          259   1e-78    
ref|WP_023737969.1|  MULTISPECIES: porphobilinogen deaminase            259   2e-78    
ref|WP_028001771.1|  porphobilinogen deaminase                          259   2e-78    
ref|WP_024706559.1|  porphobilinogen deaminase                          259   2e-78    
ref|WP_012709692.1|  porphobilinogen deaminase                          259   2e-78    
ref|WP_025425100.1|  porphobilinogen deaminase                          258   2e-78    
ref|WP_020055971.1|  hypothetical protein                               259   2e-78    
ref|WP_023756506.1|  MULTISPECIES: porphobilinogen deaminase            258   2e-78    
ref|WP_041414721.1|  porphobilinogen deaminase                          258   2e-78    
ref|WP_023736796.1|  MULTISPECIES: porphobilinogen deaminase            258   2e-78    
ref|WP_023710202.1|  MULTISPECIES: porphobilinogen deaminase            258   3e-78    
gb|ESY49618.1|  porphobilinogen deaminase                               258   3e-78    
ref|WP_011567549.1|  porphobilinogen deaminase                          258   3e-78    
dbj|BAQ67455.1|  porphobilinogen deaminase                              258   3e-78    
ref|WP_024847189.1|  porphobilinogen deaminase                          258   3e-78    
ref|WP_042459077.1|  porphobilinogen deaminase                          258   4e-78    
ref|WP_037316456.1|  porphobilinogen deaminase                          258   4e-78    
ref|WP_023834671.1|  porphobilinogen deaminase                          258   4e-78    
ref|WP_026783779.1|  porphobilinogen deaminase                          258   4e-78    
gb|AFL54109.1|  porphobilinogen deaminase HemC                          258   5e-78    
ref|WP_007205595.1|  porphobilinogen deaminase                          257   7e-78    
ref|WP_013892312.1|  porphobilinogen deaminase                          257   7e-78    
ref|WP_037208367.1|  porphobilinogen deaminase                          257   7e-78    
ref|WP_027059449.1|  porphobilinogen deaminase                          257   7e-78    
ref|WP_037117448.1|  porphobilinogen deaminase                          257   7e-78    
ref|WP_035252540.1|  porphobilinogen deaminase                          257   8e-78    
ref|WP_008230781.1|  porphobilinogen deaminase                          257   8e-78    
ref|WP_037389845.1|  porphobilinogen deaminase                          257   8e-78    
gb|ETD86828.1|  porphobilinogen deaminase                               257   9e-78    
ref|WP_007008388.1|  porphobilinogen deaminase                          257   9e-78    
ref|WP_025057635.1|  porphobilinogen deaminase                          257   9e-78    
ref|WP_013383712.1|  porphobilinogen deaminase                          257   1e-77    
gb|EPX77903.1|  Porphobilinogen deaminase                               257   1e-77    
ref|WP_037128273.1|  porphobilinogen deaminase                          257   1e-77    
ref|WP_011427097.1|  porphobilinogen deaminase                          257   1e-77    
ref|WP_040819532.1|  porphobilinogen deaminase                          257   1e-77    
ref|WP_027031858.1|  porphobilinogen deaminase                          256   1e-77    
ref|WP_029349283.1|  porphobilinogen deaminase                          256   1e-77    
ref|WP_023726067.1|  porphobilinogen deaminase                          256   1e-77    
ref|WP_032932216.1|  porphobilinogen deaminase                          256   2e-77    
ref|WP_038650482.1|  porphobilinogen deaminase                          256   2e-77    
sp|A1B853.1|HEM3_PARDP  RecName: Full=Porphobilinogen deaminase; ...    256   2e-77    
ref|WP_025043361.1|  porphobilinogen deaminase                          256   2e-77    
ref|WP_027263717.1|  porphobilinogen deaminase                          256   2e-77    
ref|WP_008331131.1|  porphobilinogen deaminase                          256   2e-77    
ref|WP_044051017.1|  porphobilinogen deaminase                          256   2e-77    
ref|WP_023705005.1|  MULTISPECIES: porphobilinogen deaminase            256   2e-77    
ref|WP_041530594.1|  porphobilinogen deaminase                          256   2e-77    
gb|AID33248.1|  porphobilinogen deaminase                               256   3e-77    
ref|WP_029959243.1|  porphobilinogen deaminase                          256   3e-77    
ref|WP_029641302.1|  porphobilinogen deaminase                          255   3e-77    
ref|WP_037162577.1|  porphobilinogen deaminase                          256   3e-77    
ref|WP_041605147.1|  porphobilinogen deaminase                          256   3e-77    
ref|WP_018097313.1|  porphobilinogen deaminase                          255   3e-77    
gb|AFK51924.1|  Porphobilinogen deaminase                               256   3e-77    
gb|AAM48667.1|  porphobilinogen deaminase                               256   3e-77    
ref|WP_045441635.1|  porphobilinogen deaminase                          255   4e-77    
ref|WP_028481275.1|  porphobilinogen deaminase                          255   4e-77    
ref|WP_027053179.1|  porphobilinogen deaminase                          255   4e-77    
ref|WP_039622646.1|  porphobilinogen deaminase                          255   4e-77    
ref|WP_023683914.1|  MULTISPECIES: porphobilinogen deaminase            255   4e-77    
ref|WP_023694474.1|  MULTISPECIES: porphobilinogen deaminase            255   5e-77    
ref|WP_023730223.1|  MULTISPECIES: porphobilinogen deaminase            255   5e-77    
ref|WP_015315067.1|  porphobilinogen deaminase                          255   5e-77    
ref|WP_043758008.1|  porphobilinogen deaminase                          255   5e-77    
ref|WP_023818294.1|  porphobilinogen deaminase                          255   5e-77    
ref|WP_023702385.1|  porphobilinogen deaminase                          254   6e-77    
ref|WP_020091968.1|  porphobilinogen deaminase                          254   6e-77    
dbj|BAQ45696.1|  porphobilinogen deaminase                              255   6e-77    
ref|WP_043379950.1|  porphobilinogen deaminase                          254   6e-77    
ref|WP_041011032.1|  porphobilinogen deaminase                          254   7e-77    
ref|WP_035260028.1|  porphobilinogen deaminase                          254   7e-77    
ref|WP_028747477.1|  porphobilinogen deaminase                          254   7e-77    
ref|WP_027047533.1|  porphobilinogen deaminase                          254   8e-77    
ref|WP_032926856.1|  porphobilinogen deaminase                          254   9e-77    
ref|WP_042669520.1|  porphobilinogen deaminase                          254   9e-77    
ref|WP_023800555.1|  porphobilinogen deaminase                          254   9e-77    
ref|WP_023778853.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_040820549.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_007872131.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_015341425.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_010912273.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_036740171.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_031257752.1|  porphobilinogen deaminase                          254   1e-76    
gb|EET47076.1|  porphobilinogen deaminase                               254   1e-76    
ref|WP_029372045.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_022717397.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_027154807.1|  porphobilinogen deaminase                          254   1e-76    
ref|WP_011582515.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_017928894.1|  hypothetical protein                               254   2e-76    
ref|WP_038691776.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_022709669.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_041002922.1|  porphobilinogen deaminase                          253   2e-76    
dbj|BAQ15843.1|  porphobilinogen deaminase                              253   2e-76    
ref|WP_023747363.1|  MULTISPECIES: porphobilinogen deaminase            253   2e-76    
ref|WP_027992435.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_036697480.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_018235886.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_028033627.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_028287486.1|  porphobilinogen deaminase                          253   2e-76    
ref|WP_006201144.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_043350729.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_036281275.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_028466749.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_007563605.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_009561838.1|  Porphobilinogen deaminase                          253   3e-76    
ref|WP_042088316.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_037417795.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_007690201.1|  porphobilinogen deaminase                          253   3e-76    
ref|WP_040677491.1|  porphobilinogen deaminase                          253   4e-76    
ref|WP_034521682.1|  porphobilinogen deaminase                          253   4e-76    
ref|WP_043763987.1|  porphobilinogen deaminase                          253   5e-76    
ref|WP_045581095.1|  porphobilinogen deaminase                          253   5e-76    
ref|WP_041722817.1|  porphobilinogen deaminase                          252   5e-76    
ref|WP_037218952.1|  porphobilinogen deaminase                          252   5e-76    
ref|WP_029009478.1|  porphobilinogen deaminase                          252   5e-76    
gb|ACM28080.1|  porphobilinogen deaminase                               253   5e-76    
ref|WP_025658178.1|  porphobilinogen deaminase                          252   5e-76    
gb|EDQ35185.2|  porphobilinogen deaminase                               252   5e-76    
ref|WP_018855764.1|  porphobilinogen deaminase                          252   5e-76    
ref|WP_034508983.1|  porphobilinogen deaminase                          252   6e-76    
gb|EKF18928.1|  porphobilinogen deaminase                               252   6e-76    
ref|WP_017139943.1|  hydroxymethylbilane synthase                       253   6e-76    
ref|WP_020010863.1|  MULTISPECIES: porphobilinogen deaminase            252   6e-76    
ref|WP_007199416.1|  porphobilinogen deaminase                          252   7e-76    
ref|WP_040676645.1|  porphobilinogen deaminase                          252   7e-76    
ref|WP_015921151.1|  porphobilinogen deaminase                          252   7e-76    
ref|WP_040991464.1|  porphobilinogen deaminase                          252   7e-76    
ref|WP_016556598.1|  porphobilinogen deaminase                          252   7e-76    
gb|ACE81820.1|  hydroxymethylbilane synthetase                          254   8e-76    
ref|WP_002720861.1|  porphobilinogen deaminase                          252   9e-76    
ref|WP_027025625.1|  porphobilinogen deaminase                          252   9e-76    
ref|WP_005862932.1|  porphobilinogen deaminase                          252   9e-76    
ref|WP_003504999.1|  porphobilinogen deaminase                          252   9e-76    
ref|WP_007118464.1|  porphobilinogen deaminase                          252   1e-75    
ref|WP_010970392.1|  porphobilinogen deaminase                          251   1e-75    
ref|WP_018700087.1|  hypothetical protein                               251   1e-75    
ref|WP_034852992.1|  porphobilinogen deaminase                          251   1e-75    
ref|WP_018328620.1|  porphobilinogen deaminase                          251   1e-75    
ref|WP_005979171.1|  porphobilinogen deaminase                          252   1e-75    
ref|WP_006467949.1|  porphobilinogen deaminase                          251   1e-75    
ref|WP_028010503.1|  porphobilinogen deaminase                          251   1e-75    
ref|WP_042695698.1|  porphobilinogen deaminase                          251   2e-75    
ref|WP_003531176.1|  porphobilinogen deaminase                          251   2e-75    
ref|WP_040878718.1|  porphobilinogen deaminase                          251   2e-75    
ref|WP_039522835.1|  porphobilinogen deaminase                          251   2e-75    
ref|WP_008184716.1|  porphobilinogen deaminase                          251   2e-75    
ref|WP_010972466.1|  MULTISPECIES: porphobilinogen deaminase            251   2e-75    
ref|WP_012319792.1|  porphobilinogen deaminase                          251   2e-75    
gb|AGI66330.1|  porphobilinogen deaminase HemC                          251   2e-75    
ref|WP_037116333.1|  porphobilinogen deaminase                          251   3e-75    
ref|WP_011841600.1|  porphobilinogen deaminase                          251   3e-75    



>ref|XP_009767215.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
sylvestris]
Length=370

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/375 (84%), Positives = 331/375 (88%), Gaps = 6/375 (2%)
 Frame = +3

Query  3     MEKMAITLNPVVAF-PANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQA  179
             MEK+A++ +   +  P N+  S  V  SLPC   S  PNQ  R    LV  ASIAVEQ+ 
Sbjct  1     MEKIAVSTHLCPSLKPFNSNLSSDVVFSLPC-LTSVFPNQRRRI---LVTSASIAVEQET  56

Query  180   QKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLA  359
             Q TK+A+IRIGTRGSPLALAQAYETR+KL+AS P LAEEGAIEI+IIKTTGDKILSQPLA
Sbjct  57    Q-TKLALIRIGTRGSPLALAQAYETREKLIASDPGLAEEGAIEIVIIKTTGDKILSQPLA  115

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             DIGGKGLFTKEIDEALIN EIDIAVHSMKDVPTYLPDKTILPCNLPREDVRD FISL+A 
Sbjct  116   DIGGKGLFTKEIDEALINGEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDVFISLTAG  175

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             SLA LP+GSTVGTASLRRKSQILHRYPSL VLENFRGNVQTRLRKLNEGVVQATLLALAG
Sbjct  176   SLAQLPSGSTVGTASLRRKSQILHRYPSLNVLENFRGNVQTRLRKLNEGVVQATLLALAG  235

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDE MANYIA LNHEETRLAV CERA
Sbjct  236   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDETMANYIALLNHEETRLAVACERA  295

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             FL TLDGSCRTPIAGYA RGEDGDCIFKGLVASPDGTRV+ETSRKGPYT  DM LMGEDA
Sbjct  296   FLKTLDGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVLETSRKGPYTFEDMTLMGEDA  355

Query  1080  GKELLLQAGPGFFGN  1124
             GKELL +AGPGFFGN
Sbjct  356   GKELLSRAGPGFFGN  370



>ref|XP_009610066.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=370

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/375 (84%), Positives = 330/375 (88%), Gaps = 6/375 (2%)
 Frame = +3

Query  3     MEKMAITLNPVVAF-PANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQA  179
             MEK+AI+ +   +  P N+  S  V  S PC   S  PNQ     K LV RASI VEQ+ 
Sbjct  1     MEKIAISTHLCPSLKPFNSHLSSDVGFSFPC-LTSVFPNQ---RRKILVARASIVVEQET  56

Query  180   QKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLA  359
             Q TK+A+IRIGTRGSPLALAQAYETR+KL+AS P LAEEGAIEI+IIKTTGDKILSQPLA
Sbjct  57    Q-TKLALIRIGTRGSPLALAQAYETREKLIASDPGLAEEGAIEIVIIKTTGDKILSQPLA  115

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             DIGGKGLFTKEIDEALIN EIDIAVHSMKDVPTYLPDK ILPCNLPREDVRD FISL+A 
Sbjct  116   DIGGKGLFTKEIDEALINGEIDIAVHSMKDVPTYLPDKIILPCNLPREDVRDVFISLTAG  175

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             SLA LP+GSTVGTASLRRKSQILHRYPSL VLENFRGNVQTRLRKLNEGVVQATLLALAG
Sbjct  176   SLAQLPSGSTVGTASLRRKSQILHRYPSLNVLENFRGNVQTRLRKLNEGVVQATLLALAG  235

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDE MANYIA LNHEETRLAV CERA
Sbjct  236   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDETMANYIALLNHEETRLAVACERA  295

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             FL TLDGSCRTPIAGYA RGEDGDCIFKGLVASPDGTRV+ETSRKGPYT+ DM LMGEDA
Sbjct  296   FLKTLDGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVLETSRKGPYTVEDMTLMGEDA  355

Query  1080  GKELLLQAGPGFFGN  1124
             GKELL +AGPGFFGN
Sbjct  356   GKELLSRAGPGFFGN  370



>ref|XP_009792144.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
sylvestris]
Length=365

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/376 (83%), Positives = 333/376 (89%), Gaps = 13/376 (3%)
 Frame = +3

Query  3     MEKMAITLNPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKS--LVVRASIAVEQQ  176
             MEK A TLN      A+   S S+   LP GF S      + + +S   V RASIAVEQQ
Sbjct  1     MEKFA-TLN------ASNLSSASL---LPIGFSSPCVKSAVLAQRSRVHVTRASIAVEQQ  50

Query  177   AQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPL  356
             AQ TKVA+IR+GTRGSPLALAQAYETR+KL+AS+P+LAEEGAI+I+IIKTTGDKILSQPL
Sbjct  51    AQ-TKVAVIRVGTRGSPLALAQAYETREKLIASYPDLAEEGAIQIVIIKTTGDKILSQPL  109

Query  357   ADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsa  536
             ADIGGKGLFTKEIDEALIN EIDIAVHSMKDVPTYLP+KTILPCNLPREDVRD FISL+A
Sbjct  110   ADIGGKGLFTKEIDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDVFISLTA  169

Query  537   asladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALA  716
              SLA LP+GST+GTASLRRKSQILHRYPSL VLENFRGNVQTRLRKLNEGVVQATLLALA
Sbjct  170   GSLAQLPSGSTIGTASLRRKSQILHRYPSLNVLENFRGNVQTRLRKLNEGVVQATLLALA  229

Query  717   GLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCER  896
             GLKR++MTENVTSILPIEDMLPAVAQGAIGIACR+DDE MANYIASLNHEETRLAV CER
Sbjct  230   GLKRMNMTENVTSILPIEDMLPAVAQGAIGIACRTDDETMANYIASLNHEETRLAVACER  289

Query  897   AFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             AFL TLDGSCRTPIAGYA RGEDGDCIFKGLVASPDGTRVIETSRKGPYT  DM+ MGED
Sbjct  290   AFLKTLDGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTFEDMIRMGED  349

Query  1077  AGKELLLQAGPGFFGN  1124
             AGKELL +AGPGFFGN
Sbjct  350   AGKELLAEAGPGFFGN  365



>ref|XP_009602647.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=365

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/376 (82%), Positives = 332/376 (88%), Gaps = 13/376 (3%)
 Frame = +3

Query  3     MEKMAITLNPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKS--LVVRASIAVEQQ  176
             MEK A TLN      A+   S S+   LP GF S      + + +S   V RASIAVEQQ
Sbjct  1     MEKFA-TLN------ASNLRSASL---LPIGFSSPCLKSAVLTQRSRVHVTRASIAVEQQ  50

Query  177   AQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPL  356
              Q TKVA+IR+GTRGSPLALAQAYETR+KL+AS+P+LAEEGAI+I+IIKTTGDKILSQPL
Sbjct  51    TQ-TKVAVIRVGTRGSPLALAQAYETREKLIASYPDLAEEGAIQIVIIKTTGDKILSQPL  109

Query  357   ADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsa  536
             ADIGGKGLFTKEIDEALIN EIDIAVHSMKDVPTYLP+KTILPCNLPREDVRD FISL+A
Sbjct  110   ADIGGKGLFTKEIDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDVFISLTA  169

Query  537   asladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALA  716
              SLA LP+GST+GTASLRRKSQILHRYPSL VLENFRGNVQTRLRKLNEGVVQATLLALA
Sbjct  170   GSLAQLPSGSTIGTASLRRKSQILHRYPSLNVLENFRGNVQTRLRKLNEGVVQATLLALA  229

Query  717   GLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCER  896
             GLKR++MTENVTSILPIEDMLPAVAQGAIGIACR+DDE MANYIASLNHEETRLAV CER
Sbjct  230   GLKRMNMTENVTSILPIEDMLPAVAQGAIGIACRTDDETMANYIASLNHEETRLAVACER  289

Query  897   AFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             AFL TLDGSCRTPIAGYA RGEDGDCIFKGLVASPDGTRVIETSRKGPYT  +M+ MGED
Sbjct  290   AFLKTLDGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTFEEMIRMGED  349

Query  1077  AGKELLLQAGPGFFGN  1124
             AGKELL +AGPGFFGN
Sbjct  350   AGKELLAEAGPGFFGN  365



>ref|XP_004243981.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Solanum 
lycopersicum]
Length=365

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/363 (83%), Positives = 327/363 (90%), Gaps = 3/363 (1%)
 Frame = +3

Query  42    FPANTKPSVSVFRSLPCGFKSSTPNQ--PIRSTKSLVVRASIAVEQQAQKTKVAIIRIGT  215
             F A    ++S    LP GF S        ++  +  V RAS+A+EQQAQ TKVA+IR+GT
Sbjct  4     FVALNASNLSSGSLLPIGFSSPCRKSALSLQRRRVHVTRASVALEQQAQ-TKVAVIRVGT  62

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             RGSPLALAQAYETR+KL+AS P+LAEEGAIEI+IIKTTGDKILSQPLADIGGKGLFTKEI
Sbjct  63    RGSPLALAQAYETREKLIASFPDLAEEGAIEIVIIKTTGDKILSQPLADIGGKGLFTKEI  122

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             DEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPREDVRDAFISL+A SLA+LP+GST+G
Sbjct  123   DEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLTAGSLAELPSGSTIG  182

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             TASLRRKSQILHRYPSL VLENFRGNVQTRL+KLNEGVVQATLLALAGLKRL+MTENV+S
Sbjct  183   TASLRRKSQILHRYPSLNVLENFRGNVQTRLKKLNEGVVQATLLALAGLKRLNMTENVSS  242

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             IL IEDMLPAVAQGAIGIACRSDDE MANYIA+LNHEETRLA+VCERAFLTTLDGSCRTP
Sbjct  243   ILSIEDMLPAVAQGAIGIACRSDDETMANYIAALNHEETRLAIVCERAFLTTLDGSCRTP  302

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IAGYA RGEDGDCIFKGLVASPDGTRVIETSRKGPYT  DM+ MGEDAG+ELL +AGPGF
Sbjct  303   IAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTSEDMIRMGEDAGQELLSKAGPGF  362

Query  1116  FGN  1124
             FGN
Sbjct  363   FGN  365



>ref|XP_006346038.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Solanum 
tuberosum]
Length=365

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/349 (85%), Positives = 322/349 (92%), Gaps = 3/349 (1%)
 Frame = +3

Query  84    LPCGFKSSTPN--QPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETR  257
             LP GF S        ++  +  V RAS+AVEQQAQ TKVA+IR+GTRGSPLALAQAYETR
Sbjct  18    LPIGFSSPCRKFAVSVQRRRVHVTRASVAVEQQAQ-TKVAVIRVGTRGSPLALAQAYETR  76

Query  258   DKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVH  437
              KL+AS+P+LAE+GAIEI+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVH
Sbjct  77    AKLIASYPDLAEDGAIEIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVH  136

Query  438   SMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRY  617
             SMKDVPTYLP+KTILPCNLPREDVRDAFISL+A SLA+LP+GST+GTASLRRKSQILHRY
Sbjct  137   SMKDVPTYLPEKTILPCNLPREDVRDAFISLTAGSLAELPSGSTIGTASLRRKSQILHRY  196

Query  618   PSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQG  797
             PSL VLENFRGNVQTRL+KLNEGVVQATLLALAGLKRL+MTENV+SIL IEDMLPAVAQG
Sbjct  197   PSLNVLENFRGNVQTRLKKLNEGVVQATLLALAGLKRLNMTENVSSILSIEDMLPAVAQG  256

Query  798   AIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCI  977
             AIGIACRSDDE MANYIA+LNHEETRLA+VCERAFLTTLDGSCRTPIAGYA RGEDGDCI
Sbjct  257   AIGIACRSDDETMANYIAALNHEETRLAIVCERAFLTTLDGSCRTPIAGYACRGEDGDCI  316

Query  978   FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             FKGLVASPDGTRVIETSRKGPYT  DM+ MGEDAG+ELL +AGPGFFGN
Sbjct  317   FKGLVASPDGTRVIETSRKGPYTSEDMIRMGEDAGQELLSKAGPGFFGN  365



>ref|XP_002520359.1| porphobilinogen deaminase, putative [Ricinus communis]
 gb|EEF42025.1| porphobilinogen deaminase, putative [Ricinus communis]
Length=372

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/352 (84%), Positives = 322/352 (91%), Gaps = 3/352 (1%)
 Frame = +3

Query  63    SVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQ  242
             SVSV  S    FKS  PN  I+     + RAS+AVEQQ Q  KVA+IRIGTRGSPLALAQ
Sbjct  22    SVSVLGSSLPQFKS--PN-CIKKQSLRITRASVAVEQQTQDPKVALIRIGTRGSPLALAQ  78

Query  243   AYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEI  422
             A+ETRDKLMA H ELAEEGAI+I+IIKTTGDKIL+QPLADIGGKGLFTKEIDEALIN EI
Sbjct  79    AHETRDKLMAKHSELAEEGAIQIVIIKTTGDKILTQPLADIGGKGLFTKEIDEALINGEI  138

Query  423   DIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQ  602
             DIAVHSMKDVPTYLP+KTILPCNLPREDVRDAFISLSA+SLA+LP+GS +GTASLRRKSQ
Sbjct  139   DIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLSASSLAELPSGSVIGTASLRRKSQ  198

Query  603   ILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLP  782
             ILHRYPSL VLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL+MTENVTS+L I+DMLP
Sbjct  199   ILHRYPSLSVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMTENVTSVLSIDDMLP  258

Query  783   AVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGE  962
             AVAQGAIGIACRS+D+KMANY+ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E
Sbjct  259   AVAQGAIGIACRSNDDKMANYLASLNHEETRLAVACERAFLETLDGSCRTPIAGYASKDE  318

Query  963   DGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             +GDCIFKGLVASPDGTRV+ETSRKGPY L+DM++MG+DAGKELLLQAGPGFF
Sbjct  319   NGDCIFKGLVASPDGTRVLETSRKGPYALDDMIMMGKDAGKELLLQAGPGFF  370



>emb|CDP13602.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/376 (79%), Positives = 326/376 (87%), Gaps = 12/376 (3%)
 Frame = +3

Query  21    TLNPVVAFPANTKPSVSVFR----------SLPCGFKSSTPNQPIRSTKSLVVRASIAVE  170
             TLN      +N +P  S F           +LP   K+S P  P +  K+LV  +SIAVE
Sbjct  8     TLNQHPFLTSNPRPFASNFAYASSVSALGFTLPSSHKTSAP--PNQRRKTLVTSSSIAVE  65

Query  171   QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
                 +TK A+IRIGTRGSPLALAQA+ETRDKL+ASHPELAEEGAI+I+IIKTTGDKILSQ
Sbjct  66    HHHTQTKTAVIRIGTRGSPLALAQAHETRDKLIASHPELAEEGAIQIVIIKTTGDKILSQ  125

Query  351   PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
             PLADIGGKGLFTKEIDEALINA+IDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISL
Sbjct  126   PLADIGGKGLFTKEIDEALINADIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISL  185

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
             +A SLADLPAG+ VGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLN+GVVQATLLA
Sbjct  186   TATSLADLPAGAVVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNDGVVQATLLA  245

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             LAGLKRL+MTENVTSIL I+DMLPAVAQGAIGIACRSDDEKMA +IASLNH+ETRLAV C
Sbjct  246   LAGLKRLNMTENVTSILSIDDMLPAVAQGAIGIACRSDDEKMAGFIASLNHDETRLAVAC  305

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             ERAFL TLDGSCRTPIAGYA R EDG+C+F+GLVASPDGTRV+ETSRKG YT  +MV MG
Sbjct  306   ERAFLETLDGSCRTPIAGYASRDEDGNCVFRGLVASPDGTRVLETSRKGSYTFEEMVAMG  365

Query  1071  EDAGKELLLQAGPGFF  1118
             +DAGKELL +AGPGFF
Sbjct  366   KDAGKELLSKAGPGFF  381



>ref|XP_011006773.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Populus 
euphratica]
Length=376

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/324 (88%), Positives = 309/324 (95%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             V+AS+AVEQQ Q+ KVA+IRIGTRGSPLALAQA+ETRDKLMASH +LAEEGAI+I++IKT
Sbjct  51    VKASVAVEQQTQEAKVALIRIGTRGSPLALAQAHETRDKLMASHSDLAEEGAIQIVVIKT  110

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRED
Sbjct  111   TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRED  170

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V ENFRGNVQTRLRKLNEG
Sbjct  171   VRDAFISLSAASLADLPAGSIIGTASLRRKSQILHRYPSLSVEENFRGNVQTRLRKLNEG  230

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VV+ATLLALAGLKRL+MTENVTSILPI+DMLPAVAQGAIGIACRS+D+KMANY+ASLNHE
Sbjct  231   VVKATLLALAGLKRLNMTENVTSILPIDDMLPAVAQGAIGIACRSNDDKMANYLASLNHE  290

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYAR+ E+GDCIFKGLVASPDGTRV+ETSRKG Y 
Sbjct  291   ETRLAVACERAFLETLDGSCRTPIAGYARKDENGDCIFKGLVASPDGTRVLETSRKGLYA  350

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
              +DM+ MG+DAGKELL QAGPGFF
Sbjct  351   FDDMIAMGKDAGKELLSQAGPGFF  374



>ref|XP_002310073.2| hypothetical protein POPTR_0007s07680g [Populus trichocarpa]
 gb|EEE90523.2| hypothetical protein POPTR_0007s07680g [Populus trichocarpa]
Length=376

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/324 (87%), Positives = 307/324 (95%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             V+AS+AVEQQ Q+ KVA+IRIGTRGSPLALAQA+ETRDKLMASH +LAEEGAI+I+IIKT
Sbjct  51    VKASVAVEQQTQEAKVALIRIGTRGSPLALAQAHETRDKLMASHSDLAEEGAIQIVIIKT  110

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKI SQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRED
Sbjct  111   TGDKIQSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRED  170

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V ENFRGNVQTRLRKLNEG
Sbjct  171   VRDAFISLSAASLADLPAGSIIGTASLRRKSQILHRYPSLSVEENFRGNVQTRLRKLNEG  230

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VV+ATLLALAGLKRL+MTENVTSILP++DMLPAVAQGAIGIACRS+D+KM NY+ASLNHE
Sbjct  231   VVKATLLALAGLKRLNMTENVTSILPLDDMLPAVAQGAIGIACRSNDDKMVNYLASLNHE  290

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYAR+ E+GDCIFKGLVASPDG RV+ETSRKGPY 
Sbjct  291   ETRLAVACERAFLETLDGSCRTPIAGYARKDENGDCIFKGLVASPDGRRVLETSRKGPYA  350

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
              +DM+ MG+DAGKELL QAGPGFF
Sbjct  351   FDDMIAMGKDAGKELLSQAGPGFF  374



>ref|XP_007225744.1| hypothetical protein PRUPE_ppa007124mg [Prunus persica]
 gb|EMJ26943.1| hypothetical protein PRUPE_ppa007124mg [Prunus persica]
Length=381

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/362 (81%), Positives = 321/362 (89%), Gaps = 11/362 (3%)
 Frame = +3

Query  36    VAFPANTKPSVSVFRSLP-CGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIG  212
             V+ P  + PS+   R+ P C  K S    P         RAS+AVEQQ QK K+A+IRIG
Sbjct  28    VSVPGFSLPSLKT-RAFPHCIRKHSAVGIP---------RASVAVEQQTQKAKLALIRIG  77

Query  213   TRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKE  392
             TRGSPLALAQA+ETRDKLMASHP+LAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKE
Sbjct  78    TRGSPLALAQAHETRDKLMASHPDLAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKE  137

Query  393   IDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTV  572
             IDEALIN EIDIAVHSMKDVPTYLP+KTILPCNLPREDVRDAFISL+A+SLADLPAGST+
Sbjct  138   IDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLTASSLADLPAGSTI  197

Query  573   GTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVT  752
             GTASLRRKSQIL+RYPSL VLENFRGNVQTRLRKLNE VVQATLLALAGLKRLDMTENVT
Sbjct  198   GTASLRRKSQILNRYPSLNVLENFRGNVQTRLRKLNEKVVQATLLALAGLKRLDMTENVT  257

Query  753   SILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRT  932
             SIL +++MLPAVAQGAIGIACRS+D+KMANYIASLNHEETRLAV CERAFL TLDGSCRT
Sbjct  258   SILSLDEMLPAVAQGAIGIACRSNDDKMANYIASLNHEETRLAVACERAFLLTLDGSCRT  317

Query  933   PIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPG  1112
             PIAGYA R EDG+CIFKGLVASPDGTRV+ETSRKG Y   DM+ MG++AG+ELL QAGPG
Sbjct  318   PIAGYASRDEDGNCIFKGLVASPDGTRVLETSRKGTYAFQDMINMGKEAGQELLSQAGPG  377

Query  1113  FF  1118
             FF
Sbjct  378   FF  379



>emb|CBI18797.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/326 (86%), Positives = 308/326 (94%), Gaps = 0/326 (0%)
 Frame = +3

Query  141   LVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiii  320
             +V+RASIAVEQ+  KTKVA++RIGTRGSPLALAQAYETRDKLMA+H ELAEEGAI+I++I
Sbjct  1     MVIRASIAVEQETHKTKVALVRIGTRGSPLALAQAYETRDKLMAAHSELAEEGAIQIVVI  60

Query  321   kttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPR  500
             KTTGDKIL+QPLADIGGKGLFTKEIDEAL+N +IDIAVHSMKDVPTYLPDKTILPCNLPR
Sbjct  61    KTTGDKILTQPLADIGGKGLFTKEIDEALLNGDIDIAVHSMKDVPTYLPDKTILPCNLPR  120

Query  501   EDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLN  680
             EDVRDAFISL+AASL++LPAGS VGTASLRRKSQ+LHRY SL VLENFRGNVQTRLRKLN
Sbjct  121   EDVRDAFISLTAASLSELPAGSIVGTASLRRKSQLLHRYKSLNVLENFRGNVQTRLRKLN  180

Query  681   EGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLN  860
             EGVVQATLLALAGLKRL+MTENVTSIL I++MLPAVAQGAIGIACRS+D+KMANY+ASLN
Sbjct  181   EGVVQATLLALAGLKRLNMTENVTSILSIDEMLPAVAQGAIGIACRSNDDKMANYLASLN  240

Query  861   HEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGP  1040
             HE TRLAV CERAFL TLDGSCRTPIAGYA   EDG+CIFKGLVASPDGT+V+ETSRKGP
Sbjct  241   HEVTRLAVACERAFLETLDGSCRTPIAGYASHDEDGNCIFKGLVASPDGTKVLETSRKGP  300

Query  1041  YTLNDMVLMGEDAGKELLLQAGPGFF  1118
             Y L DM+ MG+DAG+ELL +AGPGFF
Sbjct  301   YALEDMIKMGKDAGEELLSRAGPGFF  326



>ref|XP_012072847.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Jatropha 
curcas]
Length=384

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/364 (80%), Positives = 325/364 (89%), Gaps = 3/364 (1%)
 Frame = +3

Query  27    NPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIR  206
             +PV+ F A+   SV  F SLPC F++      I+     V RAS+AVEQQ Q++K+A+IR
Sbjct  22    SPVI-FRASGSVSVIGF-SLPC-FQTRVFPNCIKKRSFSVPRASVAVEQQTQESKLALIR  78

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLALAQAYETRDKLMA+H ELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFT
Sbjct  79    IGTRGSPLALAQAYETRDKLMATHSELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFT  138

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEIDEALIN EIDIAVHSMKDVPTYLP+KTILPCNL REDVRDAFISLSA+SLA+LPAGS
Sbjct  139   KEIDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLEREDVRDAFISLSASSLAELPAGS  198

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              +GTASLRRKSQILHRY SL VLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL+MTEN
Sbjct  199   VIGTASLRRKSQILHRYASLSVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMTEN  258

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
             VTSIL I+DMLPAVAQGAIGIACRS+D+KMANY+ASLNHE+TRLAV CERAFL TLDGSC
Sbjct  259   VTSILSIDDMLPAVAQGAIGIACRSNDDKMANYLASLNHEDTRLAVACERAFLETLDGSC  318

Query  927   RTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAG  1106
             RTPIAGYA + E GDC+FKGLVASPDG+RV+ETSRKG Y L DM++MG+DAG ELL +AG
Sbjct  319   RTPIAGYACKDEGGDCVFKGLVASPDGSRVLETSRKGAYALADMIMMGKDAGMELLSRAG  378

Query  1107  PGFF  1118
             PGFF
Sbjct  379   PGFF  382



>gb|KDP37560.1| hypothetical protein JCGZ_05999 [Jatropha curcas]
Length=382

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/364 (80%), Positives = 325/364 (89%), Gaps = 3/364 (1%)
 Frame = +3

Query  27    NPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIR  206
             +PV+ F A+   SV  F SLPC F++      I+     V RAS+AVEQQ Q++K+A+IR
Sbjct  20    SPVI-FRASGSVSVIGF-SLPC-FQTRVFPNCIKKRSFSVPRASVAVEQQTQESKLALIR  76

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLALAQAYETRDKLMA+H ELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFT
Sbjct  77    IGTRGSPLALAQAYETRDKLMATHSELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFT  136

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEIDEALIN EIDIAVHSMKDVPTYLP+KTILPCNL REDVRDAFISLSA+SLA+LPAGS
Sbjct  137   KEIDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLEREDVRDAFISLSASSLAELPAGS  196

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              +GTASLRRKSQILHRY SL VLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL+MTEN
Sbjct  197   VIGTASLRRKSQILHRYASLSVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMTEN  256

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
             VTSIL I+DMLPAVAQGAIGIACRS+D+KMANY+ASLNHE+TRLAV CERAFL TLDGSC
Sbjct  257   VTSILSIDDMLPAVAQGAIGIACRSNDDKMANYLASLNHEDTRLAVACERAFLETLDGSC  316

Query  927   RTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAG  1106
             RTPIAGYA + E GDC+FKGLVASPDG+RV+ETSRKG Y L DM++MG+DAG ELL +AG
Sbjct  317   RTPIAGYACKDEGGDCVFKGLVASPDGSRVLETSRKGAYALADMIMMGKDAGMELLSRAG  376

Query  1107  PGFF  1118
             PGFF
Sbjct  377   PGFF  380



>ref|XP_010647324.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Vitis vinifera]
Length=369

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/328 (85%), Positives = 309/328 (94%), Gaps = 0/328 (0%)
 Frame = +3

Query  135   KSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieii  314
             K +V+RASIAVEQ+  KTKVA++RIGTRGSPLALAQAYETRDKLMA+H ELAEEGAI+I+
Sbjct  40    KKMVIRASIAVEQETHKTKVALVRIGTRGSPLALAQAYETRDKLMAAHSELAEEGAIQIV  99

Query  315   iikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNL  494
             +IKTTGDKIL+QPLADIGGKGLFTKEIDEAL+N +IDIAVHSMKDVPTYLPDKTILPCNL
Sbjct  100   VIKTTGDKILTQPLADIGGKGLFTKEIDEALLNGDIDIAVHSMKDVPTYLPDKTILPCNL  159

Query  495   PREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRK  674
             PREDVRDAFISL+AASL++LPAGS VGTASLRRKSQ+LHRY SL VLENFRGNVQTRLRK
Sbjct  160   PREDVRDAFISLTAASLSELPAGSIVGTASLRRKSQLLHRYKSLNVLENFRGNVQTRLRK  219

Query  675   LNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIAS  854
             LNEGVVQATLLALAGLKRL+MTENVTSIL I++MLPAVAQGAIGIACRS+D+KMANY+AS
Sbjct  220   LNEGVVQATLLALAGLKRLNMTENVTSILSIDEMLPAVAQGAIGIACRSNDDKMANYLAS  279

Query  855   LNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRK  1034
             LNHE TRLAV CERAFL TLDGSCRTPIAGYA   EDG+CIFKGLVASPDGT+V+ETSRK
Sbjct  280   LNHEVTRLAVACERAFLETLDGSCRTPIAGYASHDEDGNCIFKGLVASPDGTKVLETSRK  339

Query  1035  GPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             GPY L DM+ MG+DAG+ELL +AGPGFF
Sbjct  340   GPYALEDMIKMGKDAGEELLSRAGPGFF  367



>ref|XP_011022037.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Populus 
euphratica]
Length=426

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/324 (87%), Positives = 307/324 (95%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             V+AS+AVEQQAQ+ K+A+IRIGTRGSPLALAQA+ETRDKLMASH ELAE+GAI+I+IIKT
Sbjct  101   VKASVAVEQQAQEAKLALIRIGTRGSPLALAQAHETRDKLMASHAELAEDGAIQIVIIKT  160

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+ TILPCNLPRED
Sbjct  161   TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEMTILPCNLPRED  220

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFIS+SA SLADLPAGS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKLNEG
Sbjct  221   VRDAFISMSATSLADLPAGSIVGTASLRRKSQILHRYPSLSVEENFRGNVQTRLRKLNEG  280

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VV+ATLLALAGLKRL+MTENVTSILPI++MLPAVAQGAIGIACR  D+KMANY+ASLNHE
Sbjct  281   VVKATLLALAGLKRLNMTENVTSILPIDNMLPAVAQGAIGIACRDSDDKMANYLASLNHE  340

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYARR E+GDCIFKGLVASPDGTRV++TSRKGPY 
Sbjct  341   ETRLAVACERAFLETLDGSCRTPIAGYARRDENGDCIFKGLVASPDGTRVLKTSRKGPYA  400

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
              +DM+ MG+DAG+ELL QAGPGFF
Sbjct  401   FDDMIAMGKDAGQELLSQAGPGFF  424



>ref|XP_008221067.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Prunus mume]
Length=376

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/362 (81%), Positives = 319/362 (88%), Gaps = 11/362 (3%)
 Frame = +3

Query  36    VAFPANTKPSVSVFRSLP-CGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIG  212
             V+ P  + PS+   R+ P C  K S    P         RAS+AVEQQ QK K+A+IRIG
Sbjct  23    VSVPGFSLPSLKT-RAFPVCIRKHSAVGIP---------RASVAVEQQTQKAKLALIRIG  72

Query  213   TRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKE  392
             TRGSPLALAQA+ETRDKLMASHP+LAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKE
Sbjct  73    TRGSPLALAQAHETRDKLMASHPDLAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKE  132

Query  393   IDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTV  572
             IDEALIN EIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISL+ +SLADLPAGST+
Sbjct  133   IDEALINGEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISLTVSSLADLPAGSTI  192

Query  573   GTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVT  752
             GTASLRRKSQIL+RYPSL VLENFRGNVQTRLRKLNE VVQATLLALAGLKRLDMTENVT
Sbjct  193   GTASLRRKSQILNRYPSLNVLENFRGNVQTRLRKLNEKVVQATLLALAGLKRLDMTENVT  252

Query  753   SILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRT  932
             SIL +++MLPAVAQGAIGIACRS+D+KMANYIASLNHEETRLAV CERAFL TLDGSCRT
Sbjct  253   SILSLDEMLPAVAQGAIGIACRSNDDKMANYIASLNHEETRLAVACERAFLLTLDGSCRT  312

Query  933   PIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPG  1112
             PIAGYA R  DG+CIFKGLVASPDGTRV+ETSRKG Y   DM+ MG+DAG+ELL +AGPG
Sbjct  313   PIAGYASRDGDGNCIFKGLVASPDGTRVLETSRKGTYAFQDMINMGKDAGQELLSRAGPG  372

Query  1113  FF  1118
             FF
Sbjct  373   FF  374



>ref|XP_008361909.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Malus 
domestica]
Length=390

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/354 (81%), Positives = 322/354 (91%), Gaps = 1/354 (0%)
 Frame = +3

Query  63    SVSVFRS-LPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALA  239
             SVSV RS +P     S PN   + +   + RAS+AVEQQ QK+KVA+IRIGTRGSPLALA
Sbjct  36    SVSVLRSSMPSLKTRSFPNSIRKHSLIGIPRASVAVEQQIQKSKVALIRIGTRGSPLALA  95

Query  240   QAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAE  419
             QAYETR+KLMASHPELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN +
Sbjct  96    QAYETREKLMASHPELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGD  155

Query  420   IDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKS  599
             IDIAVHSMKDVPTYLP++T+LPCNLPREDVRDAFISL+++SLADLPAGSTVGTASLRRKS
Sbjct  156   IDIAVHSMKDVPTYLPEQTVLPCNLPREDVRDAFISLTSSSLADLPAGSTVGTASLRRKS  215

Query  600   QILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDML  779
             QILHR+PSL V ENFRGNVQTRL+KLNE VV+ATLLALAGLKRLDMTENVTSIL +++ML
Sbjct  216   QILHRFPSLNVQENFRGNVQTRLKKLNEKVVEATLLALAGLKRLDMTENVTSILSLDEML  275

Query  780   PAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRG  959
             PAVAQGAIGIACR++D+KMA+YIA LNHEETRLAV CER+FL TLDGSCRTPIAGYA + 
Sbjct  276   PAVAQGAIGIACRTNDDKMAHYIALLNHEETRLAVACERSFLLTLDGSCRTPIAGYASKD  335

Query  960   EDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFG  1121
             EDG+CIFKGLVASPDGTRV+ETSRKGPY   DM+ MG+DAG+ELL +AGPGFFG
Sbjct  336   EDGNCIFKGLVASPDGTRVLETSRKGPYASQDMINMGKDAGQELLSRAGPGFFG  389



>ref|XP_009351734.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Pyrus x 
bretschneideri]
Length=388

 Score =   521 bits (1342),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 285/354 (81%), Positives = 321/354 (91%), Gaps = 1/354 (0%)
 Frame = +3

Query  63    SVSVFRS-LPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALA  239
             SVSV RS +P     + PN   + +   +  AS+AVEQQ QK+KVA+I+IGTRGSPLALA
Sbjct  34    SVSVLRSSMPSLKTRAFPNSIRKHSLIGIPMASVAVEQQIQKSKVALIKIGTRGSPLALA  93

Query  240   QAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAE  419
             QAYETR+KLMASHPELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN +
Sbjct  94    QAYETREKLMASHPELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGD  153

Query  420   IDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKS  599
             IDIAVHSMKDVPTYLP++T+LPCNLPREDVRDAFISL+A+SLADLPAGSTVGTASLRRKS
Sbjct  154   IDIAVHSMKDVPTYLPEQTVLPCNLPREDVRDAFISLTASSLADLPAGSTVGTASLRRKS  213

Query  600   QILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDML  779
             QILHR+P+L V ENFRGNVQTRL+KLNE VV+ATLLALAGLKRLDMTENVTSIL +++ML
Sbjct  214   QILHRFPTLNVQENFRGNVQTRLKKLNEKVVEATLLALAGLKRLDMTENVTSILSLDEML  273

Query  780   PAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRG  959
             PAVAQGAIGIACR++D+KMANYI SLNHEETRLAV CER+FL TLDGSCRTPIAGYA + 
Sbjct  274   PAVAQGAIGIACRTNDDKMANYIDSLNHEETRLAVACERSFLLTLDGSCRTPIAGYASKD  333

Query  960   EDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFG  1121
             EDG+CIFKGLVASPDGTRV+ETSRKGPY   DM+ MG+DAG+ELL +AGPGFFG
Sbjct  334   EDGNCIFKGLVASPDGTRVLETSRKGPYASQDMIDMGKDAGQELLSRAGPGFFG  387



>ref|XP_010112535.1| Porphobilinogen deaminase [Morus notabilis]
 gb|EXC33988.1| Porphobilinogen deaminase [Morus notabilis]
Length=380

 Score =   521 bits (1341),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 283/325 (87%), Positives = 309/325 (95%), Gaps = 0/325 (0%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             V RAS+AVEQQ QK++VA++RIGTRGSPLALAQA+ETRDKL ASHPELAEEGAIEI+IIK
Sbjct  54    VTRASVAVEQQTQKSRVALLRIGTRGSPLALAQAHETRDKLKASHPELAEEGAIEIVIIK  113

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN++IDIAVHSMKDVPTYLP+KTILPCNLPRE
Sbjct  114   TTGDKILSQPLADIGGKGLFTKEIDEALINSDIDIAVHSMKDVPTYLPEKTILPCNLPRE  173

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSAASLA+LPAGS VGTASLRRKSQIL+RYPSLKV +NFRGNVQTRLRKLNE
Sbjct  174   DVRDAFISLSAASLAELPAGSIVGTASLRRKSQILYRYPSLKVEDNFRGNVQTRLRKLNE  233

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGLKRL+MTENVT IL I++MLPAVAQGAIGIACRSDD+KMA+YIASLNH
Sbjct  234   GVVQATLLALAGLKRLNMTENVTCILSIDEMLPAVAQGAIGIACRSDDDKMASYIASLNH  293

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLA+ CERAFLT LDGSCRTPIAGYA + EDG+CIFKGLVASPDGTRV+ETSRKGPY
Sbjct  294   EETRLAIACERAFLTKLDGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPY  353

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
                DM+ MG+DAG+ELL +AGPGFF
Sbjct  354   AFEDMMKMGKDAGEELLSRAGPGFF  378



>ref|XP_011097642.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Sesamum 
indicum]
Length=377

 Score =   520 bits (1340),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 287/360 (80%), Positives = 320/360 (89%), Gaps = 6/360 (2%)
 Frame = +3

Query  54    TKPSVSVF-----RSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTR  218
             T+P  S F      +L C   +S      R  + LV RAS++VE++  +TK A+IRIGTR
Sbjct  17    TRPLCSNFTAASVSALGCSLPASKSPAFTRRGRVLVTRASVSVEEKT-RTKTAVIRIGTR  75

Query  219   GSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEID  398
             GSPLALAQAYETRDKL+ SHPELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEID
Sbjct  76    GSPLALAQAYETRDKLIESHPELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEID  135

Query  399   EALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGT  578
             EALIN+EIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFI L+AASLA+LPAGSTVGT
Sbjct  136   EALINSEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFICLTAASLAELPAGSTVGT  195

Query  579   ASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSI  758
             ASLRRKSQ+L+RYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL+MTENVTS+
Sbjct  196   ASLRRKSQLLNRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMTENVTSV  255

Query  759   LPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPI  938
             L I+DMLPAVAQGAIGIACRSDDEKMA+Y+ASLNHE+TRLAV CERAFL  L+GSCRTPI
Sbjct  256   LSIDDMLPAVAQGAIGIACRSDDEKMASYLASLNHEDTRLAVSCERAFLEKLEGSCRTPI  315

Query  939   AGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             AGYARR  DG+CIFK LVASPDGT+V+ETSR+GPY  +DM+ MG DAG+ELL +AGPGFF
Sbjct  316   AGYARRDADGNCIFKALVASPDGTQVLETSREGPYAYDDMIKMGVDAGEELLARAGPGFF  375



>ref|NP_001240888.1| uncharacterized protein LOC100779132 [Glycine max]
 gb|ACU20300.1| unknown [Glycine max]
 gb|KHN25625.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=356

 Score =   517 bits (1331),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 283/328 (86%), Positives = 304/328 (93%), Gaps = 3/328 (1%)
 Frame = +3

Query  141   LVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiii  320
              V +AS+AVEQQ   TKVA+IRIGTRGSPLALAQAYETRDKLMASHP+LAEEGAIEI+II
Sbjct  32    WVTKASVAVEQQ---TKVALIRIGTRGSPLALAQAYETRDKLMASHPDLAEEGAIEIVII  88

Query  321   kttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPR  500
             KTTGDKIL+QPLADIGGKGLFTKEIDEAL+N+EIDIAVHSMKDVPTYLPDKTILPCNLPR
Sbjct  89    KTTGDKILTQPLADIGGKGLFTKEIDEALLNSEIDIAVHSMKDVPTYLPDKTILPCNLPR  148

Query  501   EDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLN  680
             EDVRDAFISL+AASLADLP  S +GTASLRRKSQILHRYPSL V ENFRGNVQTRLRKLN
Sbjct  149   EDVRDAFISLTAASLADLPPASVIGTASLRRKSQILHRYPSLNVQENFRGNVQTRLRKLN  208

Query  681   EGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLN  860
             EGVVQATLLALAGLKRL MTENVTSIL I+DMLPAVAQGAIGIACRSDD+KMA YI SLN
Sbjct  209   EGVVQATLLALAGLKRLSMTENVTSILSIDDMLPAVAQGAIGIACRSDDDKMAEYIDSLN  268

Query  861   HEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGP  1040
             HEETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+C+F+GLVASPDGTRV+ETSR GP
Sbjct  269   HEETRLAVVCERAFLQTLDGSCRTPIAGYACRNEDGNCLFRGLVASPDGTRVLETSRVGP  328

Query  1041  YTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             Y + DM+ MG+DAGKELL +AGP FF +
Sbjct  329   YAVEDMIEMGKDAGKELLSRAGPNFFSS  356



>ref|XP_003537739.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Glycine 
max]
 gb|KHN05503.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=350

 Score =   514 bits (1325),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 278/324 (86%), Positives = 304/324 (94%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RASIAVEQQ  +TKVA+++IGTRGSPLALAQAYETRDKLMASHPELAEEGAI+I+IIKT
Sbjct  25    IRASIAVEQQTSQTKVALLKIGTRGSPLALAQAYETRDKLMASHPELAEEGAIQIVIIKT  84

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  85    TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLPRED  144

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLP+GS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL+EG
Sbjct  145   VRDAFISLSAASLADLPSGSVVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEG  204

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             +VQATLLALAGLKRL+MTENV+SIL I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  205   IVQATLLALAGLKRLNMTENVSSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  264

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL  L+GSCRTPIAGYA R EDG+C+F+GLVASPDGTRV+ETSR G Y 
Sbjct  265   ETRLAVSCERAFLEKLEGSCRTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRIGSYA  324

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               DM+ MG+DAG+ELL +AGPGFF
Sbjct  325   FEDMIKMGKDAGEELLSRAGPGFF  348



>ref|XP_010046969.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW78688.1| hypothetical protein EUGRSUZ_C00142 [Eucalyptus grandis]
Length=385

 Score =   516 bits (1328),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             V RAS+ VE++ Q+ + A + IGTRGSPLALAQAYETRDKL ASHPELAEEGAIEI IIK
Sbjct  59    VARASVVVEKETQEARTAFLVIGTRGSPLALAQAYETRDKLKASHPELAEEGAIEIKIIK  118

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLPDKTILPCNL RE
Sbjct  119   TTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLQRE  178

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFIS SA SLA LPAGS VGTASLRRKSQIL+RYPSL+V ENFRGNVQTRL+KL+E
Sbjct  179   DVRDAFISTSAGSLAKLPAGSIVGTASLRRKSQILNRYPSLQVQENFRGNVQTRLKKLSE  238

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGLKRL+MTENVTSIL I+DMLPAVAQGAIGIACRSD+EKMANY+A+LNH
Sbjct  239   GVVQATLLALAGLKRLNMTENVTSILSIDDMLPAVAQGAIGIACRSDNEKMANYLATLNH  298

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAV CERAFL TLDGSCRTPIAGYA + EDG+CIF+GLVASPDGTRV+ETSRKGPY
Sbjct  299   EETRLAVSCERAFLETLDGSCRTPIAGYASKDEDGNCIFRGLVASPDGTRVLETSRKGPY  358

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
             T  DMVLMG+DAGKELL +AGPGFF
Sbjct  359   TYEDMVLMGKDAGKELLSRAGPGFF  383



>gb|KHN20627.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=350

 Score =   513 bits (1322),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 279/324 (86%), Positives = 303/324 (94%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RASIAVEQQ  +TKVA++RIGTRGSPLALAQAYETRDKLMASH ELAEEGAI+I+IIKT
Sbjct  25    IRASIAVEQQTSQTKVALLRIGTRGSPLALAQAYETRDKLMASHAELAEEGAIQIVIIKT  84

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  85    TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLPRED  144

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLP+GS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL+EG
Sbjct  145   VRDAFISLSAASLADLPSGSIVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEG  204

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             +VQATLLALAGLKRL+MTENVTSIL I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  205   IVQATLLALAGLKRLNMTENVTSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  264

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL  L+GSCRTPIAGYA R EDG+C+F+GLVASPDG RV+ETSR GPY 
Sbjct  265   ETRLAVSCERAFLEKLEGSCRTPIAGYASRNEDGNCLFRGLVASPDGIRVLETSRIGPYA  324

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               DM+ MG+DAG+ELL +AGPGFF
Sbjct  325   FEDMIKMGKDAGEELLSRAGPGFF  348



>ref|NP_001242644.1| uncharacterized protein LOC100812733 [Glycine max]
 gb|ACU17914.1| unknown [Glycine max]
Length=350

 Score =   511 bits (1316),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 278/324 (86%), Positives = 302/324 (93%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RASIAVEQQ  +TKVA++RIGTRGSPLALAQAYETRDKLMASH ELAEEGAI+I+IIKT
Sbjct  25    IRASIAVEQQTSQTKVALLRIGTRGSPLALAQAYETRDKLMASHAELAEEGAIQIVIIKT  84

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  85    TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLPRED  144

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLP+GS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL+EG
Sbjct  145   VRDAFISLSAASLADLPSGSIVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEG  204

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             +VQATLLALAGLKRL+MTENVTSIL I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  205   IVQATLLALAGLKRLNMTENVTSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  264

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL  L+GSCRTPIAGYA R EDG+C+F+GLVASPDG RV+ETSR GPY 
Sbjct  265   ETRLAVSCERAFLEKLEGSCRTPIAGYASRNEDGNCLFRGLVASPDGIRVLETSRIGPYA  324

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               D + MG+DAG+ELL +AGPGFF
Sbjct  325   FEDTIKMGKDAGEELLSRAGPGFF  348



>gb|ACU17610.1| unknown [Glycine max]
Length=350

 Score =   510 bits (1313),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 276/324 (85%), Positives = 302/324 (93%), Gaps = 0/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RASIAVEQQ  +TKVA+++IGTRGSPLALAQAYETRDKLMASHPELAEEGAI+I+IIKT
Sbjct  25    IRASIAVEQQTSQTKVALLKIGTRGSPLALAQAYETRDKLMASHPELAEEGAIQIVIIKT  84

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN + DIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  85    TGDKILSQPLADIGGKGLFTKEIDEALINGDSDIAVHSMKDVPTYLPDKTILPCNLPRED  144

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLP+GS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL+EG
Sbjct  145   VRDAFISLSAASLADLPSGSVVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEG  204

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             +VQATLLALAGLKRL+MTENV+SIL I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  205   IVQATLLALAGLKRLNMTENVSSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  264

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL  L+GSC TPIAGYA R EDG+C+F+GLVASPDGTRV+ETSR G Y 
Sbjct  265   ETRLAVSCERAFLEKLEGSCHTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRIGSYA  324

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               DM+ MG+DAG+ELL +AGPGFF
Sbjct  325   FEDMIKMGKDAGEELLSRAGPGFF  348



>ref|XP_006437594.1| hypothetical protein CICLE_v10031858mg [Citrus clementina]
 ref|XP_006484530.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Citrus 
sinensis]
 gb|ESR50834.1| hypothetical protein CICLE_v10031858mg [Citrus clementina]
Length=375

 Score =   511 bits (1315),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 286/347 (82%), Positives = 312/347 (90%), Gaps = 10/347 (3%)
 Frame = +3

Query  93    GFKS---STPNQP--IRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETR  257
             GF S    TP+ P  ++     +VRAS AVE     TKVAIIRIGTRGSPLALAQA+ETR
Sbjct  32    GFSSPRLKTPSFPKSLKKRSFGLVRASAAVE-----TKVAIIRIGTRGSPLALAQAHETR  86

Query  258   DKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVH  437
             +KLMA HPELA+EGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN++IDIAVH
Sbjct  87    NKLMALHPELAQEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINSQIDIAVH  146

Query  438   SMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRY  617
             SMKDVPTYLP+KTILPCNL REDVRDAFISLSAASLA+LPAGS VGTASLRRKSQILHRY
Sbjct  147   SMKDVPTYLPEKTILPCNLQREDVRDAFISLSAASLAELPAGSIVGTASLRRKSQILHRY  206

Query  618   PSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQG  797
             PSLKV+ENFRGNVQTRLRKLNE VVQATLLALAGLKRL MTENVT+IL ++DMLPAVAQG
Sbjct  207   PSLKVMENFRGNVQTRLRKLNERVVQATLLALAGLKRLSMTENVTNILSVDDMLPAVAQG  266

Query  798   AIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCI  977
             AIGIACRS+DEKMANY+ SLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E+GDC+
Sbjct  267   AIGIACRSNDEKMANYLGSLNHEETRLAVACERAFLETLDGSCRTPIAGYACKDENGDCV  326

Query  978   FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             F+GLVASPDGTRV+ETSRKG YTL DM+ MG+DAGKELL Q GPGFF
Sbjct  327   FRGLVASPDGTRVLETSRKGSYTLQDMIKMGKDAGKELLSQTGPGFF  373



>ref|XP_003607331.1| Porphobilinogen deaminase [Medicago truncatula]
 gb|AES89528.1| porphobilinogen deaminase [Medicago truncatula]
Length=369

 Score =   509 bits (1312),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 277/326 (85%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RAS+AVEQQ Q+TK AIIRIGTRGSPLALAQA+ETRDKL+ASH ELAEEGAI+I+IIKT
Sbjct  44    IRASVAVEQQTQQTKTAIIRIGTRGSPLALAQAHETRDKLIASHTELAEEGAIQIVIIKT  103

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRED
Sbjct  104   TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRED  163

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V +NFRGNVQTRLRKL+EG
Sbjct  164   VRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYPSLSVQDNFRGNVQTRLRKLSEG  223

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VV+ATLLALAGLKRL+MTENVTS L I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  224   VVKATLLALAGLKRLNMTENVTSTLSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  283

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLA+ CERAFLTTLDGSCRTPIAGYA R +DG+C+F+GLVASPDGTRV+ETSR GPY 
Sbjct  284   ETRLAISCERAFLTTLDGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGPYA  343

Query  1047  LNDMVLMGEDAGKELLLQAGPGFFGN  1124
               DM+ MG DAG+ELL +AGPGFF +
Sbjct  344   YEDMMKMGRDAGEELLSRAGPGFFNS  369



>ref|XP_007156992.1| hypothetical protein PHAVU_002G034500g [Phaseolus vulgaris]
 gb|ESW28986.1| hypothetical protein PHAVU_002G034500g [Phaseolus vulgaris]
Length=385

 Score =   510 bits (1313),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 279/326 (86%), Positives = 304/326 (93%), Gaps = 3/326 (1%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             V+ASIAVE Q   TKVA+IRIGTRGSPLALAQA+ETRDKLMASHP+LAEEGAI+I+IIKT
Sbjct  63    VKASIAVEPQ---TKVALIRIGTRGSPLALAQAHETRDKLMASHPDLAEEGAIQIVIIKT  119

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEAL+N+EIDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  120   TGDKILSQPLADIGGKGLFTKEIDEALLNSEIDIAVHSMKDVPTYLPDKTILPCNLPRED  179

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSA+SLADLP GS +GTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL++G
Sbjct  180   VRDAFISLSASSLADLPPGSVIGTASLRRKSQILHRYPSLNVQENFRGNVQTRLRKLSDG  239

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VVQATLLALAGLKRL MTENVTSIL IEDMLPAVAQGAIGIACRS+D+KMA YIASLNH+
Sbjct  240   VVQATLLALAGLKRLSMTENVTSILSIEDMLPAVAQGAIGIACRSNDDKMAEYIASLNHD  299

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+C+F+GLVASPDGT V+ET+R GPY 
Sbjct  300   ETRLAVVCERAFLQTLDGSCRTPIAGYACRNEDGNCLFRGLVASPDGTSVLETTRVGPYA  359

Query  1047  LNDMVLMGEDAGKELLLQAGPGFFGN  1124
             + DM+ MG+DAGKELL +AGP FF +
Sbjct  360   VEDMIEMGKDAGKELLSRAGPNFFSS  385



>ref|XP_004505653.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Cicer 
arietinum]
Length=369

 Score =   509 bits (1311),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 276/326 (85%), Positives = 303/326 (93%), Gaps = 0/326 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RAS+AVEQQ Q+ K A++RIGTRGSPLALAQA+ETRDKLMASH ELAEEGAI+I+IIKT
Sbjct  44    IRASVAVEQQTQQNKTALLRIGTRGSPLALAQAHETRDKLMASHTELAEEGAIQIVIIKT  103

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  104   TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLPRED  163

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLP+GS VGTASLRRKSQILHRYPSL V +NFRGNVQTRLRKL+EG
Sbjct  164   VRDAFISLSAASLADLPSGSVVGTASLRRKSQILHRYPSLNVQDNFRGNVQTRLRKLSEG  223

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VVQATLLALAGLKRL MTENV+S L I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  224   VVQATLLALAGLKRLHMTENVSSTLSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  283

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLA+ CERAFL TLDGSCRTPIAGYA R EDG+C+F+GLVASPDGTRV+ETSR GPY 
Sbjct  284   ETRLAISCERAFLETLDGSCRTPIAGYASRTEDGNCLFRGLVASPDGTRVLETSRIGPYA  343

Query  1047  LNDMVLMGEDAGKELLLQAGPGFFGN  1124
               DM+ MG+DAG+ELL +AGPGFF +
Sbjct  344   FEDMMKMGKDAGEELLSRAGPGFFNS  369



>gb|EYU27543.1| hypothetical protein MIMGU_mgv1a008527mg [Erythranthe guttata]
Length=370

 Score =   508 bits (1307),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 287/373 (77%), Positives = 321/373 (86%), Gaps = 6/373 (2%)
 Frame = +3

Query  3     MEKMAITLNPVVAFPANTKPSVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQA  179
             MEKMAI       F   T  S+S  R SL    KS + N+  R   S  VRAS+AVE++ 
Sbjct  1     MEKMAIATVNQAHF---TAASISPLRFSLSSIGKSPSLNRSARGA-SFSVRASVAVEEKT  56

Query  180   QKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLA  359
               TK A+IRIGTRGSPLALAQAYETR KL+ SHPELAEEGAI+I+IIKTTGDKILSQPLA
Sbjct  57    L-TKAAVIRIGTRGSPLALAQAYETRAKLIDSHPELAEEGAIQIVIIKTTGDKILSQPLA  115

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             DIGGKGLFTKEIDEALIN++IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+AA
Sbjct  116   DIGGKGLFTKEIDEALINSDIDIAVHSMKDVPTYLPENTILPCNLPREDVRDAFICLTAA  175

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             SLA+LPAGS VGTASLRRKSQ+L+RYPSLKV+ENFRGNVQTRL+KLNEGVVQATLLALAG
Sbjct  176   SLAELPAGSVVGTASLRRKSQLLNRYPSLKVVENFRGNVQTRLKKLNEGVVQATLLALAG  235

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             LKRL+MTENVT+I+ I+DMLPAVAQGAIGIACRSDDEKMA Y+ASLNHEETRLA+ CERA
Sbjct  236   LKRLNMTENVTAIMSIDDMLPAVAQGAIGIACRSDDEKMATYLASLNHEETRLAISCERA  295

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             FL  L+GSCRTPIAGYA R E+GDC F+ L+ASPDGT V+ETSRKGPY  +DM+ MG DA
Sbjct  296   FLEKLEGSCRTPIAGYAHRDENGDCFFRALIASPDGTEVLETSRKGPYAYDDMMKMGVDA  355

Query  1080  GKELLLQAGPGFF  1118
             G+ELL +AGPGFF
Sbjct  356   GEELLSRAGPGFF  368



>ref|XP_007133420.1| hypothetical protein PHAVU_011G1771000g, partial [Phaseolus vulgaris]
 gb|ESW05414.1| hypothetical protein PHAVU_011G1771000g, partial [Phaseolus vulgaris]
Length=335

 Score =   503 bits (1296),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 275/327 (84%), Positives = 304/327 (93%), Gaps = 1/327 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQ-KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             +RAS+A+EQQ   +TKVA++RIGTRGSPLALAQAYETRDKLMASHPELAEEGAI+I++IK
Sbjct  9     IRASLAIEQQTLLQTKVALLRIGTRGSPLALAQAYETRDKLMASHPELAEEGAIQIVVIK  68

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN++IDIAVHSMKDVPTYLPDKTILPCNLPRE
Sbjct  69    TTGDKILSQPLADIGGKGLFTKEIDEALINSDIDIAVHSMKDVPTYLPDKTILPCNLPRE  128

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSAASLADL +GS VGTASLRRKSQILHRYPSL V ENFRGNVQTRLRKL+E
Sbjct  129   DVRDAFISLSAASLADLSSGSIVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSE  188

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGLKRL+MTENVTSIL I+DMLPAVAQGAIGIACR++D+KMA Y+ASLNH
Sbjct  189   GVVQATLLALAGLKRLNMTENVTSILSIDDMLPAVAQGAIGIACRTNDDKMAEYLASLNH  248

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EET+LAV CERAFL TL+GSCRTPIAGYA R  DG+C F+GLVASPDGTRV+ETSR G Y
Sbjct  249   EETKLAVSCERAFLETLEGSCRTPIAGYASRNMDGNCFFRGLVASPDGTRVLETSRIGSY  308

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFFGN  1124
                DM+ MG+DAG+ELL +AGPGFF +
Sbjct  309   VAEDMIKMGKDAGEELLSRAGPGFFSS  335



>sp|Q43082.1|HEM3_PEA RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; Flags: Precursor 
[Pisum sativum]
 emb|CAA51820.1| hydroxymethylbilane synthase [Pisum sativum]
Length=369

 Score =   504 bits (1299),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 274/326 (84%), Positives = 305/326 (94%), Gaps = 0/326 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             +RAS+AVEQQ Q+ K A+IRIGTRGSPLALAQA+ETRDKLMASH ELAEEGAI+I+IIKT
Sbjct  44    IRASLAVEQQTQQNKTALIRIGTRGSPLALAQAHETRDKLMASHTELAEEGAIQIVIIKT  103

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP++TILPCNLPRED
Sbjct  104   TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEETILPCNLPRED  163

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V +NFRGNVQTRLRKL+EG
Sbjct  164   VRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYPSLTVQDNFRGNVQTRLRKLSEG  223

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
             VV+ATLLALAGLKRL+MTENVTS L I+DMLPAVAQGAIGIACRS+D+KMA Y+ASLNHE
Sbjct  224   VVKATLLALAGLKRLNMTENVTSTLSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHE  283

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLA+ CERAFLTTLDGSCRTPIAGYA R +DG+C+F+GLVASPDGTRV+ETSR G YT
Sbjct  284   ETRLAISCERAFLTTLDGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGSYT  343

Query  1047  LNDMVLMGEDAGKELLLQAGPGFFGN  1124
               DM+ +G+DAG+ELL +AGPGFF +
Sbjct  344   YEDMMKIGKDAGEELLSRAGPGFFNS  369



>gb|KGN58555.1| hypothetical protein Csa_3G682170 [Cucumis sativus]
Length=364

 Score =   499 bits (1286),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 309/325 (95%), Gaps = 1/325 (0%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             ++RA +A EQQ +KTKVA++RIGTRGSPLALAQA+ETRDKLMASHPELAE+GAI+I++IK
Sbjct  39    LIRA-VAAEQQVEKTKVALLRIGTRGSPLALAQAHETRDKLMASHPELAEDGAIQIVVIK  97

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEID+ALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRE
Sbjct  98    TTGDKILSQPLADIGGKGLFTKEIDDALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRE  157

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSA S A+LPAGS +GTASLRRKSQ+L+RYPSLKVLENFRGNVQTRLRKLNE
Sbjct  158   DVRDAFISLSAGSFAELPAGSIIGTASLRRKSQLLNRYPSLKVLENFRGNVQTRLRKLNE  217

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGL+RL+MTENVTSIL I++MLPAVAQGAIGIACRSDD+ MANY+ASLNH
Sbjct  218   GVVQATLLALAGLRRLNMTENVTSILSIDEMLPAVAQGAIGIACRSDDDIMANYLASLNH  277

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+CIFKGLVASPDGTRV+ETSR+GPY
Sbjct  278   EETRLAVVCERAFLETLDGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPY  337

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
              + DM+ MG+DAG+ELL +AGPGFF
Sbjct  338   AIEDMIAMGKDAGQELLSRAGPGFF  362



>ref|XP_004149732.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Cucumis 
sativus]
Length=375

 Score =   498 bits (1282),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 309/325 (95%), Gaps = 1/325 (0%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             ++RA +A EQQ +KTKVA++RIGTRGSPLALAQA+ETRDKLMASHPELAE+GAI+I++IK
Sbjct  50    LIRA-VAAEQQVEKTKVALLRIGTRGSPLALAQAHETRDKLMASHPELAEDGAIQIVVIK  108

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEID+ALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRE
Sbjct  109   TTGDKILSQPLADIGGKGLFTKEIDDALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRE  168

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSA S A+LPAGS +GTASLRRKSQ+L+RYPSLKVLENFRGNVQTRLRKLNE
Sbjct  169   DVRDAFISLSAGSFAELPAGSIIGTASLRRKSQLLNRYPSLKVLENFRGNVQTRLRKLNE  228

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGL+RL+MTENVTSIL I++MLPAVAQGAIGIACRSDD+ MANY+ASLNH
Sbjct  229   GVVQATLLALAGLRRLNMTENVTSILSIDEMLPAVAQGAIGIACRSDDDIMANYLASLNH  288

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+CIFKGLVASPDGTRV+ETSR+GPY
Sbjct  289   EETRLAVVCERAFLETLDGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPY  348

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
              + DM+ MG+DAG+ELL +AGPGFF
Sbjct  349   AIEDMIAMGKDAGQELLSRAGPGFF  373



>ref|XP_004306458.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   498 bits (1282),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 267/326 (82%), Positives = 299/326 (92%), Gaps = 0/326 (0%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             V RAS+AVEQQA   K+A+I+IGTRGSPLALAQAY+T++KL+ASHP LAE+GAIEI+IIK
Sbjct  47    VTRASLAVEQQAHNPKLAVIKIGTRGSPLALAQAYQTKEKLIASHPHLAEDGAIEIVIIK  106

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPT LPDKTILPCNLPRE
Sbjct  107   TTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTLLPDKTILPCNLPRE  166

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFI L+A+SL +LPAGS +GTASLRRKSQILHRYPSLKV ENFRGNVQTRL+KLNE
Sbjct  167   DVRDAFICLTASSLGELPAGSIIGTASLRRKSQILHRYPSLKVEENFRGNVQTRLKKLNE  226

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
              VVQATLLALAGLKRL+MTENVTS+L +++MLPAVAQGAIGIACRS+D+KMA YIA LNH
Sbjct  227   KVVQATLLALAGLKRLNMTENVTSVLSLDEMLPAVAQGAIGIACRSNDDKMAEYIAKLNH  286

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAV CERAFL TLDGSCRTPIAGYA +  DG+CIFKGLVASP+GTRV+ETSRKG Y
Sbjct  287   EETRLAVACERAFLLTLDGSCRTPIAGYASKDADGNCIFKGLVASPNGTRVLETSRKGRY  346

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFFG  1121
                +M+ +G+DAG+ELL  AGPGFFG
Sbjct  347   AYKEMMEIGKDAGQELLKLAGPGFFG  372



>ref|XP_004297733.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   496 bits (1276),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 278/363 (77%), Positives = 312/363 (86%), Gaps = 18/363 (5%)
 Frame = +3

Query  33    VVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIG  212
             +V F  NT+P           F +S     IR     + RAS+AVE   Q  K+A+I+IG
Sbjct  19    LVDFSFNTRP-----------FPTS-----IRKQSLGITRASVAVE--TQNPKLALIKIG  60

Query  213   TRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKE  392
             TRGSPLALAQAY+T+DKL+ASHP LAE+GAIEI+IIKTTGDKILSQPLADIGGKGLFTKE
Sbjct  61    TRGSPLALAQAYQTKDKLIASHPHLAEDGAIEIVIIKTTGDKILSQPLADIGGKGLFTKE  120

Query  393   IDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTV  572
             IDEALIN ++DIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFI L+A+SLADLPAGS +
Sbjct  121   IDEALINGDVDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFICLTASSLADLPAGSVI  180

Query  573   GTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVT  752
             GTASLRRKSQILHR+PSLKV ENFRGNVQTRL+KLNE VVQATLLALAGLKRL+MTENVT
Sbjct  181   GTASLRRKSQILHRFPSLKVEENFRGNVQTRLKKLNEKVVQATLLALAGLKRLNMTENVT  240

Query  753   SILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRT  932
             SIL +++MLPAVAQGAIGIACRS+D+KMA YI  LNHEETRLAV CERAFL TLDGSCRT
Sbjct  241   SILSLDEMLPAVAQGAIGIACRSNDDKMAEYIDKLNHEETRLAVACERAFLLTLDGSCRT  300

Query  933   PIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPG  1112
             PIAGYA +  DG+CIFKGLVASPDGTRV+ETSRKGPYT  +M+ +G+DAG+ELL  AGPG
Sbjct  301   PIAGYASKDADGNCIFKGLVASPDGTRVLETSRKGPYTYKEMMEIGKDAGEELLKLAGPG  360

Query  1113  FFG  1121
             FFG
Sbjct  361   FFG  363



>gb|KJB31849.1| hypothetical protein B456_005G211000 [Gossypium raimondii]
Length=376

 Score =   495 bits (1275),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 278/325 (86%), Positives = 306/325 (94%), Gaps = 6/325 (2%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             V++AS+A      KT+VA++RIGTRGSPLALAQA+ETRDKLMASHPELAEEGAI+I++IK
Sbjct  56    VIKASVA------KTEVALVRIGTRGSPLALAQAHETRDKLMASHPELAEEGAIKIVVIK  109

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRE
Sbjct  110   TTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRE  169

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSA+SLA+LPAGS +GTASLRRKSQIL+RYPSLKV +NFRGNVQTRLRKLNE
Sbjct  170   DVRDAFISLSASSLAELPAGSVIGTASLRRKSQILYRYPSLKVEDNFRGNVQTRLRKLNE  229

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGL+RL MTENVTS+LPI +MLPAVAQGAIGIACRS+DEKMANY+ASLNH
Sbjct  230   GVVQATLLALAGLRRLSMTENVTSVLPIHEMLPAVAQGAIGIACRSNDEKMANYLASLNH  289

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAV CERAFL TLDGSCRTPIAGYA + EDG+CIFKGLVASPDGTRV+ETSRKGPY
Sbjct  290   EETRLAVTCERAFLETLDGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPY  349

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
                DMV+MG+DAGKELL +AGPGFF
Sbjct  350   AFEDMVMMGKDAGKELLSRAGPGFF  374



>ref|XP_002873350.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49609.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   495 bits (1274),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 267/333 (80%), Positives = 297/333 (89%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + + S  V+A +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KL + HPEL E+GAI
Sbjct  53    KQSSSGFVKACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLKSKHPELVEDGAI  109

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILP
Sbjct  110   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILP  169

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPREDVRDAFI L+AASLA+LPAGS VGTASLRRKSQILH+YP+L+V ENFRGNVQTR
Sbjct  170   CNLPREDVRDAFICLTAASLAELPAGSVVGTASLRRKSQILHKYPALRVEENFRGNVQTR  229

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G VQATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y
Sbjct  230   LSKLQGGKVQATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATY  289

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLA+ CERAFL TLDGSCRTPIAGYA + E+G+CIF+GLVASPDGT+V+ET
Sbjct  290   LASLNHEETRLAISCERAFLETLDGSCRTPIAGYAAKDEEGNCIFRGLVASPDGTKVLET  349

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  350   SRKGPYVYEDMVKMGKDAGQELLSRAGPGFFGN  382



>ref|XP_006287933.1| hypothetical protein CARUB_v10001168mg [Capsella rubella]
 gb|EOA20831.1| hypothetical protein CARUB_v10001168mg [Capsella rubella]
Length=382

 Score =   494 bits (1272),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 267/333 (80%), Positives = 296/333 (89%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + + S  V+A +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KLM+ HPEL E+GAI
Sbjct  53    KQSSSGFVKACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLMSKHPELVEDGAI  109

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILP
Sbjct  110   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILP  169

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNL REDVRDAFI L+AASLA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTR
Sbjct  170   CNLVREDVRDAFICLTAASLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTR  229

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G VQATLLALAGLKRL MTENV SIL ++DMLPAVAQGAIGIACR+DD+KMA Y
Sbjct  230   LSKLQGGKVQATLLALAGLKRLSMTENVASILSLDDMLPAVAQGAIGIACRTDDDKMATY  289

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEE+RLAV CERAFL TLDGSCRTPIAGYA + E+G+C+F+GLVASPDGT+V+ET
Sbjct  290   LASLNHEESRLAVSCERAFLLTLDGSCRTPIAGYAAKDEEGNCVFRGLVASPDGTKVLET  349

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  350   SRKGPYVYEDMVKMGKDAGQELLSRAGPGFFGN  382



>ref|NP_196445.1| Porphobilinogen deaminase [Arabidopsis thaliana]
 sp|Q43316.1|HEM3_ARATH RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; AltName: Full=Protein 
RUGOSA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL31946.1|AF419614_1 AT5g08280/F8L15_10 [Arabidopsis thaliana]
 emb|CAA51941.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 emb|CAA52061.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 emb|CAC08328.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AAL49926.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AAM67570.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AED91277.1| Porphobilinogen deaminase [Arabidopsis thaliana]
Length=382

 Score =   493 bits (1270),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 266/333 (80%), Positives = 295/333 (89%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + + S  V+A +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KL   HPEL E+GAI
Sbjct  53    KQSSSGFVKACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLKKKHPELVEDGAI  109

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILP
Sbjct  110   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILP  169

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPREDVRDAFI L+AA+LA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTR
Sbjct  170   CNLPREDVRDAFICLTAATLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTR  229

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G VQATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y
Sbjct  230   LSKLQGGKVQATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATY  289

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLA+ CERAFL TLDGSCRTPIAGYA + E+G+CIF+GLVASPDGT+V+ET
Sbjct  290   LASLNHEETRLAISCERAFLETLDGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLET  349

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  350   SRKGPYVYEDMVKMGKDAGQELLSRAGPGFFGN  382



>ref|XP_010276152.1| PREDICTED: porphobilinogen deaminase, chloroplastic isoform X1 
[Nelumbo nucifera]
Length=374

 Score =   493 bits (1268),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 282/370 (76%), Positives = 318/370 (86%), Gaps = 6/370 (2%)
 Frame = +3

Query  18    ITLNPVVAFPANTKP-SVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKV  194
             ITL   +  PA+ +  S+S F   P   K    N      + L+ RA++AVEQQAQ T+V
Sbjct  4     ITLKQAL-IPASLRSASISAFGFPPPCLKFHPANH---GRRLLMTRAAVAVEQQAQ-TRV  58

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IRIGTRGSPLALAQAYETRDKLMA+HPEL+EEGAIEI+IIKTTGDKIL+QPLADIGGK
Sbjct  59    SLIRIGTRGSPLALAQAYETRDKLMATHPELSEEGAIEIVIIKTTGDKILTQPLADIGGK  118

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEIDEAL+N EIDIAVHSMKDVPTYLPD TILPCNLPREDVRDAFISLSA SLA+L
Sbjct  119   GLFTKEIDEALLNGEIDIAVHSMKDVPTYLPDGTILPCNLPREDVRDAFISLSARSLAEL  178

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             PAGS VG+ASLRRKSQIL+RYPSLKV  NFRGNVQTRLRK+ EG VQATLLALAGLKRLD
Sbjct  179   PAGSIVGSASLRRKSQILNRYPSLKVEMNFRGNVQTRLRKVREGEVQATLLALAGLKRLD  238

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             +TENVT+IL I++M+PAVAQGAIGIAC+S+D+KMANYIASLNHEETRLAV CERAFL TL
Sbjct  239   LTENVTAILSIDEMIPAVAQGAIGIACQSNDDKMANYIASLNHEETRLAVACERAFLETL  298

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSC+TPIAGYA +  +G CIF+GLVASPDGT+V ETSRKG Y L DM+ MG+DAGKELL
Sbjct  299   DGSCQTPIAGYACKDNEGYCIFRGLVASPDGTQVFETSRKGLYILEDMIAMGKDAGKELL  358

Query  1095  LQAGPGFFGN  1124
              +AG  FF N
Sbjct  359   SRAGSSFFDN  368



>gb|EPS63046.1| hypothetical protein M569_11740, partial [Genlisea aurea]
Length=354

 Score =   491 bits (1265),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 266/331 (80%), Positives = 298/331 (90%), Gaps = 1/331 (0%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             RS      RAS+A E+Q   TK A+IRIGTRGSPLALAQAYETRDKL+ SHPELAEEGAI
Sbjct  25    RSRGVFAARASVATEEQT-PTKTAVIRIGTRGSPLALAQAYETRDKLIHSHPELAEEGAI  83

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             +I+IIKTTGDKILSQPLADIGGKGLFTKEIDEAL+++EIDIAVHSMKDVPTYLPD+ ILP
Sbjct  84    QIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALLDSEIDIAVHSMKDVPTYLPDRIILP  143

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPREDVRDAFI L++ SL +LP GS VGTASLRRKSQ+L+RYPSLKVLENFRGNVQTR
Sbjct  144   CNLPREDVRDAFICLTSPSLVELPEGSIVGTASLRRKSQLLNRYPSLKVLENFRGNVQTR  203

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             LRKLNEGVV+ATLLALAGLKRL+MTENVTS+L I+DMLPAVAQGAIGIACR+DDEKMA Y
Sbjct  204   LRKLNEGVVRATLLALAGLKRLNMTENVTSVLSIDDMLPAVAQGAIGIACRNDDEKMAKY  263

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             ++SLNHE+TRLAV CERAFL  L+GSCRTPIAGYA+R  DG+CIFK LVASPDG +V+ET
Sbjct  264   LSSLNHEDTRLAVACERAFLEKLEGSCRTPIAGYAQRDADGNCIFKALVASPDGAKVLET  323

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
              R+GPY  +DMV MG DAG+ELL +AGPGFF
Sbjct  324   YREGPYAYDDMVKMGVDAGEELLSRAGPGFF  354



>ref|XP_009125721.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Brassica 
rapa]
Length=380

 Score =   492 bits (1266),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 269/333 (81%), Positives = 294/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + T S  VRA +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI
Sbjct  51    KGTSSGFVRACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRSKLQAIHPELTEDGAI  107

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT+LP
Sbjct  108   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTVLP  167

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNL REDVRDAFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTR
Sbjct  168   CNLVREDVRDAFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLTVEENFRGNVQTR  227

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G V ATLLALAGLKRL MTENV S+L +++MLPAVAQGAIGIACR+DD+KMA+Y
Sbjct  228   LSKLQGGKVHATLLALAGLKRLSMTENVASVLSLDEMLPAVAQGAIGIACRTDDDKMASY  287

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C+F+GLVASPDGTRV+ET
Sbjct  288   LASLNHEETRLAVACERAFLETLDGSCRTPIAGYAAKDEEGNCLFRGLVASPDGTRVLET  347

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  348   SRKGPYVFEDMVKMGKDAGQELLSRAGPGFFGN  380



>ref|XP_011626606.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Amborella 
trichopoda]
Length=370

 Score =   491 bits (1264),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 314/357 (88%), Gaps = 6/357 (2%)
 Frame = +3

Query  60    PSVSVFRSLPCGFKSSTP--NQPIRST--KSLVVRASIAVEQQAQKTKVAIIRIGTRGSP  227
             PSV +  +   GF S  P    P+ S   K LV RA++AVE Q Q TKV+++RIGTRGSP
Sbjct  14    PSVPMAPASVSGFGSCPPCLKYPLTSHGRKLLVPRAAVAVENQPQ-TKVSLVRIGTRGSP  72

Query  228   LALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEAL  407
             LALAQAYETRDKL A+H ELAE+GAI+IIIIKTTGDKIL+QPLADIGGKGLFTKEIDEAL
Sbjct  73    LALAQAYETRDKLKATHSELAEDGAIDIIIIKTTGDKILNQPLADIGGKGLFTKEIDEAL  132

Query  408   INAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASL  587
             + AEIDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A+SLA+LPAGS VG+ASL
Sbjct  133   LKAEIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLAELPAGSVVGSASL  192

Query  588   RRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPI  767
             RR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG VQATLLALAGLKRLDMTE+VTSIL I
Sbjct  193   RRQSQILYRYPSLKVI-NFRGNVQTRLRKLGEGEVQATLLALAGLKRLDMTEDVTSILSI  251

Query  768   EDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGY  947
             E+MLPA+AQGAIGIACR++D+KMANYIASLNHEETRLAV CERAFL TLDGSCRTPIAGY
Sbjct  252   EEMLPAIAQGAIGIACRTNDDKMANYIASLNHEETRLAVTCERAFLETLDGSCRTPIAGY  311

Query  948   ARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             A R +DG CIF+GLVASPDGTRV+ETSRKG Y + DMV MG+DAGKELL +AGP FF
Sbjct  312   AHRDKDGYCIFRGLVASPDGTRVLETSRKGNYDIEDMVEMGKDAGKELLSRAGPSFF  368



>ref|XP_006399317.1| hypothetical protein EUTSA_v10013814mg [Eutrema salsugineum]
 gb|ESQ40770.1| hypothetical protein EUTSA_v10013814mg [Eutrema salsugineum]
Length=382

 Score =   491 bits (1265),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 269/333 (81%), Positives = 293/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + + S  VRA +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL + HPEL E+GAI
Sbjct  53    KQSSSGFVRACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRKKLQSKHPELTEDGAI  109

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILP
Sbjct  110   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILP  169

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNL REDVRDAFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTR
Sbjct  170   CNLVREDVRDAFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLTVEENFRGNVQTR  229

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G VQATLLALAGLKRL MTENV +IL +++MLPAVAQGAIGIACR+DD+KMANY
Sbjct  230   LSKLQGGKVQATLLALAGLKRLGMTENVAAILSLDEMLPAVAQGAIGIACRTDDDKMANY  289

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + + G+C F+GLVASPDGTRV+ET
Sbjct  290   LASLNHEETRLAVACERAFLETLDGSCRTPIAGYAAKDDQGNCFFRGLVASPDGTRVLET  349

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  350   SRKGPYVFEDMVKMGKDAGQELLSRAGPGFFGN  382



>ref|XP_010522127.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Tarenaya 
hassleriana]
Length=380

 Score =   491 bits (1265),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 281/373 (75%), Positives = 313/373 (84%), Gaps = 5/373 (1%)
 Frame = +3

Query  6     EKMAITLNPVVAFPANTKPSVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQ  182
              +++ +L P     + +  SVSV   SLP   +S    +  +   S V+R+ +AVEQ   
Sbjct  11    HQISFSLKPSSLVNSCSLGSVSVLGFSLP-HLRSPLSARCRQGRTSGVIRSCVAVEQ---  66

Query  183   KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLAD  362
             K + AIIRIGTRGSPLALAQAYETRDKL + HPELAE+GAI I IIKTTGDKIL+QPLAD
Sbjct  67    KPRTAIIRIGTRGSPLALAQAYETRDKLKSIHPELAEDGAIHIEIIKTTGDKILTQPLAD  126

Query  363   IGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaas  542
             IGGKGLFTKEIDEALI+  IDIAVHSMKDVPTYLPDKTILPCNL REDVRDAFI L+AAS
Sbjct  127   IGGKGLFTKEIDEALIDGRIDIAVHSMKDVPTYLPDKTILPCNLKREDVRDAFICLTAAS  186

Query  543   ladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL  722
             LA+LPAGS VGTASLRRKSQILHRYPSLKV ENFRGNVQTRL KL  G V ATLLALAGL
Sbjct  187   LAELPAGSVVGTASLRRKSQILHRYPSLKVEENFRGNVQTRLSKLQGGKVHATLLALAGL  246

Query  723   KRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAF  902
             KRL+MTENVTSIL I++MLPAVAQGAIGIACRSDD+KMANY+ASLNHE TRLAV CERAF
Sbjct  247   KRLNMTENVTSILSIDEMLPAVAQGAIGIACRSDDDKMANYLASLNHEVTRLAVACERAF  306

Query  903   LTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             L TLDGSCRTPIAGYA + +DG+C+FKGLVASPDGTRV+ETSRKG Y   DMV MG+DAG
Sbjct  307   LETLDGSCRTPIAGYASQDDDGNCVFKGLVASPDGTRVLETSRKGLYAFEDMVRMGKDAG  366

Query  1083  KELLLQAGPGFFG  1121
             +ELL +AGPGFFG
Sbjct  367   QELLSRAGPGFFG  379



>emb|CDX69959.1| BnaA10g23080D [Brassica napus]
Length=382

 Score =   491 bits (1263),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 282/383 (74%), Positives = 310/383 (81%), Gaps = 22/383 (6%)
 Frame = +3

Query  6     EKMAITLNPVVAFPANTKPSVSVFR-SLP---------CGFKSSTPNQPIRSTKSLVVRA  155
              K+A+T  P     + +  SVSV   SLP         C  K S+P           VRA
Sbjct  12    HKVALTRQPSPPVNSCSLGSVSVIGFSLPQISSPSLAKCRRKQSSPGS---------VRA  62

Query  156   SIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgd  335
              +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI I IIKTTGD
Sbjct  63    CVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRAKLQAKHPELTEDGAIHIEIIKTTGD  119

Query  336   kilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRD  515
             KILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT+LPCNL REDVRD
Sbjct  120   KILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTVLPCNLVREDVRD  179

Query  516   AFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQ  695
             AFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTRL KL  G V 
Sbjct  180   AFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLSVEENFRGNVQTRLSKLQGGKVH  239

Query  696   ATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETR  875
             ATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA+Y+ASLNHEETR
Sbjct  240   ATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMASYLASLNHEETR  299

Query  876   LAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLND  1055
             LAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGT+V+ETSRKGPY   D
Sbjct  300   LAVACERAFLETLDGSCRTPIAGYATKDEEGNCYFRGLVASPDGTKVLETSRKGPYVFED  359

Query  1056  MVLMGEDAGKELLLQAGPGFFGN  1124
             MV MG+DAG+ELL +AGPGFFGN
Sbjct  360   MVKMGKDAGQELLSRAGPGFFGN  382



>ref|XP_009122439.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Brassica 
rapa]
Length=382

 Score =   491 bits (1263),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 282/383 (74%), Positives = 311/383 (81%), Gaps = 22/383 (6%)
 Frame = +3

Query  6     EKMAITLNPVVAFPANTKPSVSVFR-SLP---------CGFKSSTPNQPIRSTKSLVVRA  155
              K+A+T  P     + +  SVSV   SLP         CG K S+ +          VRA
Sbjct  12    HKVALTRQPSPPVNSCSLGSVSVIGFSLPQISSPSLAKCGRKQSSFSS---------VRA  62

Query  156   SIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgd  335
              +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI I IIKTTGD
Sbjct  63    CVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRAKLQAKHPELTEDGAIHIEIIKTTGD  119

Query  336   kilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRD  515
             KILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT+LPCNL REDVRD
Sbjct  120   KILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTVLPCNLVREDVRD  179

Query  516   AFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQ  695
             AFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTRL KL  G V 
Sbjct  180   AFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLSVEENFRGNVQTRLSKLQGGKVH  239

Query  696   ATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETR  875
             ATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA+Y+ASLNHEETR
Sbjct  240   ATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMASYLASLNHEETR  299

Query  876   LAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLND  1055
             LAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGT+V+ETSRKGPY   D
Sbjct  300   LAVACERAFLETLDGSCRTPIAGYAAKDEEGNCYFRGLVASPDGTKVLETSRKGPYVFED  359

Query  1056  MVLMGEDAGKELLLQAGPGFFGN  1124
             MV MG+DAG+ELL +AGPGFFGN
Sbjct  360   MVKMGKDAGQELLSRAGPGFFGN  382



>emb|CDY21529.1| BnaC09g47630D [Brassica napus]
Length=382

 Score =   490 bits (1262),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 279/374 (75%), Positives = 306/374 (82%), Gaps = 4/374 (1%)
 Frame = +3

Query  6     EKMAITLNPVVAFPANTKPSVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQ  182
              K+A+T  P     + +  SVSV   SLP     S      + +    VRA +AVEQ   
Sbjct  12    HKVALTRQPSPPVNSCSLGSVSVIGFSLPQISSPSLAKCRRKQSSFSSVRACVAVEQ---  68

Query  183   KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLAD  362
             KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI I IIKTTGDKILSQPLAD
Sbjct  69    KTRTAIIRIGTRGSPLALAQAYETRAKLQAKHPELTEDGAIHIEIIKTTGDKILSQPLAD  128

Query  363   IGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaas  542
             IGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT LPCNL REDVRDAFI L+AAS
Sbjct  129   IGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTFLPCNLVREDVRDAFICLTAAS  188

Query  543   ladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL  722
             LA+LPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTRL KL  G V ATLLALAGL
Sbjct  189   LAELPAGSVVGTASLRRKSQILHKYPSLSVEENFRGNVQTRLSKLQGGKVHATLLALAGL  248

Query  723   KRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAF  902
             KRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMANY+ASLNHEETRLAV CERAF
Sbjct  249   KRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMANYLASLNHEETRLAVACERAF  308

Query  903   LTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             L TLDGSCRTPIAGYA + E+G C F+GLVASPDGT+V+ETSRKGPY   DMV MG+DAG
Sbjct  309   LETLDGSCRTPIAGYAAKDEEGSCYFRGLVASPDGTKVLETSRKGPYVFEDMVKMGKDAG  368

Query  1083  KELLLQAGPGFFGN  1124
             +ELL +AGPGFFGN
Sbjct  369   QELLSRAGPGFFGN  382



>ref|XP_010670537.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=366

 Score =   489 bits (1260),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 266/331 (80%), Positives = 299/331 (90%), Gaps = 0/331 (0%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             R  + ++ +ASIAVEQ+  + KVA++RIGTRGSPLALAQAYETR KL+A+H ELAEEGAI
Sbjct  33    RQQRLMLTKASIAVEQKTPQNKVALVRIGTRGSPLALAQAYETRSKLIAAHEELAEEGAI  92

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             EI+IIKTTGDKIL+QPLADIGGKGLFTKEIDEAL+N +IDIAVHSMKDVPTYLPDK ILP
Sbjct  93    EIVIIKTTGDKILTQPLADIGGKGLFTKEIDEALLNNDIDIAVHSMKDVPTYLPDKIILP  152

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNL REDVRDAFIS +AAS+ADLPAGS VGTASLRRKSQ+LHRYPSL VL+NFRGNVQTR
Sbjct  153   CNLEREDVRDAFISTTAASVADLPAGSIVGTASLRRKSQLLHRYPSLSVLDNFRGNVQTR  212

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             LRKLNEG+ QATLLALAGLKRL+MTE VTS+L I+DMLPAVAQGAIGIAC ++D+KM NY
Sbjct  213   LRKLNEGLCQATLLALAGLKRLNMTETVTSVLSIDDMLPAVAQGAIGIACLNNDDKMVNY  272

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA R E+GDC F+GLVAS DG +VIET
Sbjct  273   LASLNHEETRLAVACERAFLETLDGSCRTPIAGYACRDENGDCFFRGLVASTDGKQVIET  332

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             SR+G Y  +DMV MG+DAGKELL +AGPGFF
Sbjct  333   SRRGSYAFDDMVSMGKDAGKELLSRAGPGFF  363



>gb|AAM64573.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
Length=382

 Score =   490 bits (1261),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 265/333 (80%), Positives = 294/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + + S  V+A +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KL   HPEL E+GAI
Sbjct  53    KQSSSGFVKACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLKKKHPELVEDGAI  109

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMK VPTYLP+KTILP
Sbjct  110   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKYVPTYLPEKTILP  169

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPREDVRDAFI L+AA+LA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTR
Sbjct  170   CNLPREDVRDAFICLTAATLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTR  229

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G VQATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y
Sbjct  230   LSKLQGGKVQATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATY  289

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLA+ CERAFL TLDGSCRTPIAGYA + E+G+CIF+GLVASPDGT+V+ET
Sbjct  290   LASLNHEETRLAISCERAFLETLDGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLET  349

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  350   SRKGPYVYEDMVKMGKDAGQELLSRAGPGFFGN  382



>emb|CDY44763.1| BnaC02g01240D [Brassica napus]
Length=380

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 268/326 (82%), Positives = 290/326 (89%), Gaps = 3/326 (1%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             VRA +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI I IIKT
Sbjct  58    VRACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRAKLQAIHPELTEDGAIHIEIIKT  114

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT+LPCNL RED
Sbjct  115   TGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTVLPCNLVRED  174

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRDAFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTRL KL  G
Sbjct  175   VRDAFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLAVEENFRGNVQTRLSKLQGG  234

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
              V ATLLALAGLKRL MTENV S+L +++MLPAVAQGAIGIACR+DD+KMANY+ASLNHE
Sbjct  235   KVHATLLALAGLKRLSMTENVASVLSLDEMLPAVAQGAIGIACRTDDDKMANYLASLNHE  294

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGTRV+ETSRKGPY 
Sbjct  295   ETRLAVACERAFLETLDGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYV  354

Query  1047  LNDMVLMGEDAGKELLLQAGPGFFGN  1124
               DMV MG+DAG+ELL +AGPGFFGN
Sbjct  355   FEDMVKMGKDAGQELLSRAGPGFFGN  380



>gb|EYU33770.1| hypothetical protein MIMGU_mgv1a008233mg [Erythranthe guttata]
Length=380

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 277/380 (73%), Positives = 315/380 (83%), Gaps = 10/380 (3%)
 Frame = +3

Query  3     MEKMAITLNPVVAFPA-NTKPSVSVFRS---LPCGFKSSTPNQP----IRSTKSLVVRAS  158
             ME    +++   AF    T+P  S F +      GF S     P    +RS  S   RAS
Sbjct  1     METAIASVSQAAAFAGVKTRPLSSYFTAGSVSALGFSSPGNKSPAFFALRSRVS-AARAS  59

Query  159   IAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdk  338
             ++VE++ + TK A+IRIGTRGSPLALAQAYETR KL+ SHP+LAEEGAI+I+IIKTTGDK
Sbjct  60    VSVEEKIE-TKTAVIRIGTRGSPLALAQAYETRAKLIESHPDLAEEGAIQIVIIKTTGDK  118

Query  339   ilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDA  518
             ILSQPLADIGGKGLFTKEIDEALIN+EIDIAVHSMKDVPTYLP+KTILPCNLPREDVRDA
Sbjct  119   ILSQPLADIGGKGLFTKEIDEALINSEIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDA  178

Query  519   FIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQA  698
             FI L+AAS+A+LPAGS VGTASLRRKSQ+L+RYP+L VLENFRGNVQTRLRKLNEGVVQA
Sbjct  179   FICLTAASVAELPAGSIVGTASLRRKSQLLNRYPNLSVLENFRGNVQTRLRKLNEGVVQA  238

Query  699   TLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRL  878
             TLLALAGLKRL+M E VTS+L I+DMLPAVAQGAIGIACR DDEKM  Y+ASLNHE+TRL
Sbjct  239   TLLALAGLKRLNMIETVTSVLSIDDMLPAVAQGAIGIACRRDDEKMVKYLASLNHEDTRL  298

Query  879   AVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDM  1058
             A+ CERAFL  L+GSCRTPIAGYARR  DG+CIFK L+ASPDGT V+ET R+G Y   DM
Sbjct  299   AISCERAFLEKLEGSCRTPIAGYARRDADGNCIFKALIASPDGTEVLETYREGQYVYEDM  358

Query  1059  VLMGEDAGKELLLQAGPGFF  1118
             + MG DAG+ELL +AGPGFF
Sbjct  359   MKMGVDAGEELLTRAGPGFF  378



>ref|XP_010423118.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Camelina 
sativa]
Length=384

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 280/377 (74%), Positives = 310/377 (82%), Gaps = 8/377 (2%)
 Frame = +3

Query  6     EKMAITLNPVVAFPANTKPSVSVFR-SLPCGFKSSTPNQPIR---STKSLVVRASIAVEQ  173
              K+ +T  P     + +  SVS    SLP    S   NQ  R   S+ S  V+A +AVEQ
Sbjct  12    HKVVLTRQPASRVNSCSLGSVSAIGFSLP-QISSPALNQCRRKQSSSSSGFVKACVAVEQ  70

Query  174   QAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQP  353
                KT+ AIIRIGTRGSPLALAQAYETR+KL + HPEL EEGAI I IIKTTGDKILSQP
Sbjct  71    ---KTRTAIIRIGTRGSPLALAQAYETREKLKSKHPELVEEGAIHIEIIKTTGDKILSQP  127

Query  354   LADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsls  533
             LADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILPCNL REDVRDAFI L+
Sbjct  128   LADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPCNLVREDVRDAFICLT  187

Query  534   aasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLAL  713
             AASLA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTRL KL  G V ATLLAL
Sbjct  188   AASLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTRLSKLQGGKVHATLLAL  247

Query  714   AGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCE  893
             AGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y+ASLNHEETRLAV CE
Sbjct  248   AGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYLASLNHEETRLAVSCE  307

Query  894   RAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGE  1073
             RAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGT+V+ETSRKGPY   DMV MG+
Sbjct  308   RAFLETLDGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKVLETSRKGPYVYEDMVKMGK  367

Query  1074  DAGKELLLQAGPGFFGN  1124
             DAG+ELL +AGPGFFGN
Sbjct  368   DAGQELLSRAGPGFFGN  384



>gb|ERN14810.1| hypothetical protein AMTR_s00032p00091590 [Amborella trichopoda]
Length=442

 Score =   492 bits (1266),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 281/357 (79%), Positives = 314/357 (88%), Gaps = 6/357 (2%)
 Frame = +3

Query  60    PSVSVFRSLPCGFKSSTP--NQPIRST--KSLVVRASIAVEQQAQKTKVAIIRIGTRGSP  227
             PSV +  +   GF S  P    P+ S   K LV RA++AVE Q Q TKV+++RIGTRGSP
Sbjct  14    PSVPMAPASVSGFGSCPPCLKYPLTSHGRKLLVPRAAVAVENQPQ-TKVSLVRIGTRGSP  72

Query  228   LALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEAL  407
             LALAQAYETRDKL A+H ELAE+GAI+IIIIKTTGDKIL+QPLADIGGKGLFTKEIDEAL
Sbjct  73    LALAQAYETRDKLKATHSELAEDGAIDIIIIKTTGDKILNQPLADIGGKGLFTKEIDEAL  132

Query  408   INAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASL  587
             + AEIDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A+SLA+LPAGS VG+ASL
Sbjct  133   LKAEIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLAELPAGSVVGSASL  192

Query  588   RRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPI  767
             RR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG VQATLLALAGLKRLDMTE+VTSIL I
Sbjct  193   RRQSQILYRYPSLKVI-NFRGNVQTRLRKLGEGEVQATLLALAGLKRLDMTEDVTSILSI  251

Query  768   EDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGY  947
             E+MLPA+AQGAIGIACR++D+KMANYIASLNHEETRLAV CERAFL TLDGSCRTPIAGY
Sbjct  252   EEMLPAIAQGAIGIACRTNDDKMANYIASLNHEETRLAVTCERAFLETLDGSCRTPIAGY  311

Query  948   ARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             A R +DG CIF+GLVASPDGTRV+ETSRKG Y + DMV MG+DAGKELL +AGP FF
Sbjct  312   AHRDKDGYCIFRGLVASPDGTRVLETSRKGNYDIEDMVEMGKDAGKELLSRAGPSFF  368



>emb|CDY40758.1| BnaAnng06210D [Brassica napus]
Length=380

 Score =   489 bits (1259),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 268/333 (80%), Positives = 292/333 (88%), Gaps = 3/333 (1%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             + T S  VRA +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL E+GAI
Sbjct  51    KGTSSGFVRACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETRSKLQAIHPELTEDGAI  107

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
              I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KT+LP
Sbjct  108   HIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTVLP  167

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNL REDVRDAFI L+AASLADLPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTR
Sbjct  168   CNLVREDVRDAFICLTAASLADLPAGSVVGTASLRRKSQILHKYPSLTVEENFRGNVQTR  227

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             L KL  G V ATLLALAGLKRL MTENV S+L +++MLPAVAQGAIGIACR+DD+KMA+Y
Sbjct  228   LSKLQGGKVHATLLALAGLKRLSMTENVASVLSLDEMLPAVAQGAIGIACRTDDDKMASY  287

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDG RV+ET
Sbjct  288   LASLNHEETRLAVACERAFLETLDGSCRTPIAGYAAKDEEGNCFFRGLVASPDGIRVLET  347

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             SRKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  348   SRKGPYVFEDMVKMGKDAGQELLSRAGPGFFGN  380



>pdb|4HTG|A Chain A, Porphobilinogen Deaminase From Arabidopsis Thaliana
Length=320

 Score =   486 bits (1252),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 263/322 (82%), Positives = 289/322 (90%), Gaps = 3/322 (1%)
 Frame = +3

Query  159   IAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdk  338
             +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KL   HPEL E+GAI I IIKTTGDK
Sbjct  2     VAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLKKKHPELVEDGAIHIEIIKTTGDK  58

Query  339   ilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDA  518
             ILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILPCNLPREDVRDA
Sbjct  59    ILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDA  118

Query  519   FIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQA  698
             FI L+AA+LA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTRL KL  G VQA
Sbjct  119   FICLTAATLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTRLSKLQGGKVQA  178

Query  699   TLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRL  878
             TLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y+ASLNHEETRL
Sbjct  179   TLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYLASLNHEETRL  238

Query  879   AVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDM  1058
             A+ CERAFL TLDGSCRTPIAGYA + E+G+CIF+GLVASPDGT+V+ETSRKGPY   DM
Sbjct  239   AISCERAFLETLDGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDM  298

Query  1059  VLMGEDAGKELLLQAGPGFFGN  1124
             V MG+DAG+ELL +AGPGFFGN
Sbjct  299   VKMGKDAGQELLSRAGPGFFGN  320



>ref|XP_010491454.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Camelina 
sativa]
Length=384

 Score =   489 bits (1258),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 293/332 (88%), Gaps = 3/332 (1%)
 Frame = +3

Query  129   STKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaie  308
             S+ S  V+A +AVEQ   KT+ AIIRIGTRGSPLALAQAYETR+KL + HPEL EEGAI 
Sbjct  56    SSSSGFVKACVAVEQ---KTRTAIIRIGTRGSPLALAQAYETREKLKSKHPELVEEGAIH  112

Query  309   iiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPC  488
             I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILPC
Sbjct  113   IEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPC  172

Query  489   NLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRL  668
             NL REDVRDAFI L+AASLA+LPAGS VGTASLRRKSQILH+YP+L V ENFRGNVQTRL
Sbjct  173   NLVREDVRDAFICLTAASLAELPAGSVVGTASLRRKSQILHKYPALHVEENFRGNVQTRL  232

Query  669   RKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYI  848
              KL  G V ATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGIACR+DD+KMA Y+
Sbjct  233   SKLQGGKVHATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYL  292

Query  849   ASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETS  1028
             ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGT+V+ETS
Sbjct  293   ASLNHEETRLAVSCERAFLETLDGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKVLETS  352

Query  1029  RKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             RKGPY   DMV MG+DAG+ELL +AGPGFFGN
Sbjct  353   RKGPYVYEDMVKMGKDAGQELLSRAGPGFFGN  384



>emb|CDX81090.1| BnaC03g03440D [Brassica napus]
Length=378

 Score =   488 bits (1255),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 266/327 (81%), Positives = 289/327 (88%), Gaps = 3/327 (1%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             VVRA +AVE+   KT+ AIIRIGTRGSPLALAQAYETR KL A HPEL  EGAI I IIK
Sbjct  55    VVRACVAVEE---KTRTAIIRIGTRGSPLALAQAYETRAKLQAKHPELTSEGAIHIEIIK  111

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKDVPTYLP+KTILPCNL RE
Sbjct  112   TTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPCNLVRE  171

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFI L+AASLA+LPAGS VGTASLRRKSQILH+YPSL V ENFRGNVQTRL KL  
Sbjct  172   DVRDAFICLTAASLAELPAGSVVGTASLRRKSQILHKYPSLAVEENFRGNVQTRLSKLQG  231

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             G V ATLLALAGLKRL MTENV S+L +++MLPAVAQGAIGIACR++D+KMA+Y+ASLNH
Sbjct  232   GKVHATLLALAGLKRLSMTENVASVLSLDEMLPAVAQGAIGIACRTEDDKMASYLASLNH  291

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GLVASPDGTRV+ETSRKGPY
Sbjct  292   EETRLAVACERAFLETLDGSCRTPIAGYAAKDEEGNCYFRGLVASPDGTRVLETSRKGPY  351

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFFGN  1124
                DMV MG+DAG+ELL  AGPGFFGN
Sbjct  352   VFEDMVKMGKDAGQELLSLAGPGFFGN  378



>ref|XP_009131051.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Brassica 
rapa]
Length=379

 Score =   486 bits (1251),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 275/363 (76%), Positives = 303/363 (83%), Gaps = 7/363 (2%)
 Frame = +3

Query  39    AFPANTKPSVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGT  215
             +FP N   SVSV   SLP     S      + + S  VRA +A+E+   K + AIIRIGT
Sbjct  23    SFPVN---SVSVIGFSLPQVTSPSLEKCRRKRSSSGFVRACVAMEE---KKRTAIIRIGT  76

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             RGSPLALAQAYETR KL A HPEL E+GAI I IIKTTGDKILSQPLADIGGKGLFTKEI
Sbjct  77    RGSPLALAQAYETRAKLQAKHPELTEDGAIHIEIIKTTGDKILSQPLADIGGKGLFTKEI  136

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             DEALIN  IDIAVHSMKDVPTYLP+KTILPCNL REDVRDAFI L+AASLA+LPAGS VG
Sbjct  137   DEALINGHIDIAVHSMKDVPTYLPEKTILPCNLVREDVRDAFICLTAASLAELPAGSVVG  196

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             TASLRRKSQILH+YPSL V ENFRGNVQTRL KL  G V ATLLALAGLKRL MTENV S
Sbjct  197   TASLRRKSQILHKYPSLAVEENFRGNVQTRLSKLQGGKVHATLLALAGLKRLSMTENVAS  256

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             +L +++MLPAVAQGAIGIACR++D+KMA+Y+ASLNHEETRLAV CERAFL TLDGSCRTP
Sbjct  257   VLSLDEMLPAVAQGAIGIACRTEDDKMASYLASLNHEETRLAVACERAFLETLDGSCRTP  316

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IAGYA + E+G+C F+GLVASPDGTRV+ETSRKGPY   DMV MG+DAG+ELL  AGPGF
Sbjct  317   IAGYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELLSLAGPGF  376

Query  1116  FGN  1124
             FGN
Sbjct  377   FGN  379



>emb|CDX78330.1| BnaA03g02420D [Brassica napus]
Length=379

 Score =   484 bits (1247),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 273/361 (76%), Positives = 302/361 (84%), Gaps = 4/361 (1%)
 Frame = +3

Query  45    PANTKPSVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRG  221
             P++   SVSV   SLP     S      + + +  VRA +AVE+   K + AIIRIGTRG
Sbjct  22    PSSPVNSVSVIGFSLPRITSPSLAKYRRKGSSTGFVRACVAVEE---KKRTAIIRIGTRG  78

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQAYETR KL A HPEL E+GAI I IIKTTGDKILSQPLADIGGKGLFTKEIDE
Sbjct  79    SPLALAQAYETRAKLQAKHPELTEDGAIHIEIIKTTGDKILSQPLADIGGKGLFTKEIDE  138

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             ALIN  IDIAVHSMKDVPTYLP+KTILPCNL REDVRDAFI L+AASLA+LPAGS VGTA
Sbjct  139   ALINGHIDIAVHSMKDVPTYLPEKTILPCNLVREDVRDAFICLTAASLAELPAGSVVGTA  198

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRRKSQILH+YPSL V ENFRGNVQTRL KL  G V ATLLALAGLKRL MTENV S+L
Sbjct  199   SLRRKSQILHKYPSLAVEENFRGNVQTRLSKLQGGKVHATLLALAGLKRLSMTENVASVL  258

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
              +++MLPAVAQGAIGIACR++D+KMA+Y+ASLNHEETRLAV CERAFL TLDGSCRTPIA
Sbjct  259   SLDEMLPAVAQGAIGIACRTEDDKMASYLASLNHEETRLAVACERAFLETLDGSCRTPIA  318

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFG  1121
             GYA + E+G+C F+GLVASPDGTRV+ETSRKGPY   DMV MG+DAG+ELL  AGPGFFG
Sbjct  319   GYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELLSLAGPGFFG  378

Query  1122  N  1124
             N
Sbjct  379   N  379



>ref|XP_010547710.1| PREDICTED: LOW QUALITY PROTEIN: porphobilinogen deaminase, chloroplastic-like 
[Tarenaya hassleriana]
Length=379

 Score =   484 bits (1247),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 286/382 (75%), Positives = 317/382 (83%), Gaps = 18/382 (5%)
 Frame = +3

Query  12    MAITLNPVVAFPANTKPSVSVFRSLPC-------GFK----SSTPNQPIRSTKSL-VVRA  155
             ++ +L+P      ++KPS +V  +L C       GF     SS P+   R ++S  V+RA
Sbjct  3     VSCSLSPTHQIALSSKPSATV--NLSCLGSASVLGFSLPHLSSPPSNRCRRSRSSGVIRA  60

Query  156   SIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgd  335
             S+AVE    KT+ AIIRIGTRGSPLALAQAYETRDKL + HPEL EEGAI I IIKTTGD
Sbjct  61    SVAVEH---KTQSAIIRIGTRGSPLALAQAYETRDKLKSMHPELTEEGAIHIEIIKTTGD  117

Query  336   kilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRD  515
             KIL+QPLADIGGKGLFTKEI  ALI+  IDIAVHSMKDVPTYLPDKTILPCNL REDVRD
Sbjct  118   KILTQPLADIGGKGLFTKEI-XALIDGRIDIAVHSMKDVPTYLPDKTILPCNLEREDVRD  176

Query  516   AFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQ  695
             AFI LSAASLA+LPAGS VGTASLRRKSQIL+RYP+LKV ENFRGNVQTRL KL  G VQ
Sbjct  177   AFICLSAASLAELPAGSIVGTASLRRKSQILYRYPALKVEENFRGNVQTRLSKLQGGKVQ  236

Query  696   ATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETR  875
             ATLLALAGLKRL+MTENVTSIL I++MLPAVAQGAIGIACRSDD+KM NY+ASLNHE TR
Sbjct  237   ATLLALAGLKRLNMTENVTSILSIDEMLPAVAQGAIGIACRSDDDKMENYLASLNHEGTR  296

Query  876   LAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLND  1055
             LAV CERAFL TLDGSCRTPIAGYA R EDG+CIFKGLVASPDG RV+ETSRKGPY   D
Sbjct  297   LAVACERAFLETLDGSCRTPIAGYASRDEDGNCIFKGLVASPDGRRVLETSRKGPYAYED  356

Query  1056  MVLMGEDAGKELLLQAGPGFFG  1121
             MV MG++AG+ELL +AGPGFFG
Sbjct  357   MVRMGKEAGQELLSRAGPGFFG  378



>ref|XP_007043279.1| Hydroxymethylbilane synthase isoform 1 [Theobroma cacao]
 gb|EOX99110.1| Hydroxymethylbilane synthase isoform 1 [Theobroma cacao]
Length=371

 Score =   482 bits (1241),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 6/325 (2%)
 Frame = +3

Query  144   VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
             V++AS+A      KT+VA++RIGTRGSPLALAQA+ETRDKLMASHPELAEEGAI+I+IIK
Sbjct  51    VIKASVA------KTEVALLRIGTRGSPLALAQAHETRDKLMASHPELAEEGAIKIVIIK  104

Query  324   ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
             TTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNL RE
Sbjct  105   TTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLLRE  164

Query  504   DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
             DVRDAFISLSA+SLA+LPAGS VGTASLRRKSQILHRYPSLKV ENFRGNVQTRLRKLNE
Sbjct  165   DVRDAFISLSASSLAELPAGSVVGTASLRRKSQILHRYPSLKVEENFRGNVQTRLRKLNE  224

Query  684   GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
             GVVQATLLALAGL+RL MTENVTS+L I++MLPAVAQGAIGIACRS+DEKMANY+ASLNH
Sbjct  225   GVVQATLLALAGLRRLSMTENVTSVLSIDEMLPAVAQGAIGIACRSNDEKMANYLASLNH  284

Query  864   EETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPY  1043
             EETRL V CERAFL TLDGSCRTPIAG A + EDG+C+FKGLVASPDG RV+ETSRKG Y
Sbjct  285   EETRLTVACERAFLETLDGSCRTPIAGNAYKDEDGNCVFKGLVASPDGKRVLETSRKGQY  344

Query  1044  TLNDMVLMGEDAGKELLLQAGPGFF  1118
                DMV+MG+DAGKELL +AGPGFF
Sbjct  345   AFEDMVMMGKDAGKELLSRAGPGFF  369



>gb|KHG03036.1| Porphobilinogen deaminase, chloroplastic [Gossypium arboreum]
Length=371

 Score =   482 bits (1240),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 274/319 (86%), Positives = 297/319 (93%), Gaps = 0/319 (0%)
 Frame = +3

Query  162   AVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdki  341
             A++    KT+VA++RIGTRGSPLALAQA+ETRDKLMASHPELAEEGAIEI++IKTTGDKI
Sbjct  51    AIKASLAKTEVALLRIGTRGSPLALAQAHETRDKLMASHPELAEEGAIEIVVIKTTGDKI  110

Query  342   lSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAF  521
             LSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNL REDVRDAF
Sbjct  111   LSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLKREDVRDAF  170

Query  522   IslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQAT  701
             ISLSA+SLA+LPAGS VGTASLRRKSQILHRYPSLKV +NFRGNVQTRLRKLNEGVVQAT
Sbjct  171   ISLSASSLAELPAGSVVGTASLRRKSQILHRYPSLKVEDNFRGNVQTRLRKLNEGVVQAT  230

Query  702   LLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLA  881
             LLALAGL+RL MTENVTS L I++MLPAVAQGAIGIACRSDDEKMANY+ASLNHEETRLA
Sbjct  231   LLALAGLRRLSMTENVTSTLSIDEMLPAVAQGAIGIACRSDDEKMANYLASLNHEETRLA  290

Query  882   VVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMV  1061
             V CERAFL TLDGSCRTPIAGYA + +D +CIFKGLVASPDGTRV+ETSRKG Y   DMV
Sbjct  291   VSCERAFLETLDGSCRTPIAGYASKDKDCNCIFKGLVASPDGTRVLETSRKGSYHFEDMV  350

Query  1062  LMGEDAGKELLLQAGPGFF  1118
              MG+DAGKELL +AGPGFF
Sbjct  351   SMGKDAGKELLSRAGPGFF  369



>gb|KJB77369.1| hypothetical protein B456_012G134300 [Gossypium raimondii]
Length=371

 Score =   481 bits (1237),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 273/319 (86%), Positives = 297/319 (93%), Gaps = 0/319 (0%)
 Frame = +3

Query  162   AVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdki  341
             A++    KT+VA++RIGTRGSPLALAQA+ETR+KLMASHPELAEEGAIEI++IKTTGDKI
Sbjct  51    AIKASLAKTEVALLRIGTRGSPLALAQAHETRNKLMASHPELAEEGAIEIVVIKTTGDKI  110

Query  342   lSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAF  521
             LSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNL REDVRDAF
Sbjct  111   LSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLKREDVRDAF  170

Query  522   IslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQAT  701
             ISLSA+SLA+LPAGS VGTASLRRKSQILHRYPSLKV +NFRGNVQTRLRKLNEGVVQAT
Sbjct  171   ISLSASSLAELPAGSVVGTASLRRKSQILHRYPSLKVEDNFRGNVQTRLRKLNEGVVQAT  230

Query  702   LLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLA  881
             LLALAGL+RL MTE VTS L I++MLPAVAQGAIGIACRSDDEKMA+Y+ASLNHEETRLA
Sbjct  231   LLALAGLRRLSMTEKVTSTLSIDEMLPAVAQGAIGIACRSDDEKMASYLASLNHEETRLA  290

Query  882   VVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMV  1061
             V CERAFL TLDGSCRTPIAGYA + EDG+CIFKGLVASPDGTRV+ETSRKG Y   DMV
Sbjct  291   VSCERAFLLTLDGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGSYHFEDMV  350

Query  1062  LMGEDAGKELLLQAGPGFF  1118
              MG+DAGKELL +AGPGFF
Sbjct  351   SMGKDAGKELLSRAGPGFF  369



>ref|XP_008793588.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=363

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 275/366 (75%), Positives = 315/366 (86%), Gaps = 9/366 (2%)
 Frame = +3

Query  21    TLNPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAI  200
             T  P++  PAN +P      SL  G     P       +++VVRA++AVEQ+A KTKV++
Sbjct  5     THQPLITAPANLRPGRRSASSL--GLPPRCPG-----RRAMVVRAAVAVEQEA-KTKVSL  56

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQAYETRDKLMA+H +LAE+GAIEIIIIKTTGDKIL+QPLADIGGKGL
Sbjct  57    VRIGTRGSPLALAQAYETRDKLMAAHSDLAEDGAIEIIIIKTTGDKILNQPLADIGGKGL  116

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L+A SL++LPA
Sbjct  117   FTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICLTAKSLSELPA  176

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KLNEG VQAT+LALAGLKRL MT
Sbjct  177   GSFVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLNEGEVQATMLALAGLKRLHMT  235

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             ENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYI+ LNHEETRLAV CERAFL TLDG
Sbjct  236   ENVTALLSVEEMLPAIAQGAIGIACRSNDEKMANYISLLNHEETRLAVACERAFLETLDG  295

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAGYA R  DG C+F+GLVASPDGTRV+ETSRKG Y L DMV +G+DAGKELL +
Sbjct  296   SCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELLSR  355

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  356   AGPGFF  361



>ref|XP_009414508.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 270/368 (73%), Positives = 310/368 (84%), Gaps = 11/368 (3%)
 Frame = +3

Query  21    TLNPVVAFPANT--KPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKV  194
             T +P++  P N   +P  +    LP G +        R  +  +V  +  V +Q  KTK+
Sbjct  5     THHPLITAPCNLWPRPRPTSAPVLPSGSR--------RPRRGALVVRAAVVVEQEVKTKI  56

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             +++RIGTRGSPLALAQAYETRDKLMASH ELAEEGAI+I+IIKTTGDKIL+QPLADIGGK
Sbjct  57    SLVRIGTRGSPLALAQAYETRDKLMASHSELAEEGAIDIVIIKTTGDKILNQPLADIGGK  116

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEIDEAL+   IDIAVHSMKDVPTYLPD TILPCNLPREDVRDAFI L+A SLA+L
Sbjct  117   GLFTKEIDEALLEGSIDIAVHSMKDVPTYLPDGTILPCNLPREDVRDAFICLTAKSLAEL  176

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             PAGS +GTASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KLNEG VQATLLALAGLKRL+
Sbjct  177   PAGSVIGTASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLNEGEVQATLLALAGLKRLN  235

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             MTENVT+IL IE+MLPA+AQGAIGIACRS+D+ MANYIASLNH++TRLAV CERAFL TL
Sbjct  236   MTENVTAILSIEEMLPAIAQGAIGIACRSNDDTMANYIASLNHDDTRLAVACERAFLETL  295

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSCRTPIAGYA R  DG+C+ + LVASPDGTRV+ETSRKG Y L+DMV MG+DAGKELL
Sbjct  296   DGSCRTPIAGYAYRDSDGNCVLRCLVASPDGTRVLETSRKGLYALDDMVAMGKDAGKELL  355

Query  1095  LQAGPGFF  1118
              +AGP FF
Sbjct  356   SKAGPSFF  363



>ref|XP_008813288.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=363

 Score =   475 bits (1222),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 256/312 (82%), Positives = 287/312 (92%), Gaps = 1/312 (0%)
 Frame = +3

Query  183   KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLAD  362
             KTKV+++RIGTRGSPLALAQAYETRDKLMA+H ELA++GAI+IIIIKTTGDKILSQPLAD
Sbjct  51    KTKVSLVRIGTRGSPLALAQAYETRDKLMAAHSELADDGAIKIIIIKTTGDKILSQPLAD  110

Query  363   IGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaas  542
             IGGKGLFTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L+A S
Sbjct  111   IGGKGLFTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICLTANS  170

Query  543   ladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL  722
             L++LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KLNEG VQAT+LALAGL
Sbjct  171   LSELPAGSIVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLNEGEVQATMLALAGL  229

Query  723   KRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAF  902
             KRL MTENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYIASLNHEETRLAV CERAF
Sbjct  230   KRLHMTENVTALLSVEEMLPAIAQGAIGIACRSNDEKMANYIASLNHEETRLAVACERAF  289

Query  903   LTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             L TLDGSCRTPIAGYA R +DG C+F+GLVASPDGTRV+E SRKG Y L +MV MG+DAG
Sbjct  290   LETLDGSCRTPIAGYAYRDKDGYCVFRGLVASPDGTRVLEASRKGSYALEEMVSMGKDAG  349

Query  1083  KELLLQAGPGFF  1118
             KELL +AGPGF 
Sbjct  350   KELLSRAGPGFL  361



>ref|XP_002306378.2| hypothetical protein POPTR_0005s09400g, partial [Populus trichocarpa]
 gb|EEE93374.2| hypothetical protein POPTR_0005s09400g, partial [Populus trichocarpa]
Length=358

 Score =   474 bits (1221),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 259/294 (88%), Positives = 278/294 (95%), Gaps = 0/294 (0%)
 Frame = +3

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQA+ETRDKLMASH ELAE+GAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDE
Sbjct  4     SPLALAQAHETRDKLMASHAELAEDGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDE  63

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             ALIN +IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFIS+SA SLADLPAGS VGTA
Sbjct  64    ALINGDIDIAVHSMKDVPTYLPEMTILPCNLPREDVRDAFISMSATSLADLPAGSIVGTA  123

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRRKSQILHR+PSL V ENFRGNVQTRLRKLNEGVV+ATLLALAGLKRL+MTENVTSIL
Sbjct  124   SLRRKSQILHRFPSLSVEENFRGNVQTRLRKLNEGVVKATLLALAGLKRLNMTENVTSIL  183

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
             PI+DMLPAVAQGAIGIACR  D+KMANY+ASLNHEETRLAV CERAFL TLDGSCRTPIA
Sbjct  184   PIDDMLPAVAQGAIGIACRDSDDKMANYLASLNHEETRLAVACERAFLETLDGSCRTPIA  243

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQA  1103
             GYARR E+GDCIFKGLVASPDGTRV++TSRKGPY  +DM+ MG+DAGKELL QA
Sbjct  244   GYARRDENGDCIFKGLVASPDGTRVLKTSRKGPYAFDDMIAMGKDAGKELLSQA  297



>ref|XP_008793587.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=363

 Score =   473 bits (1217),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 274/366 (75%), Positives = 313/366 (86%), Gaps = 9/366 (2%)
 Frame = +3

Query  21    TLNPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAI  200
             T  P++  PAN +P      SL  G     P       +++VVRA++AVEQ+A KTKV++
Sbjct  5     THQPLITAPANLRPGRRSASSL--GLPPRCPG-----RRAMVVRAAVAVEQEA-KTKVSL  56

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQAYETRDKLMA+H +LAE+GAIEIIIIKTTGDKIL+QPLADIGGKGL
Sbjct  57    VRIGTRGSPLALAQAYETRDKLMAAHSDLAEDGAIEIIIIKTTGDKILNQPLADIGGKGL  116

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L+A SL++LPA
Sbjct  117   FTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICLTAKSLSELPA  176

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KL EG VQATLLALAGLKRL M 
Sbjct  177   GSFVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLKEGEVQATLLALAGLKRLKMM  235

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             ENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYI+ LNHEETRLAV CERAFL TLDG
Sbjct  236   ENVTAVLSVEEMLPAIAQGAIGIACRSNDEKMANYISLLNHEETRLAVACERAFLETLDG  295

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAGYA R  DG C+F+GLVASPDGTRV+ETSRKG Y L DMV +G+DAGKELL +
Sbjct  296   SCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELLSR  355

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  356   AGPGFF  361



>ref|XP_010927101.1| PREDICTED: LOW QUALITY PROTEIN: porphobilinogen deaminase, chloroplastic-like 
[Elaeis guineensis]
Length=365

 Score =   472 bits (1215),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 280/376 (74%), Positives = 317/376 (84%), Gaps = 17/376 (5%)
 Frame = +3

Query  3     MEKMAITLNPVVAFPANT----KPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVE  170
             M   A    P+V  PAN     KP+ S  R LP    S +P       +++VVRA++AVE
Sbjct  1     MAMRAAAHQPLVTAPANLRHRRKPASS--RGLP----SRSP-----RRRAVVVRATVAVE  49

Query  171   QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
             ++A KTKV+++RIGTRGSPLALAQAYETRDKLMA+H EL E+GAIEIIIIKTTGDKILSQ
Sbjct  50    KEA-KTKVSLVRIGTRGSPLALAQAYETRDKLMAAHSELTEDGAIEIIIIKTTGDKILSQ  108

Query  351   PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
             PLADIGGKGLFTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L
Sbjct  109   PLADIGGKGLFTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICL  168

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
             +A SL++LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KLN G VQATLLA
Sbjct  169   TAKSLSELPAGSVVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLNXGEVQATLLA  227

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             LAGLKRL MTENVT++L +E+MLPA+AQGAIGIACRS+DE MANYIASLNHEETRLAV C
Sbjct  228   LAGLKRLLMTENVTALLSVEEMLPAIAQGAIGIACRSNDETMANYIASLNHEETRLAVAC  287

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             ERAFL TLDGSCRTPIAGYA R  DG C F+GLVASPDGTRV+ETSRKG Y  ++MV MG
Sbjct  288   ERAFLETLDGSCRTPIAGYAYRDMDGYCAFRGLVASPDGTRVLETSRKGSYAFDEMVSMG  347

Query  1071  EDAGKELLLQAGPGFF  1118
             +DAGKELL +AGPGFF
Sbjct  348   KDAGKELLSRAGPGFF  363



>ref|XP_010941629.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Elaeis 
guineensis]
Length=363

 Score =   471 bits (1213),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 257/316 (81%), Positives = 289/316 (91%), Gaps = 1/316 (0%)
 Frame = +3

Query  171   QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
             +Q  KTKV+++RIGTRGSPLALAQA+ETRDKLMA+H ELAE+GAIEIIIIKTTGDKIL+Q
Sbjct  47    EQEVKTKVSLVRIGTRGSPLALAQAHETRDKLMATHSELAEDGAIEIIIIKTTGDKILNQ  106

Query  351   PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
             PLADIGGKGLFTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L
Sbjct  107   PLADIGGKGLFTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICL  166

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
             +A SL++LPAGS VG+ASLRR+SQIL+RYPSL+V+ NFRGNVQTRL+KL EG VQATLLA
Sbjct  167   TAKSLSELPAGSLVGSASLRRQSQILYRYPSLRVV-NFRGNVQTRLKKLKEGEVQATLLA  225

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             LAGLKRL MTE+VT+IL +E+MLPA+AQGAIGIACRS+DEKMANYI+ LNHEETRLAV C
Sbjct  226   LAGLKRLKMTEHVTAILSVEEMLPAIAQGAIGIACRSNDEKMANYISLLNHEETRLAVAC  285

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             ERAFL TLDGSCRTPIAGYA R E+G C+F+GLVASPDG+RV+ETSRKG YTL DMV MG
Sbjct  286   ERAFLETLDGSCRTPIAGYACRDENGYCVFRGLVASPDGSRVLETSRKGSYTLGDMVAMG  345

Query  1071  EDAGKELLLQAGPGFF  1118
             +DAGKELL  AGPGFF
Sbjct  346   KDAGKELLATAGPGFF  361



>ref|XP_008793589.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=354

 Score =   450 bits (1158),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 265/366 (72%), Positives = 303/366 (83%), Gaps = 18/366 (5%)
 Frame = +3

Query  21    TLNPVVAFPANTKPSVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAI  200
             T  P++  PAN +P      SL  G     P       +++VVRA++AVEQ+A+      
Sbjct  5     THQPLITAPANLRPGRRSASSL--GLPPRCPG-----RRAMVVRAAVAVEQEAK------  51

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
                 T+ SPLALAQAYETRDKLMA+H +LAE+GAIEIIIIKTTGDKIL+QPLADIGGKGL
Sbjct  52    ----TKDSPLALAQAYETRDKLMAAHSDLAEDGAIEIIIIKTTGDKILNQPLADIGGKGL  107

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI L+A SL++LPA
Sbjct  108   FTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFICLTAKSLSELPA  167

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KL EG VQATLLALAGLKRL M 
Sbjct  168   GSFVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLKEGEVQATLLALAGLKRLKMM  226

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             ENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYI+ LNHEETRLAV CERAFL TLDG
Sbjct  227   ENVTAVLSVEEMLPAIAQGAIGIACRSNDEKMANYISLLNHEETRLAVACERAFLETLDG  286

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAGYA R  DG C+F+GLVASPDGTRV+ETSRKG Y L DMV +G+DAGKELL +
Sbjct  287   SCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELLSR  346

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  347   AGPGFF  352



>gb|ABK26871.1| unknown [Picea sitchensis]
Length=373

 Score =   449 bits (1154),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 248/324 (77%), Positives = 282/324 (87%), Gaps = 1/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             VRA+    + A +T V+++RIGTRGSPLALAQAYETRDKL ++HPELAEEGA+EIIIIKT
Sbjct  49    VRAAATAVESATRTHVSLVRIGTRGSPLALAQAYETRDKLKSAHPELAEEGAVEIIIIKT  108

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKIL+QPLADIGGKGLFTKEID+AL+  +IDIAVHSMKDVPTYLP  TILPCNLPRED
Sbjct  109   TGDKILNQPLADIGGKGLFTKEIDDALLGGKIDIAVHSMKDVPTYLPSGTILPCNLPRED  168

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRD FI  +A SLA+L AGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG
Sbjct  169   VRDVFICPTAGSLAELQAGSIVGSASLRRQSQILYRYPSLKVI-NFRGNVQTRLRKLKEG  227

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
              V ATLLA AGLKRL M ++VT +L  E+MLPA+AQGAIGIACRS+D+KMA+Y+A+LNHE
Sbjct  228   EVHATLLAFAGLKRLGMIQHVTCLLSTEEMLPAIAQGAIGIACRSNDDKMADYLAALNHE  287

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYA R +DG C F+GL+ASPDGTRV+ETSRKG YT
Sbjct  288   ETRLAVACERAFLETLDGSCRTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYT  347

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               DMV MG DAGKEL  +AGP FF
Sbjct  348   YEDMVSMGVDAGKELKERAGPAFF  371



>gb|ABR17705.1| unknown [Picea sitchensis]
Length=373

 Score =   448 bits (1152),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 248/324 (77%), Positives = 282/324 (87%), Gaps = 1/324 (0%)
 Frame = +3

Query  147   VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
             VRA+    + A +T V+++RIGTRGSPLALAQAYETRDKL ++HPELAEEGA+EIIIIKT
Sbjct  49    VRAAATAVESATRTHVSLVRIGTRGSPLALAQAYETRDKLKSAHPELAEEGAVEIIIIKT  108

Query  327   tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
             TGDKIL+QPLADIGGKGLFTKEID+AL+  +IDIAVHSMKDVPTYLP  TILPCNLPRED
Sbjct  109   TGDKILNQPLADIGGKGLFTKEIDDALLGGKIDIAVHSMKDVPTYLPSGTILPCNLPRED  168

Query  507   VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
             VRD FI  +A SLA+L AGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG
Sbjct  169   VRDVFICPTAGSLAELQAGSIVGSASLRRQSQILYRYPSLKVI-NFRGNVQTRLRKLKEG  227

Query  687   VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHE  866
              V ATLLA AGLKRL M ++VT +L  E+MLPA+AQGAIGIACRS+D+KMA+Y+A+LNHE
Sbjct  228   EVHATLLAFAGLKRLGMIQHVTCLLSTEEMLPAIAQGAIGIACRSNDDKMADYLAALNHE  287

Query  867   ETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYT  1046
             ETRLAV CERAFL TLDGSCRTPIAGYA R +DG C F+GL+ASPDGTRV+ETSRKG YT
Sbjct  288   ETRLAVACERAFLETLDGSCRTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYT  347

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
               DMV MG DAGKEL  +AGP FF
Sbjct  348   HEDMVSMGVDAGKELKERAGPAFF  371



>ref|XP_001781636.1| predicted protein [Physcomitrella patens]
 gb|EDQ53592.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   445 bits (1144),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 250/352 (71%), Positives = 296/352 (84%), Gaps = 13/352 (4%)
 Frame = +3

Query  63    SVSVFRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQ  242
             SVS+ +  P G  +S      RS K  VV A+   + Q   TKVA++RIGTRGSPLALAQ
Sbjct  53    SVSLVK--PSGVTAS------RSVKRSVVEATATFDTQ---TKVALVRIGTRGSPLALAQ  101

Query  243   AYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEI  422
             AY+TRDKL A+HPELAEEGA+EI+IIKTTGDKILSQPLADIGGKGLFTKEID+AL+N +I
Sbjct  102   AYQTRDKLKAAHPELAEEGALEIVIIKTTGDKILSQPLADIGGKGLFTKEIDDALLNGDI  161

Query  423   DIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQ  602
             DIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI  + +SLA+LP GS VG+ASLRR+SQ
Sbjct  162   DIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPNYSSLAELPEGSVVGSASLRRQSQ  221

Query  603   ILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLP  782
             +LH+YP LKV+ NFRGNVQTRLRKL+EG VQATLLALAGLKRLDMTE+VT+IL  +DMLP
Sbjct  222   LLHKYPHLKVV-NFRGNVQTRLRKLSEGTVQATLLALAGLKRLDMTEHVTTILDTDDMLP  280

Query  783   AVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGE  962
             A+AQGAIGIACR+ D KM  Y++SLNHE+TRLAV CERAFL  LDGSCRTPIAG A+R +
Sbjct  281   AIAQGAIGIACRTGDTKMEEYLSSLNHEDTRLAVACERAFLAKLDGSCRTPIAGLAQRTD  340

Query  963   DGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             DG C F+GLVA+ DG +V+ETSRKG +  +DM+ + +DAG+EL+ +AGP FF
Sbjct  341   DG-CSFRGLVATTDGKQVLETSRKGSFFYDDMIALAQDAGQELISRAGPDFF  391



>ref|XP_008461840.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Cucumis 
melo]
Length=286

 Score =   439 bits (1130),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 247/284 (87%), Positives = 274/284 (96%), Gaps = 0/284 (0%)
 Frame = +3

Query  267   MASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMK  446
             MASHPELAE+GAI+I++IKTTGDKILSQPLADIGGKGLFTKEID+ALIN +IDIAVHSMK
Sbjct  1     MASHPELAEDGAIQIVVIKTTGDKILSQPLADIGGKGLFTKEIDDALINGDIDIAVHSMK  60

Query  447   DVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSL  626
             DVPTYLP+KTILPCNLPREDVRDAFISLSA+SLA+LPAGS +GTASLRRKSQ+L+RYPSL
Sbjct  61    DVPTYLPEKTILPCNLPREDVRDAFISLSASSLAELPAGSMIGTASLRRKSQLLNRYPSL  120

Query  627   KVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIG  806
             KVLENFRGNVQTRLRKLNEGVVQATLLALAGL+RL+MTENVTSIL I++MLPAVAQGAIG
Sbjct  121   KVLENFRGNVQTRLRKLNEGVVQATLLALAGLRRLNMTENVTSILSIDEMLPAVAQGAIG  180

Query  807   IACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKG  986
             IACRSDD+ MANY+ASLNHEETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+CIFKG
Sbjct  181   IACRSDDDIMANYLASLNHEETRLAVVCERAFLETLDGSCRTPIAGYASRDEDGNCIFKG  240

Query  987   LVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             LVASPDGTRV+ETSR+GPY ++DM+ MG+DAG+ELL +AGPGFF
Sbjct  241   LVASPDGTRVLETSRRGPYAIDDMIAMGKDAGQELLSRAGPGFF  284



>ref|XP_004951778.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Setaria 
italica]
Length=356

 Score =   441 bits (1134),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 241/310 (78%), Positives = 275/310 (89%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETRDKL A+H ELAEEGAIEIIIIKTTGD +L +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAIEIIIIKTTGDIVLDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEIDEAL+N  IDIAVHSMKDVPTYLPD TILPCNLPREDVRDAFISL+A SLA
Sbjct  104   GKGLFTKEIDEALLNGTIDIAVHSMKDVPTYLPDGTILPCNLPREDVRDAFISLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS +G+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KL  G V ATLLALAGLKR
Sbjct  164   ELPAGSIIGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLKGGDVHATLLALAGLKR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+MTEN TS+L +++MLPAVAQGAIGIACRS D+KM  Y++SLNHE+TRLAV CER FL 
Sbjct  223   LNMTENATSLLSVDEMLPAVAQGAIGIACRSSDDKMMEYLSSLNHEDTRLAVACEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDGT V ET+R GPY+ +DMV MG+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDKDGNCSFRGLLASPDGTTVYETTRSGPYSFDDMVAMGKDAGHE  342

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  343   LKAKAGPGFF  352



>ref|XP_007043280.1| Hydroxymethylbilane synthase isoform 2 [Theobroma cacao]
 gb|EOX99111.1| Hydroxymethylbilane synthase isoform 2 [Theobroma cacao]
Length=286

 Score =   431 bits (1107),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 247/284 (87%), Positives = 266/284 (94%), Gaps = 0/284 (0%)
 Frame = +3

Query  267   MASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMK  446
             MASHPELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMK
Sbjct  1     MASHPELAEEGAIKIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMK  60

Query  447   DVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSL  626
             DVPTYLP+KTILPCNL REDVRDAFISLSA+SLA+LPAGS VGTASLRRKSQILHRYPSL
Sbjct  61    DVPTYLPEKTILPCNLLREDVRDAFISLSASSLAELPAGSVVGTASLRRKSQILHRYPSL  120

Query  627   KVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIG  806
             KV ENFRGNVQTRLRKLNEGVVQATLLALAGL+RL MTENVTS+L I++MLPAVAQGAIG
Sbjct  121   KVEENFRGNVQTRLRKLNEGVVQATLLALAGLRRLSMTENVTSVLSIDEMLPAVAQGAIG  180

Query  807   IACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKG  986
             IACRS+DEKMANY+ASLNHEETRL V CERAFL TLDGSCRTPIAG A + EDG+C+FKG
Sbjct  181   IACRSNDEKMANYLASLNHEETRLTVACERAFLETLDGSCRTPIAGNAYKDEDGNCVFKG  240

Query  987   LVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             LVASPDG RV+ETSRKG Y   DMV+MG+DAGKELL +AGPGFF
Sbjct  241   LVASPDGKRVLETSRKGQYAFEDMVMMGKDAGKELLSRAGPGFF  284



>ref|NP_001046017.1| Os02g0168800 [Oryza sativa Japonica Group]
 sp|Q6H6D2.1|HEM3_ORYSJ RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD25717.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 dbj|BAF07931.1| Os02g0168800 [Oryza sativa Japonica Group]
 gb|EEE56391.1| hypothetical protein OsJ_05540 [Oryza sativa Japonica Group]
Length=358

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 235/310 (76%), Positives = 272/310 (88%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETRDKL A+H ELAEEGA+EI+IIKTTGD IL +PLADIG
Sbjct  46    KVSLIRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIVIIKTTGDMILDKPLADIG  105

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A+SLA
Sbjct  106   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLA  165

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKR
Sbjct  166   ELPAGSVVGSASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKR  224

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M E  TS+L +++MLPAVAQGAIGIACRS D+ M NY++SLNHE+TRLAV CER FL+
Sbjct  225   LNMAETATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVACEREFLS  284

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR GPY  + MV MG+DAG E
Sbjct  285   VLDGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEMGKDAGHE  344

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  345   LKAKAGPGFF  354



>ref|XP_010276153.1| PREDICTED: porphobilinogen deaminase, chloroplastic isoform X2 
[Nelumbo nucifera]
Length=292

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 262/286 (92%), Gaps = 0/286 (0%)
 Frame = +3

Query  267   MASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMK  446
             MA+HPEL+EEGAIEI+IIKTTGDKIL+QPLADIGGKGLFTKEIDEAL+N EIDIAVHSMK
Sbjct  1     MATHPELSEEGAIEIVIIKTTGDKILTQPLADIGGKGLFTKEIDEALLNGEIDIAVHSMK  60

Query  447   DVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSL  626
             DVPTYLPD TILPCNLPREDVRDAFISLSA SLA+LPAGS VG+ASLRRKSQIL+RYPSL
Sbjct  61    DVPTYLPDGTILPCNLPREDVRDAFISLSARSLAELPAGSIVGSASLRRKSQILNRYPSL  120

Query  627   KVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIG  806
             KV  NFRGNVQTRLRK+ EG VQATLLALAGLKRLD+TENVT+IL I++M+PAVAQGAIG
Sbjct  121   KVEMNFRGNVQTRLRKVREGEVQATLLALAGLKRLDLTENVTAILSIDEMIPAVAQGAIG  180

Query  807   IACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKG  986
             IAC+S+D+KMANYIASLNHEETRLAV CERAFL TLDGSC+TPIAGYA +  +G CIF+G
Sbjct  181   IACQSNDDKMANYIASLNHEETRLAVACERAFLETLDGSCQTPIAGYACKDNEGYCIFRG  240

Query  987   LVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             LVASPDGT+V ETSRKG Y L DM+ MG+DAGKELL +AG  FF N
Sbjct  241   LVASPDGTQVFETSRKGLYILEDMIAMGKDAGKELLSRAGSSFFDN  286



>ref|XP_002961888.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
 gb|EFJ37148.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
Length=353

 Score =   430 bits (1105),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 240/324 (74%), Positives = 272/324 (84%), Gaps = 1/324 (0%)
 Frame = +3

Query  150   RASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiiktt  329
             R  I V      T VA+IRIGTRGSPLALAQAY+TRD L  +HPELAE+GA+EI+IIKTT
Sbjct  27    RHGITVRAAVASTDVAVIRIGTRGSPLALAQAYQTRDLLKGAHPELAEDGALEIVIIKTT  86

Query  330   gdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDV  509
             GDKIL+QPLADIGGKGLFTKEID+AL++  IDIAVHSMKDVPTYLP  TILPCNL RED 
Sbjct  87    GDKILNQPLADIGGKGLFTKEIDDALLDNRIDIAVHSMKDVPTYLPQGTILPCNLRREDA  146

Query  510   RDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGV  689
             RDAFISL A SLA+LP GS VGTASLRRKSQIL RYP L+V  NFRGNVQTRL+KL EG+
Sbjct  147   RDAFISLKAKSLAELPPGSVVGTASLRRKSQILKRYPHLQVDTNFRGNVQTRLKKLQEGI  206

Query  690   VQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEE  869
             V ATLLALAGLKRL+MTE+VT +LP+++MLPA+AQGAIGIACR  DEKM  Y+ASLNHEE
Sbjct  207   VTATLLALAGLKRLNMTEHVTGVLPMDEMLPAIAQGAIGIACRQGDEKMERYLASLNHEE  266

Query  870   TRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYT  1046
             TRLAV CERAFL  LDGSCRTPIAGYA R +  D C F+GLVASPDGT+V+ET+R G Y 
Sbjct  267   TRLAVSCERAFLEMLDGSCRTPIAGYAHRDKLTDECKFRGLVASPDGTQVLETTRSGQYN  326

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
             L++MV MG+DA KELL ++GP   
Sbjct  327   LDEMVAMGKDAAKELLSKSGPSLL  350



>ref|XP_006648352.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=353

 Score =   429 bits (1103),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 271/310 (87%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETRDKL A+H ELAEEGA+EIIIIKTTGD IL +PLADIG
Sbjct  41    KVSLIRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIIIIKTTGDMILDKPLADIG  100

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  101   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  160

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKR
Sbjct  161   ELPAGSVVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKR  219

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M E  TS+L +E+MLPAVAQGAIGIACRS+D+ M NY++SLNHE+TRLAV CER FL+
Sbjct  220   LNMAETATSVLSVEEMLPAVAQGAIGIACRSNDDTMMNYLSSLNHEDTRLAVACEREFLS  279

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR GPY  + MV MG+DAG E
Sbjct  280   VLDGNCRTPIAAYASRDKDGNCSFRGLLASPDGSIVYETSRTGPYDFDVMVEMGKDAGHE  339

Query  1089  LLLQAGPGFF  1118
             L  +AG GFF
Sbjct  340   LKAKAGSGFF  349



>ref|XP_008813290.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=285

 Score =   426 bits (1094),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 210/258 (81%), Positives = 234/258 (91%), Gaps = 1/258 (0%)
 Frame = +3

Query  345   SQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFI  524
             SQPLADIGGKGLFTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI
Sbjct  27    SQPLADIGGKGLFTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFI  86

Query  525   slsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATL  704
              L+A SL++LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KLNEG VQAT+
Sbjct  87    CLTANSLSELPAGSIVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLNEGEVQATM  145

Query  705   LALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAV  884
             LALAGLKRL MTENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYIASLNHEETRLAV
Sbjct  146   LALAGLKRLHMTENVTALLSVEEMLPAIAQGAIGIACRSNDEKMANYIASLNHEETRLAV  205

Query  885   VCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVL  1064
              CERAFL TLDGSCRTPIAGYA R +DG C+F+GLVASPDGTRV+E SRKG Y L +MV 
Sbjct  206   ACERAFLETLDGSCRTPIAGYAYRDKDGYCVFRGLVASPDGTRVLEASRKGSYALEEMVS  265

Query  1065  MGEDAGKELLLQAGPGFF  1118
             MG+DAGKELL +AGPGF 
Sbjct  266   MGKDAGKELLSRAGPGFL  283



>ref|XP_002990245.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
 gb|EFJ08660.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
Length=353

 Score =   428 bits (1101),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 239/324 (74%), Positives = 271/324 (84%), Gaps = 1/324 (0%)
 Frame = +3

Query  150   RASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiiktt  329
             R  I V      T VA+IRIGTRGSPLALAQAY+TRD L  +HPELAE+GA+EI+IIKTT
Sbjct  27    RHGITVRAAVASTDVAVIRIGTRGSPLALAQAYQTRDLLKGAHPELAEDGALEIVIIKTT  86

Query  330   gdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDV  509
             GDKIL+QPLADIGGKGLFTKEID+AL++  IDIAVHSMKDVPTYLP  TILPCNL RED 
Sbjct  87    GDKILNQPLADIGGKGLFTKEIDDALLDNRIDIAVHSMKDVPTYLPQGTILPCNLRREDA  146

Query  510   RDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGV  689
             RDAFISL A SLA+LP GS VGTASLRRKSQIL RYP L+V  NFRGNVQTRL+KL EG+
Sbjct  147   RDAFISLKAKSLAELPPGSVVGTASLRRKSQILKRYPHLQVDTNFRGNVQTRLKKLQEGI  206

Query  690   VQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEE  869
             V ATLLALAGLKRL+MTE+VT +LP+++MLPA+AQGAIGIACR  DEKM  Y+ASLNHEE
Sbjct  207   VTATLLALAGLKRLNMTEHVTGVLPMDEMLPAIAQGAIGIACRQGDEKMERYLASLNHEE  266

Query  870   TRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYT  1046
             TRLAV CERAFL  LDGSCRTPIAGYA R +  D C F+GLVASPDGT+V+ET+R G Y 
Sbjct  267   TRLAVSCERAFLEMLDGSCRTPIAGYAHRDKLTDECKFRGLVASPDGTQVLETTRSGQYN  326

Query  1047  LNDMVLMGEDAGKELLLQAGPGFF  1118
              ++MV MG+DA KELL ++GP   
Sbjct  327   FDEMVAMGKDAAKELLSKSGPSLL  350



>gb|EEC72572.1| hypothetical protein OsI_06012 [Oryza sativa Indica Group]
Length=358

 Score =   428 bits (1100),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 234/310 (75%), Positives = 271/310 (87%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETRDKL A+H ELAEEGA+EI+IIKTTGD IL +PLADIG
Sbjct  46    KVSLIRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIVIIKTTGDMILDKPLADIG  105

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A+SLA
Sbjct  106   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLA  165

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKR
Sbjct  166   ELPAGSVVGSASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKR  224

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M E  TS+L +++MLPAVAQGAIGIACRS D+ M NY++SLNHE+TRLAV CER FL+
Sbjct  225   LNMAETATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVACEREFLS  284

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR G Y  + MV MG+DAG E
Sbjct  285   VLDGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGSYDFDIMVEMGKDAGHE  344

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  345   LKAKAGPGFF  354



>ref|XP_003570067.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Brachypodium 
distachyon]
Length=357

 Score =   428 bits (1100),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 274/310 (88%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAE+GA+EIIIIKTTGD IL +PLADIG
Sbjct  45    KVSLIRIGTRGSPLALAQAHETREKLKAAHTELAEDGAVEIIIIKTTGDMILDKPLADIG  104

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A +LA
Sbjct  105   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLNAKTLA  164

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKR
Sbjct  165   ELPAGSVVGSASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKR  223

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M E  TS+L +++MLPAVAQGAIGIACR++D+KM +Y++SLNHE+TRLAV CER FL+
Sbjct  224   LNMAETATSVLSVDEMLPAVAQGAIGIACRTNDDKMMDYLSSLNHEDTRLAVACEREFLS  283

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR G YT +DMV +G+DAG E
Sbjct  284   VLDGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYTFDDMVALGQDAGYE  343

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  344   LKSKAGPGFF  353



>ref|XP_001769569.1| predicted protein [Physcomitrella patens]
 gb|EDQ65562.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   427 bits (1097),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 287/331 (87%), Gaps = 5/331 (2%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             R+ K   V+A+   +    KTKVA++RIGTRGSPLALAQAY+TRDKL A+HPELAEEGA+
Sbjct  34    RTVKRSAVKAAATFDT---KTKVAVVRIGTRGSPLALAQAYQTRDKLKAAHPELAEEGAL  90

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             +I+IIKTTGDKILSQPLADIGGKGLFTKEID+AL+N +IDIAVHSMKDVPTYLP+ TILP
Sbjct  91    DIVIIKTTGDKILSQPLADIGGKGLFTKEIDDALLNGDIDIAVHSMKDVPTYLPEGTILP  150

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPREDVRDAFI    +SLA+LP GS VG+ASLRR+SQ+LHRYP L+V+ NFRGNVQTR
Sbjct  151   CNLPREDVRDAFICPKYSSLAELPEGSVVGSASLRRQSQLLHRYPHLQVV-NFRGNVQTR  209

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             LRKLNEGV  ATLLALAGLKRLDMTE++T+IL  +DMLPA+AQGAIGIACR+ D KM  Y
Sbjct  210   LRKLNEGVCAATLLALAGLKRLDMTEHITAILETDDMLPAIAQGAIGIACRTGDTKMEEY  269

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +ASLNHE+TRLA+ CERAFL  LDGSCRTPIAG A+R EDG C+F+GLVA+ DG +V+ET
Sbjct  270   LASLNHEDTRLAISCERAFLAKLDGSCRTPIAGLAQRTEDG-CLFRGLVATTDGKQVLET  328

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             SR G ++ +DM+ + +DAG+EL+ +AGPGFF
Sbjct  329   SRTGSFSYDDMIALAQDAGQELISRAGPGFF  359



>ref|XP_008793590.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X4 [Phoenix dactylifera]
Length=285

 Score =   420 bits (1080),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 232/258 (90%), Gaps = 1/258 (0%)
 Frame = +3

Query  345   SQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFI  524
             +QPLADIGGKGLFTKEIDEAL+  +IDIAVHSMKDVPTY PD  ILPCNLPREDVRDAFI
Sbjct  27    NQPLADIGGKGLFTKEIDEALLEGKIDIAVHSMKDVPTYFPDGMILPCNLPREDVRDAFI  86

Query  525   slsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATL  704
              L+A SL++LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRL+KL EG VQATL
Sbjct  87    CLTAKSLSELPAGSFVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLKKLKEGEVQATL  145

Query  705   LALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAV  884
             LALAGLKRL M ENVT++L +E+MLPA+AQGAIGIACRS+DEKMANYI+ LNHEETRLAV
Sbjct  146   LALAGLKRLKMMENVTAVLSVEEMLPAIAQGAIGIACRSNDEKMANYISLLNHEETRLAV  205

Query  885   VCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVL  1064
              CERAFL TLDGSCRTPIAGYA R  DG C+F+GLVASPDGTRV+ETSRKG Y L DMV 
Sbjct  206   ACERAFLETLDGSCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVS  265

Query  1065  MGEDAGKELLLQAGPGFF  1118
             +G+DAGKELL +AGPGFF
Sbjct  266   IGKDAGKELLSRAGPGFF  283



>ref|XP_010456444.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Camelina 
sativa]
Length=367

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 241/312 (77%), Positives = 264/312 (85%), Gaps = 16/312 (5%)
 Frame = +3

Query  129   STKSLVVRASIAVEQQAQKTKVAIIRIGTRG-------------SPLALAQAYETRDKLM  269
             S+ S  V+A +AVEQ   KT+ AIIRIGTRG             SPLALAQAYETR+KL 
Sbjct  56    SSSSGFVKACVAVEQ---KTRTAIIRIGTRGRSDFCVLIDVLMDSPLALAQAYETREKLK  112

Query  270   ASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKD  449
             + HPEL EEGAI I IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN  IDIAVHSMKD
Sbjct  113   SKHPELVEEGAIHIEIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGHIDIAVHSMKD  172

Query  450   VPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLK  629
             VPTYLP+KTILPCNL REDVRDAFI L+AASLA+LPAGS VGTASLRRKSQILH+YP+L 
Sbjct  173   VPTYLPEKTILPCNLVREDVRDAFICLTAASLAELPAGSVVGTASLRRKSQILHKYPALH  232

Query  630   VLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGI  809
             V ENFRGNVQTRL KL  G VQATLLALAGLKRL MTENV SIL +++MLPAVAQGAIGI
Sbjct  233   VEENFRGNVQTRLSKLQGGKVQATLLALAGLKRLSMTENVASILSLDEMLPAVAQGAIGI  292

Query  810   ACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGL  989
             ACR+DD+KMA Y+ASLNHEETRLAV CERAFL TLDGSCRTPIAGYA + E+G+C F+GL
Sbjct  293   ACRTDDDKMATYLASLNHEETRLAVSCERAFLETLDGSCRTPIAGYAAKDEEGNCFFRGL  352

Query  990   VASPDGTRVIET  1025
             VASPDGT+  +T
Sbjct  353   VASPDGTKGTKT  364



>ref|XP_001780954.1| predicted protein [Physcomitrella patens]
 gb|EDQ54214.1| predicted protein, partial [Physcomitrella patens]
Length=299

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 229/299 (77%), Positives = 263/299 (88%), Gaps = 2/299 (1%)
 Frame = +3

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQAY+TRDKL A+HP LAEEGA+EIIIIKTTGDKILSQPLADIGGKGLFTKEID+
Sbjct  1     SPLALAQAYQTRDKLKAAHPGLAEEGALEIIIIKTTGDKILSQPLADIGGKGLFTKEIDD  60

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             AL+N +IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI  + +SLA+LP GS VG+A
Sbjct  61    ALLNGDIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPNYSSLAELPEGSVVGSA  120

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRR+SQILH+YP LKV ENFRGNVQTRLRKL+EG VQATLLALAGLKRLDMTE++T+IL
Sbjct  121   SLRRQSQILHKYPHLKV-ENFRGNVQTRLRKLSEGTVQATLLALAGLKRLDMTEHITAIL  179

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
               +DMLPA+AQGAIGIACR+ D KM  Y+ASLNHE TRLA+ CERAFL  LDGSCRTPIA
Sbjct  180   ATDDMLPAIAQGAIGIACRTGDSKMEEYLASLNHEGTRLAISCERAFLAKLDGSCRTPIA  239

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             G A R EDG C F+GLVA+ DG +V+ETSRKG ++ +DM+ + +DAG EL+ +AGP FF
Sbjct  240   GLAERTEDG-CSFRGLVATTDGKQVLETSRKGSFSYDDMIALAQDAGAELISRAGPDFF  297



>ref|XP_002451613.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
 gb|EES04589.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
Length=356

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 235/310 (76%), Positives = 275/310 (89%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEEGAIEI+IIKTTGD IL +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164   ELPAGSVVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y++SLNHE+TRLAV CER FL 
Sbjct  223   LNMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVACEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL+ASPDG++V ET+R GPY+ +DMV +G+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHE  342

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  343   LKAKAGPGFF  352



>gb|AFW66382.1| porphobilinogen deaminase [Zea mays]
Length=356

 Score =   413 bits (1062),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 273/310 (88%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEE AIEI+IIKTTGD IL +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS +G+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164   ELPAGSVIGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y+++LNHE+TRLAV CER FL 
Sbjct  223   LNMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R  DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHE  342

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  343   LKAKAGPGFF  352



>ref|XP_008680937.1| PREDICTED: uncharacterized protein LOC100191140 isoform X1 [Zea 
mays]
 gb|ACF87707.1| unknown [Zea mays]
 gb|ACN28053.1| unknown [Zea mays]
 gb|AFW70270.1| camouflage1 [Zea mays]
Length=356

 Score =   413 bits (1061),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 235/310 (76%), Positives = 274/310 (88%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEEGAIEI+IIKTTGD IL +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164   ELPAGSVVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y++SLNHE+TRLAV CER FL 
Sbjct  223   LKMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVTCEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHE  342

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  343   LKAKAGPGFF  352



>gb|AAL12220.1| porphobilinogen deaminase [Triticum aestivum]
Length=308

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 223/305 (73%), Positives = 262/305 (86%), Gaps = 1/305 (0%)
 Frame = +3

Query  204   RIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLF  383
             RIGTRGSPLALAQA +TRD+L A+H ELAE+GAIEI+IIKTTGD IL +PLADIGGKGLF
Sbjct  1     RIGTRGSPLALAQARQTRDELKAAHTELAEDGAIEIVIIKTTGDMILDKPLADIGGKGLF  60

Query  384   TKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAG  563
             TKEID+AL+   IDIAVHSMKDVPTYLP+  ILPCNLPREDVRDAFI L+A +L +LPAG
Sbjct  61    TKEIDDALLQGSIDIAVHSMKDVPTYLPEGMILPCNLPREDVRDAFICLTAKTLGELPAG  120

Query  564   STVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTE  743
             S + +ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKRL M E
Sbjct  121   SVIASASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKRLGMPE  179

Query  744   NVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGS  923
               TS+L +++MLPAVAQGAIGI CRS+D+KM  Y++SLNHE+TRLAV CER FL+ LDG+
Sbjct  180   TATSVLSVDEMLPAVAQGAIGITCRSNDDKMMEYLSSLNHEDTRLAVACEREFLSVLDGN  239

Query  924   CRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQA  1103
             CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR G Y+ +DMV +G+DAG EL  +A
Sbjct  240   CRTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYSFDDMVALGQDAGHELKSKA  299

Query  1104  GPGFF  1118
             GPGFF
Sbjct  300   GPGFF  304



>ref|NP_001150986.1| LOC100284619 [Zea mays]
 gb|ACG41173.1| porphobilinogen deaminase [Zea mays]
Length=356

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 232/310 (75%), Positives = 272/310 (88%), Gaps = 1/310 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEE AIEI+IIKTTGD IL +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS +G+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164   ELPAGSVIGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L+M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y+++LNHE+TRLAV CER FL 
Sbjct  223   LNMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R  DG+C F+GL+ASP G++V ET+R GPY+ +DMV MG+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDNDGNCSFRGLLASPGGSKVFETTRSGPYSFDDMVEMGKDAGHE  342

Query  1089  LLLQAGPGFF  1118
             L  +AGPGFF
Sbjct  343   LKAKAGPGFF  352



>gb|EMT29771.1| Porphobilinogen deaminase, chloroplastic [Aegilops tauschii]
Length=334

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 259/301 (86%), Gaps = 1/301 (0%)
 Frame = +3

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             R SPLALAQA +TRD+L A+H ELAE+GAIEIIIIKTTGD IL +PLADIGGKGLFTKEI
Sbjct  31    RDSPLALAQARQTRDELKAAHTELAEDGAIEIIIIKTTGDMILDKPLADIGGKGLFTKEI  90

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             D+AL+   IDIAVHSMKDVPTYLP+  ILPCNLPREDVRDAFI L+A +L +LPAGS +G
Sbjct  91    DDALLQGSIDIAVHSMKDVPTYLPEGMILPCNLPREDVRDAFICLTAKTLGELPAGSVIG  150

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             +ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKRL M E  TS
Sbjct  151   SASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKRLGMPETATS  209

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             +L +++MLPAVAQGAIGI CRS+D+KM  Y++SLNHE+TRLAV CER FL+ LDG+CRTP
Sbjct  210   VLSVDEMLPAVAQGAIGITCRSNDDKMMEYLSSLNHEDTRLAVACEREFLSVLDGNCRTP  269

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IA YA R +DG+C F+GL+ASPDG+ V ETSR G Y+L+DMV +G+DAG EL  +AGPGF
Sbjct  270   IAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYSLDDMVAIGQDAGHELKSKAGPGF  329

Query  1116  F  1118
             F
Sbjct  330   F  330



>ref|XP_002451614.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
 gb|EES04590.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
Length=340

 Score =   400 bits (1027),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 223/301 (74%), Positives = 256/301 (85%), Gaps = 1/301 (0%)
 Frame = +3

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             + S LALAQA ETRDKL A+H ELAEEGA+EIIIIKTTGD IL +PLADIGGKGLFTKEI
Sbjct  39    KDSDLALAQARETRDKLKAAHSELAEEGAVEIIIIKTTGDMILDKPLADIGGKGLFTKEI  98

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             D+A++   IDIAVHSMKDVPTYLP+ TILPCNLPRED RDAFI L+A SLA+LP+G  VG
Sbjct  99    DDAILQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDARDAFICLTANSLAELPSGCVVG  158

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             +ASLRR+SQIL RYPSLKV+ N RGNVQTRL KL  G V ATLLALAGLKRL+M ENVTS
Sbjct  159   SASLRRQSQILCRYPSLKVV-NLRGNVQTRLTKLKNGDVHATLLALAGLKRLNMVENVTS  217

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             IL +E+MLPAVAQGAIGIACRS+D KM  Y++SLNHE+TR AV CER FLT LDG+CRTP
Sbjct  218   ILSMEEMLPAVAQGAIGIACRSNDNKMMEYLSSLNHEDTRSAVACEREFLTVLDGNCRTP  277

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IA YA R +DG C F+GL+ASPDG++V ET+R GPY+ +DMV MG+DAG EL  +AGPGF
Sbjct  278   IAAYAHRDKDGSCSFRGLLASPDGSKVYETTRIGPYSFDDMVEMGKDAGHELKAKAGPGF  337

Query  1116  F  1118
             +
Sbjct  338   Y  338



>ref|NP_001130048.1| uncharacterized protein LOC100191140 [Zea mays]
 gb|ACF78164.1| unknown [Zea mays]
 gb|AFW70269.1| LOW QUALITY PROTEIN: camouflage1 [Zea mays]
Length=394

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 269/306 (88%), Gaps = 1/306 (0%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEEGAIEI+IIKTTGD IL +PLADIG
Sbjct  44    KVSLIRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIG  103

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104   GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LPAGS VG+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164   ELPAGSVVGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y++SLNHE+TRLAV CER FL 
Sbjct  223   LKMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVTCEREFLA  282

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIA YA R +DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG E
Sbjct  283   VLDGNCRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHE  342

Query  1089  LLLQAG  1106
             L  + G
Sbjct  343   LRRRLG  348



>ref|XP_008677339.1| PREDICTED: LOC100284619 isoform X2 [Zea mays]
Length=320

 Score =   394 bits (1012),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 223/299 (75%), Positives = 262/299 (88%), Gaps = 1/299 (0%)
 Frame = +3

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQA+ETR+KL A+H ELAEE AIEI+IIKTTGD IL +PLADIGGKGLFTKEID+
Sbjct  19    SPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIGGKGLFTKEIDD  78

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA+LPAGS +G+A
Sbjct  79    ALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPAGSVIGSA  138

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+RL+M EN T++L
Sbjct  139   SLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAENATAVL  197

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
              +E+MLPAVAQGAIGIACRS+D+KM  Y+++LNHE+TRLAV CER FL  LDG+CRTPIA
Sbjct  198   SVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLAVLDGNCRTPIA  257

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
              YA R  DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG EL  +AGPGFF
Sbjct  258   AYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELKAKAGPGFF  316



>gb|AFW70271.1| camouflage1 [Zea mays]
Length=353

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/299 (76%), Positives = 263/299 (88%), Gaps = 1/299 (0%)
 Frame = +3

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQA+ETR+KL A+H ELAEEGAIEI+IIKTTGD IL +PLADIGGKGLFTKEID+
Sbjct  52    SPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGLFTKEIDD  111

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA+LPAGS VG+A
Sbjct  112   ALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPAGSVVGSA  171

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+RL M EN T++L
Sbjct  172   SLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRRLKMAENATAVL  230

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
              +E+MLPAVAQGAIGIACRS+D+KM  Y++SLNHE+TRLAV CER FL  LDG+CRTPIA
Sbjct  231   SVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVTCEREFLAVLDGNCRTPIA  290

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
              YA R +DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG EL  +AGPGFF
Sbjct  291   AYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHELKAKAGPGFF  349



>ref|XP_001701485.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
 gb|EDO97482.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
Length=349

 Score =   394 bits (1012),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAY TRD L  S PEL+EEGA+EI+IIKTTGDKIL+QPLADIGGKGL
Sbjct  43    VKIGTRGSPLALAQAYMTRDLLKKSFPELSEEGALEIVIIKTTGDKILNQPLADIGGKGL  102

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEID+AL++ +IDIAVHSMKDVPTYLP+ TILPCNLPREDVRD FIS  A  L++LPA
Sbjct  103   FTKEIDDALLSGKIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDVFISPVAKDLSELPA  162

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG+ASLRR++QIL +YP LKV ENFRGNVQTRLRKLNEG   ATLLALAGLKRLDMT
Sbjct  163   GAIVGSASLRRQAQILAKYPHLKV-ENFRGNVQTRLRKLNEGACSATLLALAGLKRLDMT  221

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E++T  L I++MLPAV+QGAIGIACR+DD    N +A+LNHEETR+AVVCERAFLT LDG
Sbjct  222   EHITKTLSIDEMLPAVSQGAIGIACRTDDGASRNLLAALNHEETRIAVVCERAFLTALDG  281

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             SCRTPIAGYA +G DG   F GLVA+PDG +++  SR  P+T  D V  GE+AGKEL
Sbjct  282   SCRTPIAGYAHKGADGMLHFSGLVATPDGKQIMRASRVVPFTEADAVKCGEEAGKEL  338



>gb|ABF70028.1| porphobilinogen deaminase, chloroplast (hydroxymethylbilane synthase) 
(pre-uroporphyrinogen synthase), putative [Musa acuminata]
Length=426

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 265/301 (88%), Gaps = 1/301 (0%)
 Frame = +3

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             R SPLALAQA+ETR+KL A+H ELAEEGAIEI+IIKTTGD IL +PLADIGGKGLFTKEI
Sbjct  123   RDSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGLFTKEI  182

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             D+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA+LPAGS VG
Sbjct  183   DDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPAGSVVG  242

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             +ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+RL+M EN T+
Sbjct  243   SASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAENATA  301

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             +L +E+MLPAVAQGAIGIACRS+D+KM  Y++SLNHE+TRLAV CER FL  LDG+CRTP
Sbjct  302   VLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVACEREFLAVLDGNCRTP  361

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IA YA R EDG+C F+GL+ASPDG++V ET+R GPY+ +DMV +G+DAG EL  +AGPGF
Sbjct  362   IAAYAYRDEDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELKAKAGPGF  421

Query  1116  F  1118
             F
Sbjct  422   F  422



>ref|XP_008677338.1| PREDICTED: LOC100284619 isoform X1 [Zea mays]
Length=353

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 223/299 (75%), Positives = 262/299 (88%), Gaps = 1/299 (0%)
 Frame = +3

Query  222   SPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDE  401
             SPLALAQA+ETR+KL A+H ELAEE AIEI+IIKTTGD IL +PLADIGGKGLFTKEID+
Sbjct  52    SPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIGGKGLFTKEIDD  111

Query  402   ALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTA  581
             AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA+LPAGS +G+A
Sbjct  112   ALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPAGSVIGSA  171

Query  582   SLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSIL  761
             SLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+RL+M EN T++L
Sbjct  172   SLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAENATAVL  230

Query  762   PIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIA  941
              +E+MLPAVAQGAIGIACRS+D+KM  Y+++LNHE+TRLAV CER FL  LDG+CRTPIA
Sbjct  231   SVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLAVLDGNCRTPIA  290

Query  942   GYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
              YA R  DG+C F+GL++SPDG++V ET+R GPY+ +DMV MG+DAG EL  +AGPGFF
Sbjct  291   AYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELKAKAGPGFF  349



>dbj|BAD25718.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 dbj|BAG87614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95470.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 223/257 (87%), Gaps = 1/257 (0%)
 Frame = +3

Query  348   QPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIs  527
             +PLADIGGKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI 
Sbjct  5     KPLADIGGKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFIC  64

Query  528   lsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLL  707
             L+A+SLA+LPAGS VG+ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLL
Sbjct  65    LTASSLAELPAGSVVGSASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLL  123

Query  708   ALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVV  887
             ALAGLKRL+M E  TS+L +++MLPAVAQGAIGIACRS D+ M NY++SLNHE+TRLAV 
Sbjct  124   ALAGLKRLNMAETATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVA  183

Query  888   CERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLM  1067
             CER FL+ LDG+CRTPIA YA R +DG+C F+GL+ASPDG+ V ETSR GPY  + MV M
Sbjct  184   CEREFLSVLDGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEM  243

Query  1068  GEDAGKELLLQAGPGFF  1118
             G+DAG EL  +AGPGFF
Sbjct  244   GKDAGHELKAKAGPGFF  260



>ref|XP_002950840.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f. nagariensis]
 gb|EFJ48155.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f. nagariensis]
Length=355

 Score =   390 bits (1002),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 224/324 (69%), Positives = 259/324 (80%), Gaps = 3/324 (1%)
 Frame = +3

Query  120   PIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeeg  299
             P R     V R S  +   A  TK   ++IGTRGSPLALAQAY TRD L  + PEL EEG
Sbjct  24    PKRVAGVRVNRRSCHIVASAVATKT--VKIGTRGSPLALAQAYLTRDLLKKNFPELNEEG  81

Query  300   aieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTI  479
             A+EI+IIKTTGDKIL+QPLADIGGKGLFTKEID+AL+  +IDIAVHSMKDVPTYLP+ TI
Sbjct  82    ALEIVIIKTTGDKILNQPLADIGGKGLFTKEIDDALLGGKIDIAVHSMKDVPTYLPEGTI  141

Query  480   LPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQ  659
             LPCNLPREDVRD FIS +A  L++LPAG+ VG+ASLRR++QIL +YP LKV ENFRGNVQ
Sbjct  142   LPCNLPREDVRDVFISPTAKDLSELPAGAVVGSASLRRQAQILAKYPHLKV-ENFRGNVQ  200

Query  660   TRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMA  839
             TRLRKLNEG   ATLLALAGLKRLDMT ++T IL IE+MLPAV+QGAIGIACR+ D+   
Sbjct  201   TRLRKLNEGACSATLLALAGLKRLDMTAHITKILSIEEMLPAVSQGAIGIACRTQDDASR  260

Query  840   NYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVI  1019
               +A+LNHEETR+AVVCERAFL  LDGSCRTPIAGYA +G DG   F GLVA+PDG +++
Sbjct  261   KLLAALNHEETRIAVVCERAFLAALDGSCRTPIAGYAHKGSDGQLHFSGLVATPDGKQMM  320

Query  1020  ETSRKGPYTLNDMVLMGEDAGKEL  1091
              TSR   +T  D V  GEDAG+EL
Sbjct  321   RTSRVASFTDADAVKAGEDAGREL  344



>ref|XP_003607332.1| Porphobilinogen deaminase [Medicago truncatula]
Length=228

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = +3

Query  441   MKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYP  620
             MKDVPTYLP+KTILPCNLPREDVRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYP
Sbjct  1     MKDVPTYLPEKTILPCNLPREDVRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYP  60

Query  621   SLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGA  800
             SL V +NFRGNVQTRLRKL+EGVV+ATLLALAGLKRL+MTENVTS L I+DMLPAVAQGA
Sbjct  61    SLSVQDNFRGNVQTRLRKLSEGVVKATLLALAGLKRLNMTENVTSTLSIDDMLPAVAQGA  120

Query  801   IGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIF  980
             IGIACRS+D+KMA Y+ASLNHEETRLA+ CERAFLTTLDGSCRTPIAGYA R +DG+C+F
Sbjct  121   IGIACRSNDDKMAEYLASLNHEETRLAISCERAFLTTLDGSCRTPIAGYASRDKDGNCLF  180

Query  981   KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             +GLVASPDGTRV+ETSR GPY   DM+ MG DAG+ELL +AGPGFF +
Sbjct  181   RGLVASPDGTRVLETSRIGPYAYEDMMKMGRDAGEELLSRAGPGFFNS  228



>ref|XP_005649123.1| porphobilinogen deaminase [Coccomyxa subellipsoidea C-169]
 gb|EIE24579.1| porphobilinogen deaminase [Coccomyxa subellipsoidea C-169]
Length=359

 Score =   385 bits (989),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 224/306 (73%), Positives = 256/306 (84%), Gaps = 1/306 (0%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAY TRD L A+ P+L EEGA+EI IIKTTGDKIL+QPLADIGGKGL
Sbjct  51    VKIGTRGSPLALAQAYMTRDLLKAAFPDLQEEGALEICIIKTTGDKILNQPLADIGGKGL  110

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEID+AL+   IDIAVHSMKDVPTYLP  TILPCNLPREDVRDAFIS  A+SL +LPA
Sbjct  111   FTKEIDDALLEGRIDIAVHSMKDVPTYLPPGTILPCNLPREDVRDAFISPIASSLGELPA  170

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VG+ASLRR++QILH+YP LKV ENFRGNVQTR+RKLNEGV  ATLLALAGLKRLD+ 
Sbjct  171   GSLVGSASLRRQAQILHKYPHLKV-ENFRGNVQTRMRKLNEGVCAATLLALAGLKRLDLA  229

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +  T+IL  EDMLPAVAQGAIGIACR  D    + +ASLNHE+TRLAV+CERAFLT LDG
Sbjct  230   DKATAILSTEDMLPAVAQGAIGIACREGDSAAGDLLASLNHEDTRLAVLCERAFLTALDG  289

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG A+R   G   F+GL+ASPDG ++ ETSR+G YT  +MV +G +AG+EL  Q
Sbjct  290   SCRTPIAGLAQRNASGGLSFRGLIASPDGAKIFETSREGNYTEEEMVRLGREAGEELKAQ  349

Query  1101  AGPGFF  1118
             AGP F 
Sbjct  350   AGPEFL  355



>ref|XP_011396337.1| Porphobilinogen deaminase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23465.1| Porphobilinogen deaminase, chloroplastic [Auxenochlorella protothecoides]
Length=367

 Score =   376 bits (966),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 212/331 (64%), Positives = 260/331 (79%), Gaps = 8/331 (2%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             R +++  VRAS +V     KT    +++GTRGSPLALAQAY TRD L A+ P L E+GA+
Sbjct  43    RRSRAASVRASASV---GTKT----LKVGTRGSPLALAQAYLTRDLLKAAFPHLQEDGAL  95

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             E++IIKTTGDK+L+QPLADIGGKGLFTKEID+AL+   IDI VHSMKDVPTYLP+ T+LP
Sbjct  96    EVVIIKTTGDKVLNQPLADIGGKGLFTKEIDDALLEGRIDIGVHSMKDVPTYLPEGTVLP  155

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             CNLPRED RD FIS   +SLA+LP G+ VG+ASLRR++Q+LH YP L+V+ NFRGNVQTR
Sbjct  156   CNLPREDPRDVFISARYSSLAELPEGAVVGSASLRRQAQLLHTYPHLRVV-NFRGNVQTR  214

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             LRKL EG   ATLLALAGLKRL + +  TSIL +EDMLPAV+QGAIGIACR  DE +  Y
Sbjct  215   LRKLQEGACDATLLALAGLKRLGLEDKATSILGLEDMLPAVSQGAIGIACREGDEPVLEY  274

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             + +L+HE+TRLAVVCERAFL  LDGSCRTPIAG A++  DG   F+GLVA  +G ++ +T
Sbjct  275   LRTLSHEDTRLAVVCERAFLAALDGSCRTPIAGLAQKTADGRLSFRGLVADTEGKQLFQT  334

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             +R+GP T  D V MG+DAG +L  +AG  FF
Sbjct  335   TREGPATEEDAVAMGKDAGAQLKREAGADFF  365



>ref|XP_007509251.1| porphobilinogen deaminase [Bathycoccus prasinos]
 emb|CCO19708.1| porphobilinogen deaminase [Bathycoccus prasinos]
Length=376

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 264/342 (77%), Gaps = 7/342 (2%)
 Frame = +3

Query  99    KSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASH  278
             K+S   +P  +T+    R+S+ V+ +  +    IIRIGTRGSPLALAQAY TRD L    
Sbjct  30    KNSNFGKPQFTTRR--YRSSVRVQAELDE---PIIRIGTRGSPLALAQAYMTRDLLAKQF  84

Query  279   PelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPT  458
             PELAEEGA+EI IIKTTGDK+L +PLADIGGKGLFT+E+D+AL++  ++IAVHSMKDVPT
Sbjct  85    PELAEEGALEIAIIKTTGDKVLDKPLADIGGKGLFTRELDDALLDGRVNIAVHSMKDVPT  144

Query  459   YLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLE  638
             YLP+ TILPC LPREDVRDAFI L   SL+ LP G+ VGTASLRR+SQ+L +YP LK + 
Sbjct  145   YLPEGTILPCMLPREDVRDAFICLKYDSLSALPTGALVGTASLRRQSQLLWKYPELKCV-  203

Query  639   NFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACR  818
             NFRGNVQ+R+RKL E VV  TLLALAGLKR+D+TE+ T IL  EDMLPAVAQGAIGIACR
Sbjct  204   NFRGNVQSRIRKLKEEVVDCTLLALAGLKRMDLTEHATKILDFEDMLPAVAQGAIGIACR  263

Query  819   SDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVAS  998
             ++D+KM  Y++ LNHEETRLAV CER FL  LDGSCRTPIA  AR   +G  +F GL+AS
Sbjct  264   TNDDKMQEYLSKLNHEETRLAVECERNFLRALDGSCRTPIAANARM-VNGHLVFDGLIAS  322

Query  999   PDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
              DGT ++ TSR+G ++ +D++  G DAG EL  +A   FF N
Sbjct  323   LDGTEILRTSREGSWSADDVLAAGTDAGDELKAKAPKDFFAN  364



>ref|XP_005843555.1| hypothetical protein CHLNCDRAFT_33052 [Chlorella variabilis]
 gb|EFN51453.1| hypothetical protein CHLNCDRAFT_33052 [Chlorella variabilis]
Length=361

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 254/318 (80%), Gaps = 4/318 (1%)
 Frame = +3

Query  150   RASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiiktt  329
             R   A+   A  TK   ++IGTRGSPLALAQAY TRD L ++ PEL EEGA+EIIIIKTT
Sbjct  39    RRGTAIVASAVATKT--LKIGTRGSPLALAQAYLTRDLLKSTFPELNEEGALEIIIIKTT  96

Query  330   gdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDV  509
             GDKIL+QPL+DIGGKGLFTKEID+AL++  IDIAVHSMKDVPTYLP  T+LPCNLPREDV
Sbjct  97    GDKILNQPLSDIGGKGLFTKEIDDALLDGRIDIAVHSMKDVPTYLPAGTVLPCNLPREDV  156

Query  510   RDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGV  689
             RD FIS    S+A+LP G+ VG+ASLRR++QIL +YP+L+V+ NFRGNVQTRLRKL EG 
Sbjct  157   RDVFISAKYKSIAELPEGAVVGSASLRRQAQILAKYPTLQVV-NFRGNVQTRLRKLQEGA  215

Query  690   VQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEE  869
               ATLLALAGLKRL + +  TSIL  ++MLPAVAQGAIGIACR  D++ A  +A+LNHEE
Sbjct  216   CDATLLALAGLKRLGLADKATSILSTDEMLPAVAQGAIGIACREGDDRSAAALAALNHEE  275

Query  870   TRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTL  1049
             TRLA+VCERAFL  LDGSCRTPIAG+A +  DG   F+GLV++PDG ++ ET+R G  T 
Sbjct  276   TRLAIVCERAFLAALDGSCRTPIAGWAHKA-DGQLAFRGLVSTPDGKKMYETTRTGSLTE  334

Query  1050  NDMVLMGEDAGKELLLQA  1103
             ++   +G+DAG EL  QA
Sbjct  335   DEARAIGQDAGTELKQQA  352



>ref|XP_002507564.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
 gb|ACO68822.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
Length=353

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 217/365 (59%), Positives = 268/365 (73%), Gaps = 13/365 (4%)
 Frame = +3

Query  75    FRSLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYET  254
              R+   GF +S P      ++++  R ++ V  +       +I+IGTRGSPLALAQAY T
Sbjct  1     MRARFSGFNASFPLVARGVSRNVRDRGALRVTAEVD---TPVIKIGTRGSPLALAQAYMT  57

Query  255   RDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAV  434
             RD L AS PEL  +GA+EI IIKTTGDK+L QPLADIGGKGLFT+E+D AL++  IDIAV
Sbjct  58    RDLLKASFPELGNDGALEICIIKTTGDKVLDQPLADIGGKGLFTRELDVALLDGRIDIAV  117

Query  435   HSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHR  614
             HSMKDVPTYLP+ TILPC LPREDVRDAFIS+    L++LP GS VGTASLRR+SQ+L R
Sbjct  118   HSMKDVPTYLPEGTILPCMLPREDVRDAFISVKYDDLSELPEGSLVGTASLRRQSQLLAR  177

Query  615   YPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQ  794
             +P LK + NFRGNVQ+R+RKL EGVV  TLLA+AGL R+DMT++ T IL ++ MLPAVAQ
Sbjct  178   FPGLKCV-NFRGNVQSRIRKLQEGVVDCTLLAIAGLNRMDMTQHATKILDVDVMLPAVAQ  236

Query  795   GAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDC  974
             GAIGIACR+ D K   Y+ SLNHEETR+AV CER+FL  LDGSCRTPIAG+AR+  DGD 
Sbjct  237   GAIGIACRTGDSKQITYLESLNHEETRIAVECERSFLAALDGSCRTPIAGFARK--DGDN  294

Query  975   I-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN*IILQIGS*  1151
             + F GLVA+ DG+ ++ETSR   ++  D +  G++AG EL  +A   FF N I       
Sbjct  295   LRFNGLVAALDGSEILETSRVTKWSYADAIAAGKEAGAELKKKAPAEFFANLIE------  348

Query  1152  HLMSW  1166
             H  SW
Sbjct  349   HGGSW  353



>gb|KHN35094.1| Porphobilinogen deaminase, chloroplastic, partial [Glycine soja]
Length=242

 Score =   363 bits (932),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  435   HSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHR  614
             H+  DVPTYLPDKTILPCNLPREDVRDAFISL+AASLADLP  S + TASLRRKSQILHR
Sbjct  29    HTTTDVPTYLPDKTILPCNLPREDVRDAFISLTAASLADLPPASVIDTASLRRKSQILHR  88

Query  615   YPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQ  794
             YPSL V ENFRGNVQTRLRKLNEGVVQATLLALAGLKRL MTENVTSIL I+DMLPAVAQ
Sbjct  89    YPSLNVQENFRGNVQTRLRKLNEGVVQATLLALAGLKRLSMTENVTSILSIDDMLPAVAQ  148

Query  795   GAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDC  974
             GAIGIACRSDD+KMA YIASLNHEETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+C
Sbjct  149   GAIGIACRSDDDKMAEYIASLNHEETRLAVVCERAFLQTLDGSCRTPIAGYACRNEDGNC  208

Query  975   IFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             +F+GLVASPDGTRV+ETSR GPY + DM+ MG
Sbjct  209   LFRGLVASPDGTRVLETSRVGPYAVEDMIEMG  240



>ref|XP_006591520.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Glycine 
max]
Length=259

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  435   HSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHR  614
             H+  DVPTYLPDKTILPCNLPREDVRDAFISL+AASLADLP  S +GTASLRRKSQILHR
Sbjct  46    HTTTDVPTYLPDKTILPCNLPREDVRDAFISLTAASLADLPPASVIGTASLRRKSQILHR  105

Query  615   YPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQ  794
             YPSL V ENFRGNVQTRLRKLNEGVVQATLLALAGLKRL MTENVTSIL I+DMLPAVAQ
Sbjct  106   YPSLNVQENFRGNVQTRLRKLNEGVVQATLLALAGLKRLSMTENVTSILSIDDMLPAVAQ  165

Query  795   GAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDC  974
             GAIGIACRSDD+KMA YIA+LNHEETRLAVVCERAFL TLDGSCRTPIAGYA R EDG+C
Sbjct  166   GAIGIACRSDDDKMAEYIATLNHEETRLAVVCERAFLQTLDGSCRTPIAGYACRNEDGNC  225

Query  975   IFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             +F+GLVASPDGTRV+ETSR GPY + DM+ MG
Sbjct  226   LFRGLVASPDGTRVLETSRVGPYAVEDMIEMG  257



>gb|ABF70029.1| porphobilinogen deaminase, chloroplast (hydroxymethylbilane synthase) 
(pre-uroporphyrinogen synthase), putative [Musa acuminata]
Length=328

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 234/301 (78%), Gaps = 28/301 (9%)
 Frame = +3

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             R S LALAQA ETRDKL A+H ELAEEGA+EIIIIKTTGD IL +PLADIGGKGLFTKEI
Sbjct  54    RDSDLALAQARETRDKLKAAHSELAEEGAVEIIIIKTTGDMILDKPLADIGGKGLFTKEI  113

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             D+AL+   IDIAVHSMKDVPTYLP+ TILPCNLP                          
Sbjct  114   DDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLP--------------------------  147

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
              ASLRR+SQIL RYPSLKV+ N RGNVQTRL KL  G V ATLLALAGLKRL+M ENVTS
Sbjct  148   -ASLRRQSQILCRYPSLKVV-NLRGNVQTRLTKLKNGDVHATLLALAGLKRLNMVENVTS  205

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             IL +E+MLPAVAQGAIGIACRS+D KM  Y++SLNHE+TR AV CER FLT LDG+CRTP
Sbjct  206   ILSMEEMLPAVAQGAIGIACRSNDNKMMEYLSSLNHEDTRSAVACEREFLTVLDGNCRTP  265

Query  936   IAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGF  1115
             IA YA R +DG C F+GL+ASPDG++V ET+R GPY+ +DMV MG+DAG EL  +AGPGF
Sbjct  266   IAAYAHRDKDGSCSFRGLLASPDGSKVYETTRIGPYSFDDMVEMGKDAGHELKAKAGPGF  325

Query  1116  F  1118
             +
Sbjct  326   Y  326



>gb|EMS48955.1| Porphobilinogen deaminase, chloroplastic [Triticum urartu]
Length=305

 Score =   357 bits (916),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 231/265 (87%), Gaps = 1/265 (0%)
 Frame = +3

Query  216   RGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEI  395
             R SPLALAQA +TRD+L A+H ELAE+GAIEI+IIKTTGD IL +PLADIGGKGLFTKEI
Sbjct  36    RDSPLALAQARQTRDELKAAHTELAEDGAIEIVIIKTTGDMILDKPLADIGGKGLFTKEI  95

Query  396   DEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVG  575
             D+AL+   IDIAVHSMKDVPTYLP+  ILPCNLPREDVRDAFI L+A +L +LPAGS +G
Sbjct  96    DDALLQGSIDIAVHSMKDVPTYLPEGMILPCNLPREDVRDAFICLTAKTLGELPAGSVIG  155

Query  576   TASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTS  755
             +ASLRR+SQIL++YPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGLKRL M E  TS
Sbjct  156   SASLRRQSQILYKYPSLKVV-NFRGNVQTRLRKLKEGDVHATLLALAGLKRLGMPETATS  214

Query  756   ILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTP  935
             +L +++MLPAVAQGAIGI CRS+D+KM  Y++SLNHE+TRLAV CER FL+ LDG+CRTP
Sbjct  215   VLSVDEMLPAVAQGAIGITCRSNDDKMMEYLSSLNHEDTRLAVACEREFLSVLDGNCRTP  274

Query  936   IAGYARRGEDGDCIFKGLVASPDGT  1010
             IA YA R +DG+C F+GL+ASPDG+
Sbjct  275   IAAYAYRDKDGNCSFRGLLASPDGS  299



>gb|ACJ83604.1| unknown [Medicago truncatula]
 gb|AFK37427.1| unknown [Medicago truncatula]
Length=214

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/214 (84%), Positives = 196/214 (92%), Gaps = 0/214 (0%)
 Frame = +3

Query  441   MKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYP  620
             MKDVPTYLP+KTILPCNLPREDVRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYP
Sbjct  1     MKDVPTYLPEKTILPCNLPREDVRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYP  60

Query  621   SLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGA  800
             SL V +NFRGNVQTRLRKL+EGVV+ATLLALAG KRL+MTENVTS L I+DMLPAVAQGA
Sbjct  61    SLSVQDNFRGNVQTRLRKLSEGVVKATLLALAGPKRLNMTENVTSTLSIDDMLPAVAQGA  120

Query  801   IGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIF  980
             IGIACRS+D+KMA Y+ASLNHEETRLA+ CERAFLTTLDGSCRTPIAGYA R +DG+C+F
Sbjct  121   IGIACRSNDDKMAEYLASLNHEETRLAISCERAFLTTLDGSCRTPIAGYASRDKDGNCLF  180

Query  981   KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             +GLVASPDGTRV+ETSR GPY   DM+ MG   G
Sbjct  181   RGLVASPDGTRVLETSRIGPYAYEDMMKMGRGCG  214



>ref|XP_008360135.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Malus 
domestica]
Length=306

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 235/259 (91%), Gaps = 1/259 (0%)
 Frame = +3

Query  63   SVSVFR-SLPCGFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALA  239
            +VSV   S+P     + PN   + +   + RAS+AVEQQ QK+K+A+I+IGTRGSPLALA
Sbjct  34   TVSVLHLSMPSLKPRAFPNSIRKHSLIGLPRASVAVEQQTQKSKLALIKIGTRGSPLALA  93

Query  240  QAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAE  419
            QAYETR+KLMASH ELAEEGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN +
Sbjct  94   QAYETREKLMASHTELAEEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINGD  153

Query  420  IDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKS  599
            +DIAVHSMKDVPTYLP+KTILPCNLPREDVRDAFISL+A+SLADLPAGSTVGTASLRRKS
Sbjct  154  VDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLTASSLADLPAGSTVGTASLRRKS  213

Query  600  QILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDML  779
            QILHR+P+L V ENFRGNVQTRL+KLNE VV+ATLLALAGLKRLDMTENVTSIL +++ML
Sbjct  214  QILHRFPTLNVQENFRGNVQTRLKKLNEKVVEATLLALAGLKRLDMTENVTSILSLDEML  273

Query  780  PAVAQGAIGIACRSDDEKM  836
            PAVAQGAIGIACR++D+KM
Sbjct  274  PAVAQGAIGIACRTNDDKM  292



>dbj|BAB41183.1| porphobilinogen deaminase [Amaranthus tricolor]
Length=198

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +3

Query  357  ADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsa  536
            ADIGGKGLFTKEIDEAL+N EIDIAVHSMKDVPTYLPDK ILPCNL REDVRDAFIS +A
Sbjct  1    ADIGGKGLFTKEIDEALLNNEIDIAVHSMKDVPTYLPDKIILPCNLEREDVRDAFISTTA  60

Query  537  asladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALA  716
            +SLADLPAGS VGTASLRRKSQ+LHRYPSL+VL+NFRGNVQTRLRKLNEG+VQATLLALA
Sbjct  61   SSLADLPAGSVVGTASLRRKSQLLHRYPSLEVLDNFRGNVQTRLRKLNEGLVQATLLALA  120

Query  717  GLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCER  896
            GLKRL+MTENV+S+L I+DMLPAVAQGAIGIAC  DD+KMANY+A LNHEET+LAV CER
Sbjct  121  GLKRLNMTENVSSVLSIDDMLPAVAQGAIGIACLQDDDKMANYLALLNHEETQLAVACER  180

Query  897  AFLTTLDGSCRTPIAGYA  950
            AFL TLDGSCRTPIAGYA
Sbjct  181  AFLETLDGSCRTPIAGYA  198



>ref|XP_003056550.1| porphobilinogen deaminase, chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH59926.1| porphobilinogen deaminase, chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=376

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/323 (63%), Positives = 251/323 (78%), Gaps = 8/323 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             I++IGTRGSPLALAQAY TRD L  +  EL+EEGA+EI IIKTTGDK+L QPLADIGGKG
Sbjct  62    IVKIGTRGSPLALAQAYMTRDLLKKNFVELSEEGALEICIIKTTGDKVLDQPLADIGGKG  121

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFT+E+D AL++  IDIAVHSMKDVPTYLP+ +ILPC LPREDVRDAFIS+    L++LP
Sbjct  122   LFTRELDVALLDGRIDIAVHSMKDVPTYLPEGSILPCMLPREDVRDAFISVKYDDLSELP  181

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VGTASLRR+SQ+L ++P+LK + NFRGNVQ+R+RKL EGVV  TLLA+AGL R+DM
Sbjct  182   DGALVGTASLRRQSQLLAKFPTLKCV-NFRGNVQSRIRKLQEGVVDCTLLAIAGLNRMDM  240

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
             TE+ T IL  + MLPAVAQGAIGIACR+ D +   ++  LNHEETR+AV CERAFL +LD
Sbjct  241   TEHATKILETDVMLPAVAQGAIGIACRTGDSRQLEFLEKLNHEETRIAVECERAFLASLD  300

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIAGYA +  + +  F+GLVAS DG +++ET+R   ++  D +  G+DAG EL  
Sbjct  301   GSCRTPIAGYAYKSGN-NLEFRGLVASLDGKQILETTRSSNWSFTDAIDAGKDAGNELKA  359

Query  1098  QAGPGFFGN*IILQIGS*HLMSW  1166
              A   FF N  +L+ G     SW
Sbjct  360   LAPSEFFEN--LLEHGG----SW  376



>gb|AFK34523.1| unknown [Lotus japonicus]
Length=254

 Score =   348 bits (892),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 223/239 (93%), Gaps = 6/239 (3%)
 Frame = +3

Query  147  VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
            V+ASIAVEQ    TK+A+I+IGTRGSPLALAQAYETRDKL+ASH ELAEEGAI+I+IIKT
Sbjct  22   VKASIAVEQ---PTKLALIKIGTRGSPLALAQAYETRDKLIASHSELAEEGAIQIVIIKT  78

Query  327  tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
            TGDKILSQPLADIGGKGLFTKEIDEAL+N EIDIAVHSMKDVPTYLPDKTILPCNLPRED
Sbjct  79   TGDKILSQPLADIGGKGLFTKEIDEALLNGEIDIAVHSMKDVPTYLPDKTILPCNLPRED  138

Query  507  VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
            VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V +NFRGNVQTRL+KLNEG
Sbjct  139  VRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYPSLNVQDNFRGNVQTRLKKLNEG  198

Query  687  VVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNH  863
            VV+ATLLALAGLKRL+MTENVTS L IE+MLPAVAQGAIGIACRSDD+K  N   +L+H
Sbjct  199  VVKATLLALAGLKRLNMTENVTSTLSIEEMLPAVAQGAIGIACRSDDDKWQN---TLHH  254



>gb|KDO52734.1| hypothetical protein CISIN_1g020472mg [Citrus sinensis]
Length=326

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 210/256 (82%), Positives = 229/256 (89%), Gaps = 10/256 (4%)
 Frame = +3

Query  93   GFKS---STPNQP--IRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETR  257
            GF S    TP+ P  ++     +VRAS AVE     TKVAIIRIGTRGSPLALAQA+ETR
Sbjct  32   GFSSPRLKTPSFPKSLKKRSFGLVRASAAVE-----TKVAIIRIGTRGSPLALAQAHETR  86

Query  258  DKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVH  437
            +KLMA HPELA+EGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN++IDIAVH
Sbjct  87   NKLMALHPELAQEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINSQIDIAVH  146

Query  438  SMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRY  617
            SMKDVPTYLP+KTILPCNL REDVRDAFISLSAASLA+LPAGS VGTASLRRKSQILHRY
Sbjct  147  SMKDVPTYLPEKTILPCNLQREDVRDAFISLSAASLAELPAGSIVGTASLRRKSQILHRY  206

Query  618  PSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQG  797
            PSLKV+ENFRGNVQTRLRKLNE VVQATLLALAGLKRL MTENVT+IL ++DMLPAVAQG
Sbjct  207  PSLKVMENFRGNVQTRLRKLNERVVQATLLALAGLKRLSMTENVTNILSVDDMLPAVAQG  266

Query  798  AIGIACRSDDEKMANY  845
            AIGIACRS+DEKM  +
Sbjct  267  AIGIACRSNDEKMVPF  282



>emb|CEF97893.1| Porphobilinogen deaminase, C-terminal [Ostreococcus tauri]
Length=360

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 249/333 (75%), Gaps = 11/333 (3%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             R+   +VVRA++            I+RIGTRGSPLALAQAY TRD L  + PELAE+GA+
Sbjct  31    RARGGVVVRAAV---------DAPIVRIGTRGSPLALAQAYMTRDLLKENFPELAEDGAL  81

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             EI IIKTTGDK+L QPLADIGGKGLFT+E+D+AL++  IDIAVHSMKDVPTYLP+  +LP
Sbjct  82    EICIIKTTGDKVLDQPLADIGGKGLFTRELDDALLDGRIDIAVHSMKDVPTYLPEGMVLP  141

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             C LPREDVRDAF+ L   SL DLP G+ VGTASLRR+SQ+L++YP+LK + NFRGNVQ+R
Sbjct  142   CMLPREDVRDAFLCLKYDSLDDLPEGAVVGTASLRRQSQLLYKYPTLKCV-NFRGNVQSR  200

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             +RKL E VV  TLLA+AGLKR+D+ ++   I+P E MLPAVAQGAIGI CR  D+K   +
Sbjct  201   IRKLKEEVVDCTLLAIAGLKRMDLAQHAKLIIPTEQMLPAVAQGAIGITCRGGDDKQLAF  260

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +A LNHE+TR+AV  ERAFL  LDGSCRTPIA +     DG   F+GL+AS DG  V+ET
Sbjct  261   LAKLNHEDTRMAVEGERAFLAALDGSCRTPIAAHCHN-VDGKMQFRGLIASLDGKEVLET  319

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             +R+G +    ++  G DAG EL  +A   FF N
Sbjct  320   TREGAWDAASLLAAGTDAGAELKGKAPADFFAN  352



>gb|EWM30321.1| porphobilinogen deaminase [Nannochloropsis gaditana]
Length=364

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 243/306 (79%), Gaps = 4/306 (1%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQAYET+ +L  + PELA EG +EI IIKTTGD IL + L++IGGKGL
Sbjct  46    VRIGTRGSPLALAQAYETKRRLGEAFPELAPEGMVEIKIIKTTGDMILDKALSEIGGKGL  105

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE+D AL+  E+DI VHSMKDVPT+LPD T+LPCNLPRED RD FI   A S+A+LPA
Sbjct  106   FTKELDVALLGDEVDICVHSMKDVPTWLPDGTVLPCNLPREDSRDVFICNKAKSIAELPA  165

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS +G+ASLRR++QIL R P++KV+ NFRGNVQTRLRKL+EGVV AT+LA+AGL R++M 
Sbjct  166   GSVIGSASLRRQAQILARNPNVKVV-NFRGNVQTRLRKLSEGVVDATMLAVAGLNRMNMQ  224

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + VTSIL  ++MLPAVAQGAIGI CRSDD     Y+A+LNH ET++ V CER+FL  LDG
Sbjct  225   DCVTSILDWDEMLPAVAQGAIGIQCRSDDATSLKYLAALNHPETKVCVDCERSFLAELDG  284

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             +C+TPIAG AR  ED    FKGLVA PDGT++ ET + G   L D V +G +AG++L  Q
Sbjct  285   NCKTPIAGQARVIED-KLHFKGLVAMPDGTQMFETEKVG--ALADAVKIGREAGEDLKEQ  341

Query  1101  AGPGFF  1118
             AGP FF
Sbjct  342   AGPEFF  347



>ref|XP_001417948.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96241.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=325

 Score =   343 bits (880),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 198/330 (60%), Positives = 252/330 (76%), Gaps = 11/330 (3%)
 Frame = +3

Query  141   LVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiii  320
             +VVRA++            I++IGTRGSPLALAQAY TRD L  + PELAE+GA+EI II
Sbjct  1     MVVRAAV---------DAPIVKIGTRGSPLALAQAYMTRDLLKENFPELAEDGALEICII  51

Query  321   kttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPR  500
             KTTGDK+L QPLADIGGKGLFT+E+D+AL++  IDIAVHSMKDVPTYLP+  +LPC LPR
Sbjct  52    KTTGDKVLDQPLADIGGKGLFTRELDDALLDGRIDIAVHSMKDVPTYLPEGMVLPCMLPR  111

Query  501   EDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLN  680
             EDVRDAF+ L   SL+ LP G+ VGTASLRR+SQ+L+++P+LK + NFRGNVQ+R+RKL 
Sbjct  112   EDVRDAFLCLKYDSLSQLPEGAVVGTASLRRQSQLLYKFPTLKCV-NFRGNVQSRIRKLK  170

Query  681   EGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLN  860
             E VV  TLLA+AGLKR+D+ ++   I+P E+MLPAVAQGAIGI CR+ D+K   ++A LN
Sbjct  171   EEVVDCTLLAIAGLKRMDLAQHAKVIIPTEEMLPAVAQGAIGITCRAGDDKQLAFLAKLN  230

Query  861   HEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGP  1040
             HE+TR+AV  ER+FL  LDGSCRTPIA +     DG   F+GL+AS DG +V+ET+R+G 
Sbjct  231   HEDTRMAVEGERSFLAALDGSCRTPIAAHCHL-VDGKMQFRGLIASLDGKQVLETTREGA  289

Query  1041  YTLNDMVLMGEDAGKELLLQAGPGFFGN*I  1130
             +    ++  G+DAG EL  +A   FF N I
Sbjct  290   WDAASLLDAGKDAGAELKGKAPADFFANLI  319



>ref|WP_008616862.1| porphobilinogen deaminase [Magnetospirillum sp. SO-1]
 gb|EME70191.1| porphobilinogen deaminase [Magnetospirillum sp. SO-1]
Length=315

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 198/311 (64%), Positives = 242/311 (78%), Gaps = 6/311 (2%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             K+ I+RIGTRGSPLALAQ +ETRD+L A+ P LA +GAI+I +IKTTGD +  +PLA+IG
Sbjct  4     KLPILRIGTRGSPLALAQTHETRDRLAAAWPSLAADGAIDIEVIKTTGDLVQDRPLAEIG  63

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKE+DEA+++  I +AVHSMKDVPT LPD  +LPC L REDVRDAFIS    SLA
Sbjct  64    GKGLFTKELDEAMLSGRIHLAVHSMKDVPTQLPDGIVLPCILAREDVRDAFISRKYRSLA  123

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             DLP G+ VGT+SLRR SQILHR P LKV+ NFRGNVQTRLRKL+EGVV ATLLA+AGL+R
Sbjct  124   DLPQGAVVGTSSLRRGSQILHRRPDLKVV-NFRGNVQTRLRKLDEGVVDATLLAMAGLRR  182

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L + ++ TS L  +DMLPAVAQGAIGI CR+ D++  +Y+A+LN  ++ + V  ERAFLT
Sbjct  183   LGLVQHATSALAEDDMLPAVAQGAIGITCRAGDQESLDYLAALNCPDSFVRVAAERAFLT  242

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              LDGSCRTPIA  A    DGD + F+GL+ SPDGT++   SR G     D   MG+DA +
Sbjct  243   RLDGSCRTPIAALATL--DGDRLSFRGLIVSPDGTKIHAASRTGSRA--DAEAMGKDAAE  298

Query  1086  ELLLQAGPGFF  1118
             EL+ QAGPGFF
Sbjct  299   ELIGQAGPGFF  309



>ref|XP_003079219.1| putative porphobilinogen deaminase (ISS) [Ostreococcus tauri]
Length=441

 Score =   344 bits (883),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 249/333 (75%), Gaps = 11/333 (3%)
 Frame = +3

Query  126   RSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegai  305
             R+   +VVRA++            I+RIGTRGSPLALAQAY TRD L  + PELAE+GA+
Sbjct  31    RARGGVVVRAAV---------DAPIVRIGTRGSPLALAQAYMTRDLLKENFPELAEDGAL  81

Query  306   eiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILP  485
             EI IIKTTGDK+L QPLADIGGKGLFT+E+D+AL++  IDIAVHSMKDVPTYLP+  +LP
Sbjct  82    EICIIKTTGDKVLDQPLADIGGKGLFTRELDDALLDGRIDIAVHSMKDVPTYLPEGMVLP  141

Query  486   CNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTR  665
             C LPREDVRDAF+ L   SL DLP G+ VGTASLRR+SQ+L++YP+LK + NFRGNVQ+R
Sbjct  142   CMLPREDVRDAFLCLKYDSLDDLPEGAVVGTASLRRQSQLLYKYPTLKCV-NFRGNVQSR  200

Query  666   LRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANY  845
             +RKL E VV  TLLA+AGLKR+D+ ++   I+P E MLPAVAQGAIGI CR  D+K   +
Sbjct  201   IRKLKEEVVDCTLLAIAGLKRMDLAQHAKLIIPTEQMLPAVAQGAIGITCRGGDDKQLAF  260

Query  846   IASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIET  1025
             +A LNHE+TR+AV  ERAFL  LDGSCRTPIA +     DG   F+GL+AS DG  V+ET
Sbjct  261   LAKLNHEDTRMAVEGERAFLAALDGSCRTPIAAHC-HNVDGKMQFRGLIASLDGKEVLET  319

Query  1026  SRKGPYTLNDMVLMGEDAGKELLLQAGPGFFGN  1124
             +R+G +    ++  G DAG EL  +A   FF N
Sbjct  320   TREGAWDAASLLAAGTDAGAELKGKAPADFFAN  352



>ref|WP_009869955.1| Porphobilinogen deaminase [Magnetospirillum magnetotacticum]
 gb|KIL97980.1| Porphobilinogen deaminase [Magnetospirillum magnetotacticum MS-1]
Length=315

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 245/311 (79%), Gaps = 6/311 (2%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             K+ I+RIGTRGSPLALAQ +ETRD+L A+   L +EGAI+I +IKTTGD I  +PLA+IG
Sbjct  4     KLPILRIGTRGSPLALAQTHETRDRLAAAWAPLGQEGAIDIEVIKTTGDLIQDRPLAEIG  63

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKE+DEA+++  I +AVHSMKDVPT LPD  +LPC LPREDVRDAFISL AASLA
Sbjct  64    GKGLFTKELDEAMLSGRIHLAVHSMKDVPTLLPDGIVLPCILPREDVRDAFISLKAASLA  123

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             DLP G+ VGT+SLRR +QILHR P LKV+ NFRGNVQTRLRKL+EGVV AT+LA+AGL+R
Sbjct  124   DLPQGAVVGTSSLRRGAQILHRRPDLKVV-NFRGNVQTRLRKLDEGVVDATMLAMAGLRR  182

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L +  +VTS L  +DMLPAVAQGAIGI CR+DDE    ++A+LN  ++ + V  ERAFLT
Sbjct  183   LGLAGHVTSALSEDDMLPAVAQGAIGITCRADDEAAHAFLAALNCPDSFVRVAAERAFLT  242

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              LDGSCRTPIA  A    DGD + F+GL+ SPDGT +  TSR G  + +D   MG+DA +
Sbjct  243   RLDGSCRTPIAALAVL--DGDHLSFRGLIVSPDGTAIHATSRSG--SRSDAEAMGKDAAE  298

Query  1086  ELLLQAGPGFF  1118
             EL+  AGPGFF
Sbjct  299   ELIKVAGPGFF  309



>ref|WP_043745666.1| porphobilinogen deaminase [Magnetospirillum magneticum]
Length=315

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/311 (63%), Positives = 241/311 (77%), Gaps = 6/311 (2%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             K+ I+RIGTRGSPLALAQ +ETRD+L A+   L +EGAI+I +IKTTGD +  +PLA+IG
Sbjct  4     KLPILRIGTRGSPLALAQTHETRDRLAAAWAPLGQEGAIDIEVIKTTGDLVQDRPLAEIG  63

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKE+DEA+++  I +AVHSMKDVPT LPD  +LPC LPREDVRDAF+SL   SLA
Sbjct  64    GKGLFTKELDEAMLSGRIHLAVHSMKDVPTQLPDGIVLPCILPREDVRDAFLSLKVGSLA  123

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LP G+ VGT+SLRR +QILHR P LKV+ NFRGNVQTRLRKL EGVV AT+LA+AGL+R
Sbjct  124   ELPQGAVVGTSSLRRGAQILHRRPDLKVV-NFRGNVQTRLRKLEEGVVDATMLAMAGLRR  182

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L + ++ TS L  +DMLPAVAQGAIGI CR+DD+   +Y+A+LN  ++ + V  ERAFLT
Sbjct  183   LGLAQHATSALSEDDMLPAVAQGAIGITCRADDQASLDYLAALNCPDSFVRVAAERAFLT  242

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              LDGSCRTPIA  A    DGD + F+GL+ SPDGT V  T+R G     D   MG+DA +
Sbjct  243   RLDGSCRTPIAALAEL--DGDRLSFRGLIVSPDGTTVHATARSGSRA--DAEAMGKDAAE  298

Query  1086  ELLLQAGPGFF  1118
             EL+  AGPGFF
Sbjct  299   ELIKVAGPGFF  309



>ref|WP_024079153.1| hydroxymethylbilane synthase [Magnetospirillum gryphiswaldense]
 emb|CDK98120.1| hydroxymethylbilane synthase [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=315

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 241/314 (77%), Gaps = 6/314 (2%)
 Frame = +3

Query  180   QKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLA  359
             +    A + IGTRGSPLALAQ +ETRD+L A+ P LA EGAI I +I+TTGD I ++PLA
Sbjct  3     KTVNTAQLTIGTRGSPLALAQTHETRDRLGAAWPALATEGAIAIQVIQTTGDLIQNRPLA  62

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             +IGGKGLFTKE+D+++++  ID+AVHSMKDVPT LPD  +LPC LPREDVRDAF+SL A 
Sbjct  63    EIGGKGLFTKELDDSMLDGRIDLAVHSMKDVPTVLPDGIVLPCVLPREDVRDAFLSLKAK  122

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
              + DLP G+ VGTASLRR +QILHR P L+V+ NFRGNVQ+RLRKL+EGVV ATLLA+AG
Sbjct  123   GIDDLPQGAVVGTASLRRGAQILHRRPDLQVV-NFRGNVQSRLRKLSEGVVDATLLAMAG  181

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L RL ++E+VT  L  ++MLPAVAQGAIGI CR+DD K  +++A+LN  ET + +  ERA
Sbjct  182   LNRLGLSEHVTRALETDEMLPAVAQGAIGITCRADDRKSLDFLAALNCPETMIRITAERA  241

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             FL TLDGSCRTPIA  A    DGD + F+GL+ S DG  +   SR+G  T+ D   MG D
Sbjct  242   FLLTLDGSCRTPIAALAE--VDGDRLSFRGLIVSLDGRTIHAASRQG--TVGDAHAMGVD  297

Query  1077  AGKELLLQAGPGFF  1118
             AG+EL+  AGPGFF
Sbjct  298   AGRELIQVAGPGFF  311



>ref|WP_014415752.1| porphobilinogen deaminase [Rhodospirillum photometricum]
 emb|CCG09121.1| Porphobilinogen deaminase [Rhodospirillum photometricum DSM 122]
Length=318

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/310 (61%), Positives = 230/310 (74%), Gaps = 7/310 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             + IGTRGSPLALAQ ++ RD L A+HPEL+E GAI I +IKTTGD IL +PLA+IGGKGL
Sbjct  7     LTIGTRGSPLALAQTHQVRDLLAAAHPELSEPGAIAIEVIKTTGDAILDRPLAEIGGKGL  66

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEIDEA+++  IDIAVHSMKDVPTYLPD  +LPC L REDVRDA I     S+  LP 
Sbjct  67    FTKEIDEAMLSGRIDIAVHSMKDVPTYLPDGIVLPCMLEREDVRDAVIGRDHPSIDALPL  126

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGTASLRR +QIL + P LKV+ +FRGNVQTRL KL  G V ATLLA AGL RL M 
Sbjct  127   GAVVGTASLRRGAQILAKRPDLKVV-SFRGNVQTRLAKLARGEVDATLLAKAGLNRLGMA  185

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +TS+L ++ MLPAVAQGA+G+ CR+DDE    ++A LNH ET L V  ERAFL  LDG
Sbjct  186   DKITSLLEVDQMLPAVAQGAVGVTCRADDEAAHRWLAPLNHAETFLCVTVERAFLAKLDG  245

Query  921   SCRTPIAGYARRGEDGD----CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
             SCRTPI G AR  + G       F+G++ SPDG  + +T+R+G  ++ + V +G+DAG E
Sbjct  246   SCRTPIGGLARVSDFGTDQARVFFRGMIISPDGKVIHQTTREG--SVAEAVALGDDAGAE  303

Query  1089  LLLQAGPGFF  1118
             LL +AGP FF
Sbjct  304   LLAKAGPNFF  313



>ref|WP_021132426.1| porphobilinogen deaminase [Phaeospirillum fulvum]
 gb|EPY01527.1| porphobilinogen deaminase [Phaeospirillum fulvum MGU-K5]
Length=322

 Score =   328 bits (841),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 236/312 (76%), Gaps = 11/312 (4%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelae-----egaieiiiikttgdkilSQPLADI  365
             IRIGTRGSPLALAQ YETR++L A+ P+LA+        +EI +IKTTGD +L +PL++I
Sbjct  11    IRIGTRGSPLALAQTYETRERLAAAWPDLAQPPVGGVDPVEIEVIKTTGDMVLDRPLSEI  70

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFT+E+DEA+++  I IAVHSMKDVPTYLPD  ILPC LPREDVRDAFI L A S+
Sbjct  71    GGKGLFTRELDEAMLDGRIRIAVHSMKDVPTYLPDGIILPCILPREDVRDAFICLKAKSI  130

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             ADLPAGS +G++SLRR +QIL+R P LKV+ NFRGNVQTR+RKL EGVV ATLLA+AG++
Sbjct  131   ADLPAGSVIGSSSLRRGAQILNRRPDLKVV-NFRGNVQTRMRKLEEGVVDATLLAMAGMR  189

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL + +++T  +  EDMLPAVAQGAIGI CR+DDE+   Y+  LN +++   V  ERAFL
Sbjct  190   RLGLEKHITGSIETEDMLPAVAQGAIGITCRADDEEALRYLEPLNCKDSFDRVAAERAFL  249

Query  906   TTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             T LDGSCRTPIA  A    DGD   F+GL+ SPDG  V  TSR G  T  D V M  DA 
Sbjct  250   TKLDGSCRTPIAALATL--DGDQMFFRGLIVSPDGKTVHSTSRTG--TRADGVAMAIDAA  305

Query  1083  KELLLQAGPGFF  1118
             +EL   AGPGFF
Sbjct  306   EELFKAAGPGFF  317



>gb|KJB31851.1| hypothetical protein B456_005G211000 [Gossypium raimondii]
Length=282

 Score =   325 bits (834),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 199/231 (86%), Positives = 220/231 (95%), Gaps = 6/231 (3%)
 Frame = +3

Query  144  VVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik  323
            V++AS+A      KT+VA++RIGTRGSPLALAQA+ETRDKLMASHPELAEEGAI+I++IK
Sbjct  56   VIKASVA------KTEVALVRIGTRGSPLALAQAHETRDKLMASHPELAEEGAIKIVVIK  109

Query  324  ttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRE  503
            TTGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRE
Sbjct  110  TTGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRE  169

Query  504  DVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNE  683
            DVRDAFISLSA+SLA+LPAGS +GTASLRRKSQIL+RYPSLKV +NFRGNVQTRLRKLNE
Sbjct  170  DVRDAFISLSASSLAELPAGSVIGTASLRRKSQILYRYPSLKVEDNFRGNVQTRLRKLNE  229

Query  684  GVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKM  836
            GVVQATLLALAGL+RL MTENVTS+LPI +MLPAVAQGAIGIACRS+DEKM
Sbjct  230  GVVQATLLALAGLRRLSMTENVTSVLPIHEMLPAVAQGAIGIACRSNDEKM  280



>ref|XP_002179459.1| hydroxymethylbilane synthase [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC49282.1| hydroxymethylbilane synthase [Phaeodactylum tricornutum CCAP 
1055/1]
Length=329

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 232/308 (75%), Gaps = 6/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQAYETR +L+ + P+L  EGAIEI ++KT GD IL + L ++GGKGL
Sbjct  9     LRIGTRGSPLALAQAYETRKRLIENFPDLEAEGAIEICVLKTQGDMILDKSLMELGGKGL  68

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl--adl  554
             FTKE+D AL++ E+DI VHSMKDVPT+LPD T+LPCNLPRED  DAFI    +     D+
Sbjct  69    FTKELDTALLSDEVDICVHSMKDVPTWLPDGTVLPCNLPREDTNDAFIYKDDSVKRIEDI  128

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P GS +GTASLRR++Q++ + P+LK + NFRGNVQTRLRKL++GVV ATLLA+AGLKR+D
Sbjct  129   PDGSVIGTASLRRQAQLMAKNPTLKCV-NFRGNVQTRLRKLDDGVVDATLLAIAGLKRMD  187

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M    TSIL  ++MLPAVAQGAIGI CR DDE+   Y+A+LNH ET+  V CER FL  L
Sbjct  188   MDGCATSILEWDEMLPAVAQGAIGIQCRDDDERSLKYLAALNHPETKACVDCERGFLEAL  247

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DG+C+TPIAG AR   DG  +F+GL+A PDG++  E   +G   + +   +G +AG+ L 
Sbjct  248   DGNCKTPIAGQARI-VDGKIMFRGLIAMPDGSKKFECESEG--AIEEAAKIGREAGEGLK  304

Query  1095  LQAGPGFF  1118
              +AG  FF
Sbjct  305   KEAGEEFF  312



>ref|XP_002292986.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
 gb|EED89447.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
Length=330

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 237/316 (75%), Gaps = 6/316 (2%)
 Frame = +3

Query  177   AQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPL  356
             A++  V  +RIGTRGSPLALAQAYETR +L+ + PEL  EGAIEI ++KT GD IL + L
Sbjct  2     AEEGAVTPLRIGTRGSPLALAQAYETRRRLIENFPELEAEGAIEICVMKTQGDMILDKSL  61

Query  357   ADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsls-  533
              ++GGKGLFTKE+D AL+  E+DI VHSMKDVPT+LP+ T+LPCNLPRED  DAFI+ + 
Sbjct  62    MELGGKGLFTKELDTALLGDEVDICVHSMKDVPTWLPEGTVLPCNLPREDTNDAFITANG  121

Query  534   -aasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
                 +ADLP  S +GTASLRR++QIL + P+LK + NFRGNVQTRLRKL++GVV ATLLA
Sbjct  122   DIKRIADLPDNSVIGTASLRRQAQILAQNPTLKCV-NFRGNVQTRLRKLDDGVVDATLLA  180

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             +AGLKR+DM +  T+IL  ++MLPAVAQGAIGI CRSDD +   YI +LN  +T + V C
Sbjct  181   IAGLKRMDMDDCATAILEWDEMLPAVAQGAIGIQCRSDDTRSLKYIDALNCMDTHVCVNC  240

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             ERAFL  LDG+C+TPIAG AR   DG  +FKGL+A PDG+   ET   G   + D V +G
Sbjct  241   ERAFLEALDGNCKTPIAGQARI-VDGKIVFKGLIAMPDGSLKYETEATGE--IADAVEIG  297

Query  1071  EDAGKELLLQAGPGFF  1118
               AG+EL  QAG  FF
Sbjct  298   RKAGEELKAQAGEKFF  313



>ref|WP_002729267.1| porphobilinogen deaminase [Phaeospirillum molischianum]
 emb|CCG41842.1| Porphobilinogen deaminase, chloroplastic [Phaeospirillum molischianum 
DSM 120]
Length=322

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/312 (62%), Positives = 237/312 (76%), Gaps = 11/312 (4%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelae-----egaieiiiikttgdkilSQPLADI  365
             IRIGTRGSPLALAQ YETR++L A+ P+LA+        +EI +IKTTGD +L +PL++I
Sbjct  11    IRIGTRGSPLALAQTYETRERLAAAWPDLAQPPVGGVDPVEIEVIKTTGDMVLDRPLSEI  70

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFT+E+D+A+++  I IAVHSMKDVPTYLPD  +LPC LPREDVRDAFI L A S+
Sbjct  71    GGKGLFTRELDDAMLDGRIRIAVHSMKDVPTYLPDGIVLPCILPREDVRDAFICLKAKSI  130

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             ADLPAGS +G++SLRR +QIL+R P LKV+ NFRGNVQTR+RKL EGVV ATLLA+AG++
Sbjct  131   ADLPAGSVIGSSSLRRGAQILNRRPDLKVV-NFRGNVQTRMRKLEEGVVDATLLAMAGMR  189

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL + +++T  +  EDMLPAVAQGAIGI CR+DDE    Y+A LN +++   V  ERAFL
Sbjct  190   RLGLQQHITGSIETEDMLPAVAQGAIGITCRADDEDALRYLAPLNCQDSFDRVTAERAFL  249

Query  906   TTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             T LDGSCRTPIA  A    DGD + F+GL+ SPDG  +  TSR G  +  D V M  DA 
Sbjct  250   TKLDGSCRTPIAALATL--DGDTMFFRGLIVSPDGKALHSTSRTG--SRADGVAMAIDAA  305

Query  1083  KELLLQAGPGFF  1118
             +EL   AGPGFF
Sbjct  306   EELFKAAGPGFF  317



>ref|WP_019645838.1| hypothetical protein [Novispirillum itersonii]
Length=315

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 195/309 (63%), Positives = 232/309 (75%), Gaps = 4/309 (1%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             A +RIGTRGSPLALAQA+ETRD+L+A+HP LA EGAIEI+IIKTTGD +  +PL++IGGK
Sbjct  5     AKVRIGTRGSPLALAQAHETRDRLIAAHPHLAVEGAIEIVIIKTTGDTVQDRPLSEIGGK  64

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFT+EID+A++  EI IAVHSMKDVPT+LPD  ILPC L RED RDAFI L AASLADL
Sbjct  65    GLFTREIDDAMLAGEIHIAVHSMKDVPTWLPDGIILPCMLEREDPRDAFICLKAASLADL  124

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P+G+ VG+ASLRR++QI  RYP L+V E  RGNVQTRLRKL EGVV ATLLA AGL RL 
Sbjct  125   PSGAVVGSASLRRQAQIRARYPHLRV-EVLRGNVQTRLRKLEEGVVDATLLARAGLNRLG  183

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M + +T  L +EDMLPAVAQGAIGI CR+DD +    +A LNH +T   V CERAFL  L
Sbjct  184   MADRITGTLSVEDMLPAVAQGAIGITCRADDTESQTLLAPLNHADTFDRVTCERAFLARL  243

Query  915   DGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSCRTPIAG A    DG  + F+GL+A PDG+ V+  S  G    +D   +G    + L
Sbjct  244   DGSCRTPIAGLAELSADGSRLSFRGLMARPDGSEVLSDS--GDAARSDGAALGVQVAERL  301

Query  1092  LLQAGPGFF  1118
             L +AG  F 
Sbjct  302   LSRAGDAFL  310



>gb|EJK45103.1| hypothetical protein THAOC_36301 [Thalassiosira oceanica]
Length=361

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 237/316 (75%), Gaps = 6/316 (2%)
 Frame = +3

Query  177   AQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPL  356
             A+  +V  +RIGTRGSPLALAQAYETR +L+ + PEL E+GAIEI ++KT GD IL + L
Sbjct  33    AEDGEVKPLRIGTRGSPLALAQAYETRRRLIENFPELEEDGAIEICVMKTQGDMILDKSL  92

Query  357   ADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl--  530
              ++GGKGLFTKE+D AL+  E+DI VHSMKDVPT+LPD T+LPCNLPRED  DAFI+   
Sbjct  93    MELGGKGLFTKELDTALLGDEVDICVHSMKDVPTWLPDGTVLPCNLPREDTNDAFITANG  152

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
                ++ADLP  S +GTASLRR++Q+L + P+ K + NFRGNVQTRLRKL++GVV ATLLA
Sbjct  153   EIKTIADLPDNSVIGTASLRRQAQLLAQNPTFKCV-NFRGNVQTRLRKLDDGVVDATLLA  211

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             +AGLKR++M +  T++L  E+MLPAVAQGAIGI CRSDDE+   YI +LN  +T + V C
Sbjct  212   IAGLKRMEMQDCATAVLDWEEMLPAVAQGAIGIQCRSDDERSLKYIDALNCMDTHVCVNC  271

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMG  1070
             ER FL  LDG+C+TPIAG AR   DG  +F+GL+A PDG+   ET   G   + D V +G
Sbjct  272   ERGFLEALDGNCKTPIAGQARI-IDGKIVFRGLIAMPDGSEKYETEATG--AIEDAVEIG  328

Query  1071  EDAGKELLLQAGPGFF  1118
               AG+EL  +AG  FF
Sbjct  329   RKAGEELKERAGDKFF  344



>gb|KIY94897.1| hydroxymethylbilane synthase [Monoraphidium neglectum]
Length=319

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 190/257 (74%), Positives = 216/257 (84%), Gaps = 3/257 (1%)
 Frame = +3

Query  171  QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
            Q A  TK   ++IGTRGSPLALAQAY TRD L A+  ELAEEGA+EI+IIKTTGDKIL+Q
Sbjct  34   QAATATKT--VKIGTRGSPLALAQAYMTRDLLKANFAELAEEGALEIVIIKTTGDKILNQ  91

Query  351  PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
            PLADIGGKGLFTKEID+AL++  IDIAVHSMKDVPTYLP+ TILPCNLPREDVRD FIS 
Sbjct  92   PLADIGGKGLFTKEIDDALLDGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDVFISP  151

Query  531  saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
             A  L++LP G+ VG+ASLRR++QIL +YP LKV+ NFRGNVQTRLRKL EG   ATLLA
Sbjct  152  VAKDLSELPEGAIVGSASLRRQAQILAKYPHLKVV-NFRGNVQTRLRKLQEGECSATLLA  210

Query  711  LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
            LAGLKRLDMT+++T IL  E+MLPAV+QGAIGIACR+DD   A Y+A LNHEETR+AVV 
Sbjct  211  LAGLKRLDMTQHITKILDNEEMLPAVSQGAIGIACRTDDGAAARYLAGLNHEETRVAVVT  270

Query  891  ERAFLTTLDGSCRTPIA  941
            ERAFLT LDGSCR   A
Sbjct  271  ERAFLTALDGSCRCAAA  287



>gb|ABD51930.1| chloroplast hydroxymethylbilane synthase [Guillardia theta]
Length=346

 Score =   323 bits (827),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 230/311 (74%), Gaps = 6/311 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPel--aeegaieiiiikttgdkilSQPLADIGG  371
             +I++GTRGSPLALAQAYETR +L    PE    +   + I II T+GD  LS+ L++IGG
Sbjct  18    VIKLGTRGSPLALAQAYETRRRLAELFPEELGEKGEKVSINIINTSGDMELSKALSEIGG  77

Query  372   KGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaaslad  551
             KGLFTKE+D AL+  E+D  VHSMKDVPTYLPD T L   LPRED RDAFIS    S  +
Sbjct  78    KGLFTKELDVALLKKEVDFCVHSMKDVPTYLPDGTHLEAMLPREDTRDAFISPKYQSFEE  137

Query  552   lPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL  731
             +P G+ +G+ASLRR++QI  + P +K + NFRGNVQTRLRKL++ VV ATLLALAGLKR+
Sbjct  138   MPEGTVIGSASLRRQAQIFAKNPKIKCV-NFRGNVQTRLRKLDDEVVDATLLALAGLKRM  196

Query  732   DMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTT  911
             +M + VT +L  ++MLPAVAQGAIGI  RSDD+K   YI++LNH++T+  V CER+FL T
Sbjct  197   NMADCVTKVLDWDEMLPAVAQGAIGIQVRSDDDKTLKYISALNHKDTKTCVDCERSFLAT  256

Query  912   LDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             LDGSC+TPIAG AR   DG   F+GLVASPDG+++    R G   ++D + +G+DAG+E+
Sbjct  257   LDGSCKTPIAGQARI-IDGKIHFRGLVASPDGSKIFRAERVG--DVSDYMKIGKDAGEEI  313

Query  1092  LLQAGPGFFGN  1124
               +AG  FF +
Sbjct  314   RKEAGEQFFAD  324



>ref|WP_046022495.1| porphobilinogen deaminase [Magnetospira sp. QH-2]
 emb|CCQ75376.1| Porphobilinogen deaminase [Magnetospira sp. QH-2]
Length=314

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 231/307 (75%), Gaps = 3/307 (1%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             ++RIGTRGSPLALAQA+E RD L A+H +L  EGAIEI+II+TTGD +L +PL+++GGKG
Sbjct  6     LLRIGTRGSPLALAQAHEVRDLLKAAHDDLVPEGAIEIVIIQTTGDMVLDKPLSEVGGKG  65

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEIDEA ++  +DIAVHSMKDVPT+LPD  IL   LPREDVRD FIS  AASL DLP
Sbjct  66    LFTKEIDEAQLDNRVDIAVHSMKDVPTWLPDGLILSAVLPREDVRDVFISPKAASLGDLP  125

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
             AG+ VGT+SLRR++QIL +YP LKV E FRGNVQTRLRKL EGV  ATLLA AGL RL M
Sbjct  126   AGAVVGTSSLRRQAQILAKYPHLKV-EIFRGNVQTRLRKLGEGVADATLLAKAGLNRLGM  184

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              +  T++L I+D+LPAVAQGA+GI CR++D      +  L+ + +   +  ERA L  LD
Sbjct  185   ADVATAVLDIDDLLPAVAQGAVGITCRAEDSVTQARLVPLHDQTSADRITAERALLEVLD  244

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIA  A    DG    +GLVA PDG+ V+ETSR+GP  ++    MG DAG+EL  
Sbjct  245   GSCRTPIAALAEIESDGQMFLRGLVARPDGSEVLETSRRGP--ISQAYDMGADAGRELKD  302

Query  1098  QAGPGFF  1118
             +AGP FF
Sbjct  303   RAGPDFF  309



>ref|XP_005834478.1| hypothetical protein GUITHDRAFT_162740 [Guillardia theta CCMP2712]
 gb|EKX47498.1| hypothetical protein GUITHDRAFT_162740 [Guillardia theta CCMP2712]
Length=377

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 178/311 (57%), Positives = 230/311 (74%), Gaps = 6/311 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPel--aeegaieiiiikttgdkilSQPLADIGG  371
             +I++GTRGSPLALAQAYETR +L    PE    +   + I II T+GD  LS+ L++IGG
Sbjct  49    VIKLGTRGSPLALAQAYETRRRLAELFPEELGEKGEKVSINIINTSGDMELSKALSEIGG  108

Query  372   KGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaaslad  551
             KGLFTKE+D AL+  E+D  VHSMKDVPTYLPD T L   LPRED RDAFIS    S  +
Sbjct  109   KGLFTKELDVALLKKEVDFCVHSMKDVPTYLPDGTHLEAMLPREDTRDAFISPKYQSFEE  168

Query  552   lPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRL  731
             +P G+ +G+ASLRR++QI  + P +K + NFRGNVQTRLRKL++ VV ATLLALAGLKR+
Sbjct  169   MPEGTVIGSASLRRQAQIFAKNPKIKCV-NFRGNVQTRLRKLDDEVVDATLLALAGLKRM  227

Query  732   DMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTT  911
             +M + VT +L  ++MLPAVAQGAIGI  RSDD+K   YI++LNH++T+  V CER+FL T
Sbjct  228   NMADCVTKVLDWDEMLPAVAQGAIGIQVRSDDDKTLKYISALNHKDTKTCVDCERSFLAT  287

Query  912   LDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             LDGSC+TPIAG AR   DG   F+GLVASPDG+++    R G   ++D + +G+DAG+E+
Sbjct  288   LDGSCKTPIAGQARI-IDGKIHFRGLVASPDGSKIFRAERVG--DVSDYMKIGKDAGEEI  344

Query  1092  LLQAGPGFFGN  1124
               +AG  FF +
Sbjct  345   RKEAGEQFFAD  355



>emb|CBJ30046.1| hydroxymethylbilane synthase, putative chloroplast precursor 
[Ectocarpus siliculosus]
Length=373

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 229/305 (75%), Gaps = 4/305 (1%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             A++ IGTRGSPLALAQAYETR +L     EL EEGA+ I +IKT+GD IL +PL +IGGK
Sbjct  57    ALLTIGTRGSPLALAQAYETRKRLGEQFDELKEEGAVAIQVIKTSGDMILDKPLTEIGGK  116

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKE+D  L+N ++DI VHSMKDVPT++   TILPCNLPRED  DAFIS  A ++A L
Sbjct  117   GLFTKELDVQLLNKDVDICVHSMKDVPTWIVPGTILPCNLPREDTSDAFISNKADNIASL  176

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P GS +G+ASLRR++Q+L   P+ KV+ NFRGNVQTRLRKL+E +V ATLLA AGLKRL+
Sbjct  177   PDGSVIGSASLRRQAQLLRANPTFKVV-NFRGNVQTRLRKLDEEIVDATLLAFAGLKRLE  235

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +  TS+L  + MLPAVAQGAIGI CR +D     Y+A L H+ET+ AV CERAFL  L
Sbjct  236   MAQVATSVLDQDAMLPAVAQGAIGIQCRENDPTFEKYLAGLCHQETKTAVDCERAFLAAL  295

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DG+C+TPIAG AR  E    +F+GL+ASPDG +  +T+R+G     D V MG DAG EL 
Sbjct  296   DGNCKTPIAGQARM-EGEKLVFRGLIASPDGKQFYDTTREGKP--EDAVAMGHDAGMELK  352

Query  1095  LQAGP  1109
              +AGP
Sbjct  353   KRAGP  357



>ref|WP_011391315.1| porphobilinogen deaminase [Rhodospirillum rubrum]
 ref|YP_428649.1| porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
 gb|ABC24362.1| Porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
 gb|AEO50113.1| porphobilinogen deaminase [Rhodospirillum rubrum F11]
Length=321

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 231/310 (75%), Gaps = 7/310 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQ ++ RD L+A++P+L E GA+ I +IKTTGD IL +PL+++GGKGL
Sbjct  10    LRIGTRGSPLALAQTHQVRDLLIAANPDLGEPGAVTIEVIKTTGDAILDRPLSELGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EID+A++   IDIAVHSMKDVPTYLPD  +LPC L REDVRDAF+    A LADLP 
Sbjct  70    FTREIDDAMLAGTIDIAVHSMKDVPTYLPDGIVLPCMLEREDVRDAFLGRDHARLADLPE  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VGTASLRR +QIL   P +KV+ +FRGNVQTRL KL  G   AT+LA+AGL RL M 
Sbjct  130   GSVVGTASLRRGAQILAMRPDIKVI-SFRGNVQTRLDKLARGEADATMLAIAGLNRLGMA  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +  +S+L I++MLPAVAQGA+G+ CR+ DE    ++A LNH  T+L V  ERAFLT LDG
Sbjct  189   DKASSVLEIDEMLPAVAQGAVGVTCRAGDETAHRWLAPLNHRATQLCVEIERAFLTRLDG  248

Query  921   SCRTPIAGYAR--RGED--GDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
             SCRTPI G AR  R ED  G   F+G++   DG  + +T+R+G     D + +G+DAG E
Sbjct  249   SCRTPIGGLARLKRVEDPSGTVFFRGMIIRTDGKVIHQTTREGLAA--DGIALGDDAGAE  306

Query  1089  LLLQAGPGFF  1118
             LL +AGPGFF
Sbjct  307   LLAKAGPGFF  316



>gb|AFW66383.1| hypothetical protein ZEAMMB73_808224 [Zea mays]
Length=298

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 218/243 (90%), Gaps = 1/243 (0%)
 Frame = +3

Query  189  KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
            KV++IRIGTRGSPLALAQA+ETR+KL A+H ELAEE AIEI+IIKTTGD IL +PLADIG
Sbjct  44   KVSLIRIGTRGSPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIG  103

Query  369  GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
            GKGLFTKEID+AL+   IDIAVHSMKDVPTYLP+ TILPCNLPREDVRDAFI L+A SLA
Sbjct  104  GKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLA  163

Query  549  dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
            +LPAGS +G+ASLRR+SQIL+RYPSLKV+ NFRGNVQTRLRKL EG V ATLLALAGL+R
Sbjct  164  ELPAGSVIGSASLRRQSQILYRYPSLKVV-NFRGNVQTRLRKLKEGDVSATLLALAGLRR  222

Query  729  LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
            L+M EN T++L +E+MLPAVAQGAIGIACRS+D+KM  Y+++LNHE+TRLAV CER FL 
Sbjct  223  LNMAENATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLA  282

Query  909  TLD  917
             LD
Sbjct  283  VLD  285



>ref|XP_009037531.1| hypothetical protein AURANDRAFT_27306 [Aureococcus anophagefferens]
 gb|EGB07526.1| hypothetical protein AURANDRAFT_27306 [Aureococcus anophagefferens]
Length=333

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 222/307 (72%), Gaps = 5/307 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttg-dkilSQPLADIGGKG  377
             +RIGTRGSPLALAQAY TR+ LM + PE         + I  T  D IL + L++IGGKG
Sbjct  20    LRIGTRGSPLALAQAYMTRELLMKNFPEELGGEGAIQLCIMKTQGDMILDKALSEIGGKG  79

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKE+D AL+  E+DI VHSMKDVPT+LP KT+LPC L RED RD FIS +A SL DL 
Sbjct  80    LFTKELDVALLGDEVDICVHSMKDVPTWLPAKTVLPCMLEREDTRDVFISPTAKSLKDLK  139

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              GS +G+ASLRR+SQIL   P+LK + NFRGNVQTRLRKL+EGVV ATLLA AGLKR+DM
Sbjct  140   DGSVIGSASLRRQSQILAINPTLKCV-NFRGNVQTRLRKLDEGVVDATLLAYAGLKRMDM  198

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              + VT++L  ++MLPAVAQGAIGI CR DD +   YIA+LNHEET   V CERAFL  LD
Sbjct  199   ADEVTAVLEWDEMLPAVAQGAIGIQCRDDDARALKYIAALNHEETFTCVSCERAFLAALD  258

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             G+C+TPIAG AR   DG+ +F GLV+S DG ++   ++ G     D   +G +AG+ +  
Sbjct  259   GNCKTPIAGQARI-VDGELLFDGLVSSLDGQQMYRATKTGAPA--DAEKIGREAGEGIKA  315

Query  1098  QAGPGFF  1118
             +AG  FF
Sbjct  316   EAGIEFF  322



>ref|WP_038012779.1| porphobilinogen deaminase [Terasakiella pusilla]
Length=314

 Score =   311 bits (797),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 230/307 (75%), Gaps = 6/307 (2%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLALAQAYETRD+L A+H +L  +GAI I +IKTTGD IL +PL++IGGKGLFT
Sbjct  9     IGTRGSPLALAQAYETRDRLQAAHEDLRADGAIAIEVIKTTGDMILDRPLSEIGGKGLFT  68

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEID+A ++  IDIAVHSMKDVPT+LP+   LPC LPRED RD FIS  A +LADLP G+
Sbjct  69    KEIDDAQLDGRIDIAVHSMKDVPTWLPEGISLPCILPREDPRDVFISPKAKTLADLPKGA  128

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VGTASLRR++QI  +YP L+ +  FRGNVQ+RLRKL EGVV ATLLA AG++RL   + 
Sbjct  129   VVGTASLRRQAQIKAKYPHLETI-TFRGNVQSRLRKLEEGVVDATLLANAGMRRLKYEDA  187

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
             +TS++   DMLPAVAQGAIGI+CR+ DE+M NY+A LN E + + V+ ERA L  LDGSC
Sbjct  188   ITSVIEDTDMLPAVAQGAIGISCRTGDERMMNYLAPLNCETSTIRVLAERALLRVLDGSC  247

Query  927   RTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQA  1103
             RTPIA  A    DGD I+ +G++A PDG+ V+    +GP T  D   +G  AG+EL  +A
Sbjct  248   RTPIAALAEI--DGDEIYLRGMLAKPDGSEVLTNEMRGPITDPDG--LGTKAGQELKDRA  303

Query  1104  GPGFFGN  1124
             G  F  +
Sbjct  304   GEDFLSD  310



>ref|XP_005782931.1| hypothetical protein EMIHUDRAFT_423968 [Emiliania huxleyi CCMP1516]
 gb|EOD30502.1| hypothetical protein EMIHUDRAFT_423968 [Emiliania huxleyi CCMP1516]
Length=388

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 223/315 (71%), Gaps = 8/315 (3%)
 Frame = +3

Query  192   VAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkil-SQPLADIG  368
             ++I+++GTRGSPLALAQAYET+ +L  + P+         I +  T   ++  + L D+G
Sbjct  36    MSIVKLGTRGSPLALAQAYETKRRLAEAFPDELGADDAVEIKVIKTTGDMVLDKALKDVG  95

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKE+D +L+N ++D  VHSMKDVPT+L   TILPCNLPRED RDA+IS S     
Sbjct  96    GKGLFTKELDVSLLNGDVDCCVHSMKDVPTWLVPGTILPCNLPREDTRDAWISPSGKLPQ  155

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             +LP G+ +GTASLRR++Q+    P+ K + NFRGNVQTRL+KL EG+V AT+LA AGL R
Sbjct  156   ELPDGAVIGTASLRRQAQLYAINPTFKCV-NFRGNVQTRLKKLEEGIVDATMLAKAGLNR  214

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             +++ E++T++L  +  LPAVAQGAIGI  R  DEKM+ YI +LNHE T++AV CERAFL 
Sbjct  215   MNLEEHITAVLEWDTCLPAVAQGAIGIQIREKDEKMSRYIGALNHEPTKVAVDCERAFLA  274

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDG+CRTPIAG A+   DG   F+GL+A  DGT V+ TSR GP  L+D   MG +AG+E
Sbjct  275   ALDGNCRTPIAGQAKI-VDGQLRFEGLIAKVDGTTVLRTSRTGP--LSDAAKMGTEAGEE  331

Query  1089  LLLQAGP---GFFGN  1124
             L  + G     FFG 
Sbjct  332   LKAKVGGDALAFFGE  346



>dbj|BAH84857.1| putative porphobilinogen deaminase [Cucumis sativus]
Length=188

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  390  EIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGST  569
            EID+ALIN +IDIAVHSMKDVPTYLP+KTILPCNLPREDVRDAFISLSA S A+LPAGS 
Sbjct  1    EIDDALINGDIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLSAGSFAELPAGSI  60

Query  570  VGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENV  749
            +GTASLRRKSQ+L+RYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL+RL+MTENV
Sbjct  61   IGTASLRRKSQLLNRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLRRLNMTENV  120

Query  750  TSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCR  929
            TSIL I++MLPAVAQGAIGIACRSDD+ MANY+ASLNHEETRLAVVCERAFL TLDGSCR
Sbjct  121  TSILSIDEMLPAVAQGAIGIACRSDDDIMANYLASLNHEETRLAVVCERAFLETLDGSCR  180

Query  930  TPIAG  944
            TPIAG
Sbjct  181  TPIAG  185



>dbj|BAE53224.1| Porphobilinogen deaminase [Magnetospirillum magneticum AMB-1]
Length=262

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/258 (63%), Positives = 199/258 (77%), Gaps = 6/258 (2%)
 Frame = +3

Query  348   QPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIs  527
             +PLA+IGGKGLFTKE+DEA+++  I +AVHSMKDVPT LPD  +LPC LPREDVRDAF+S
Sbjct  4     RPLAEIGGKGLFTKELDEAMLSGRIHLAVHSMKDVPTQLPDGIVLPCILPREDVRDAFLS  63

Query  528   lsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLL  707
             L   SLA+LP G+ VGT+SLRR +QILHR P LKV+ NFRGNVQTRLRKL EGVV AT+L
Sbjct  64    LKVGSLAELPQGAVVGTSSLRRGAQILHRRPDLKVV-NFRGNVQTRLRKLEEGVVDATML  122

Query  708   ALAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVV  887
             A+AGL+RL + ++ TS L  +DMLPAVAQGAIGI CR+DD+   +Y+A+LN  ++ + V 
Sbjct  123   AMAGLRRLGLAQHATSALSEDDMLPAVAQGAIGITCRADDQASLDYLAALNCPDSFVRVA  182

Query  888   CERAFLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVL  1064
              ERAFLT LDGSCRTPIA  A    DGD + F+GL+ SPDGT V  T+R G     D   
Sbjct  183   AERAFLTRLDGSCRTPIAALAEL--DGDRLSFRGLIVSPDGTTVHATARSGSRA--DAEA  238

Query  1065  MGEDAGKELLLQAGPGFF  1118
             MG+DA +EL+  AGPGFF
Sbjct  239   MGKDAAEELIKVAGPGFF  256



>ref|WP_045664149.1| porphobilinogen deaminase [Rhodospirillaceae bacterium BRH_c57]
 gb|KJS37246.1| porphobilinogen deaminase [Rhodospirillaceae bacterium BRH_c57]
Length=314

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 173/306 (57%), Positives = 227/306 (74%), Gaps = 3/306 (1%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQA+  RD L+A+H +LAE GA+ + + KTTGD +L +PL++IGGKGL
Sbjct  7     LRIGTRGSPLALAQAHAVRDALVAAHADLAEPGAVSVEVFKTTGDIVLDRPLSEIGGKGL  66

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE+D+A++  +I+IAVHSMKDV T LP   +LP  + RED RDAF+ L A SLADLPA
Sbjct  67    FTKELDDAMLRGDIEIAVHSMKDVATILPPGIVLPTIVEREDPRDAFMCLKAKSLADLPA  126

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS +GTASLRR +Q+ + YP L V+ + RGNVQTR+R+L EG + ATLLA+AGL RL ++
Sbjct  127   GSVIGTASLRRGAQVRNLYPHLSVI-SLRGNVQTRMRRLEEGHIDATLLAMAGLNRLGLS  185

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             ++  ++   EDMLPAVAQGA+GI CR++DE    ++A L H ET + VVCERAFL  LDG
Sbjct  186   QHAAAVFSPEDMLPAVAQGAVGITCRAEDEAAHRWLAPLAHAETTIRVVCERAFLRALDG  245

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG A    +GD   +G +   DG+  ++  R+GP  L D   +G +AG+ELL +
Sbjct  246   SCRTPIAGLAEITPEGDLWLRGCIVRVDGSERLDIERRGP--LADAETIGREAGEELLRR  303

Query  1101  AGPGFF  1118
             AGPGF 
Sbjct  304   AGPGFL  309



>ref|WP_022732749.1| porphobilinogen deaminase [Thalassospira lucentensis]
Length=314

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 226/314 (72%), Gaps = 6/314 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGSPLALAQA+E RDKL A+HPELA EGAI I +I TTGDKIL + L++I
Sbjct  2     TDTAKLRIGTRGSPLALAQAHEVRDKLAAAHPELASEGAIAITVITTTGDKILDRALSEI  61

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFTKEID+AL+  +ID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S 
Sbjct  62    GGKGLFTKEIDDALMGGDIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSF  121

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             A++PAGS +G+ASLRR++ IL++YP LKV+  FRGNVQTRLRKL E  V ATLLA+AGL 
Sbjct  122   AEMPAGSVIGSASLRRQAMILNKYPDLKVI-TFRGNVQTRLRKLGEEQVDATLLAMAGLN  180

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL   E  T+ +  +DMLPAVAQGAIGI  R DD +  ++I++L+ E++ + V  ERA L
Sbjct  181   RLGQPEIATAPIAEDDMLPAVAQGAIGITIREDDTQAKDWISALHCEKSAIRVAGERAAL  240

Query  906   TTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVL---MGED  1076
               LDGSCRTPIA  A   EDG    +  +  PDG+  ++T R       DM      G+D
Sbjct  241   FALDGSCRTPIAALAEYHEDGSMRLRVSIVRPDGSERLDTERH--IAKPDMATASAAGKD  298

Query  1077  AGKELLLQAGPGFF  1118
             AG+EL  + GP F 
Sbjct  299   AGEELKQRGGPDFI  312



>gb|AEQ18820.1| porphobilinogen deaminase [Chromera velia]
Length=375

 Score =   303 bits (777),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 180/307 (59%), Positives = 226/307 (74%), Gaps = 3/307 (1%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             I+ IGTRGS LALAQA+ET+ +L    PELAEEGAIE+ +I TTGD+ L   L++IGGKG
Sbjct  50    ILTIGTRGSMLALAQAHETKRRLGEKFPELAEEGAIELKVISTTGDERLEIALSEIGGKG  109

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKE+D AL+  ++DI VHSMKDVPT+L D TILP NLPRED RD FIS  A  + DLP
Sbjct  110   LFTKELDVALLTKQVDICVHSMKDVPTWLVDGTILPVNLPREDTRDVFISKVAKRIEDLP  169

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VGTASLRR +Q+L++ P +KV+ NFRGNVQTRLRKL+E  V AT+LALAGL RL M
Sbjct  170   EGAVVGTASLRRAAQVLYKNPKVKVV-NFRGNVQTRLRKLDEKQVDATMLALAGLNRLGM  228

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
             T+  TS+L  +++LPAV+QGAIGI CR+DDE++  YIA L   +T+ AV CERAFL  LD
Sbjct  229   TDVATSVLDHDEILPAVSQGAIGIQCRADDERVQKYIAPLGCAKTKAAVDCERAFLGGLD  288

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             G+CRTPIAG+A   EDG   FKG+V+S DG+      ++G   + D   MG++A  E+  
Sbjct  289   GNCRTPIAGHAFITEDGRLKFKGMVSSMDGSEFFYVEKEG--AVEDGPKMGKEAADEITA  346

Query  1098  QAGPGFF  1118
             Q G  F 
Sbjct  347   QCGEEFL  353



>ref|WP_009539461.1| Porphobilinogen deaminase [Caenispirillum salinarum]
 gb|EKV32200.1| Porphobilinogen deaminase [Caenispirillum salinarum AK4]
Length=314

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 178/306 (58%), Positives = 227/306 (74%), Gaps = 3/306 (1%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGSPLA+AQA+E RD+L+A+HP+LAE G +EII +KTTGDKIL +PL++IGGK L
Sbjct  7     IRIGTRGSPLAMAQAHEVRDRLIAAHPDLAEPGRLEIIDVKTTGDKILDRPLSEIGGKAL  66

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE+D+A++  +I+IAVHSMKDV T + D  +LP  LPREDVRDAF+ L+A S+A+L  
Sbjct  67    FTKELDDAMLRGDIEIAVHSMKDVETNILDGIVLPALLPREDVRDAFMCLTAKSIAELKE  126

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGTASLRR +QI  R P ++V+ NFRGNVQ+RLRKL+EG V AT+LA+AGL RL M 
Sbjct  127   GAVVGTASLRRGAQIKARRPDIQVV-NFRGNVQSRLRKLHEGQVDATMLAMAGLNRLGMA  185

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T+ L   +MLPAV QGAIGI CR+ D +    + +LNH+ET   V  ERAFL  LDG
Sbjct  186   EKATAALEPTEMLPAVGQGAIGITCRAGDSESIALVEALNHQETYTCVTAERAFLRRLDG  245

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPI G+ R        F GLV  PDGT ++ET R+GP  +++   + +DAGKEL   
Sbjct  246   SCRTPIGGWCRFTGPDTIRFDGLVVRPDGTGLLETFREGP--VSEAHALADDAGKELKAH  303

Query  1101  AGPGFF  1118
              GP +F
Sbjct  304   CGPEYF  309



>gb|KIZ01397.1| hypothetical protein MNEG_6565 [Monoraphidium neglectum]
Length=417

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 181/224 (81%), Gaps = 1/224 (0%)
 Frame = +3

Query  447   DVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSL  626
             DVPTYLP+ TILPCNLPREDVRD FIS  A  L++LP G+ VG+ASLRR++QIL +YP L
Sbjct  193   DVPTYLPEGTILPCNLPREDVRDVFISPVAKDLSELPEGAIVGSASLRRQAQILAKYPHL  252

Query  627   KVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIG  806
             KV+ NFRGNVQTRLRKL EG   ATLLALAGLKRLDMT+++T IL  E+MLPAV+QGAIG
Sbjct  253   KVV-NFRGNVQTRLRKLQEGECSATLLALAGLKRLDMTQHITKILDNEEMLPAVSQGAIG  311

Query  807   IACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSCRTPIAGYARRGEDGDCIFKG  986
             IACR+DD   A Y+A LNHEETR+AVV ERAFLT LDGSCRTPIAGYA +G DG   F+G
Sbjct  312   IACRTDDSAAARYLAGLNHEETRVAVVTERAFLTALDGSCRTPIAGYAHKGADGQLHFRG  371

Query  987   LVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAGPGFF  1118
             LVASP+G+++ ET+R G +   +   +G +AG+EL  +AGP FF
Sbjct  372   LVASPNGSKIFETTRVGAFDAEEGARLGREAGEELKAKAGPDFF  415


 Score = 92.8 bits (229),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 6/118 (5%)
 Frame = +3

Query  93   GFKSSTPNQPIRSTKSLVVRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMA  272
            G +     +P+    ++V R +  V Q +  TK   ++IGTRGSPLALAQAY TRD L A
Sbjct  13   GVQQRAAGRPV----AVVRRGARMVCQASTATKT--VKIGTRGSPLALAQAYMTRDLLKA  66

Query  273  SHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMK  446
            +  ELAEEGA+EI+IIKTTGDKIL+QPLADIGGKGLFTKEID+AL++  IDIAVHSMK
Sbjct  67   NFAELAEEGALEIVIIKTTGDKILNQPLADIGGKGLFTKEIDDALLDGRIDIAVHSMK  124



>ref|WP_008888587.1| porphobilinogen deaminase [Thalassospira profundimaris]
 gb|EKF09965.1| porphobilinogen deaminase [Thalassospira profundimaris WP0211]
Length=314

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 224/313 (72%), Gaps = 4/313 (1%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGSPLALAQA+E RDKL  +HPELAEEGAI + +I TTGDKIL + L++I
Sbjct  2     TDTAKLRIGTRGSPLALAQAHEVRDKLANAHPELAEEGAIAVTVITTTGDKILDRALSEI  61

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFTKEID+AL+  EID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S 
Sbjct  62    GGKGLFTKEIDDALMGGEIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSF  121

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             A++PAGS +G+ASLRR++ IL++YP LKV+  FRGNVQTRLRKL+E  V ATLLA+AGL 
Sbjct  122   AEMPAGSVIGSASLRRQAMILNKYPDLKVV-TFRGNVQTRLRKLSEEQVDATLLAMAGLN  180

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL   +  T+ +  +DMLPAVAQGAIGI  R DD +   ++A+L+ E + + V  ERA L
Sbjct  181   RLGQPDIATAPISEDDMLPAVAQGAIGITIREDDAQCKKWLAALHCETSAIRVAAERAAL  240

Query  906   TTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSR--KGPYTLNDMVLMGEDA  1079
               LDGSCRTPIA  A   +DG    +  +  PDG+  ++T R    P     M   G DA
Sbjct  241   KALDGSCRTPIAALAEFQDDGSLRLRVSIVRPDGSERLDTERMIAKPDIATAMA-AGTDA  299

Query  1080  GKELLLQAGPGFF  1118
             G+EL  + GP F 
Sbjct  300   GEELKQRGGPDFI  312



>ref|WP_033070431.1| porphobilinogen deaminase [Thalassospira australica]
Length=314

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 221/313 (71%), Gaps = 4/313 (1%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGSPLALAQA+E RDKL  +HPELAE+GAI I +I TTGDK+  + L++I
Sbjct  2     TDTAKLRIGTRGSPLALAQAHEVRDKLANAHPELAEDGAIAITVITTTGDKVQDRALSEI  61

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFTKEID+AL+  EID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S 
Sbjct  62    GGKGLFTKEIDDALLGGEIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSF  121

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             A++PAGS +G+ASLRR++ IL+++P LKV+  FRGNVQTRLRKL E  V ATLLA+AGL 
Sbjct  122   AEMPAGSVIGSASLRRQAMILNKFPDLKVV-TFRGNVQTRLRKLREEQVDATLLAMAGLN  180

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL   E  T+ +   DMLPAVAQGAIGI  R  D +  N+I+ L+ E + + VV ERA L
Sbjct  181   RLGQPEIATAPIAENDMLPAVAQGAIGITIRDGDVQSKNWISVLHCETSAVRVVAERAAL  240

Query  906   TTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSR--KGPYTLNDMVLMGEDA  1079
               LDGSCRTPIA  A   +DGD   +  +  PDG+  ++T R    P  +      G DA
Sbjct  241   KALDGSCRTPIAALAEFQDDGDLRLRVAIVRPDGSERLDTERMINNP-DIASATAAGTDA  299

Query  1080  GKELLLQAGPGFF  1118
             G EL  + GP F 
Sbjct  300   GNELKERGGPDFI  312



>gb|KDO52735.1| hypothetical protein CISIN_1g020472mg [Citrus sinensis]
Length=237

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = +3

Query  267  MASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMK  446
            MA HPELA+EGAI+I+IIKTTGDKILSQPLADIGGKGLFTKEIDEALIN++IDIAVHSMK
Sbjct  1    MALHPELAQEGAIQIVIIKTTGDKILSQPLADIGGKGLFTKEIDEALINSQIDIAVHSMK  60

Query  447  DVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSL  626
            DVPTYLP+KTILPCNL REDVRDAFISLSAASLA+LPAGS VGTASLRRKSQILHRYPSL
Sbjct  61   DVPTYLPEKTILPCNLQREDVRDAFISLSAASLAELPAGSIVGTASLRRKSQILHRYPSL  120

Query  627  KVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTENVTSILPIEDMLPAVAQGAIG  806
            KV+ENFRGNVQTRLRKLNE VVQATLLALAGLKRL MTENVT+IL ++DMLPAVAQGAIG
Sbjct  121  KVMENFRGNVQTRLRKLNERVVQATLLALAGLKRLSMTENVTNILSVDDMLPAVAQGAIG  180

Query  807  IACRSDDEKMANY  845
            IACRS+DEKM  +
Sbjct  181  IACRSNDEKMVPF  193



>ref|WP_044829765.1| porphobilinogen deaminase [Thalassospira sp. HJ]
 gb|KJE34080.1| porphobilinogen deaminase [Thalassospira sp. HJ]
Length=314

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 223/312 (71%), Gaps = 2/312 (1%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGSPLALAQA+E RDKL  +HPELAEEGAI I +I TTGDKIL + L++I
Sbjct  2     TDTAKLRIGTRGSPLALAQAHEVRDKLAKAHPELAEEGAIAITVITTTGDKILDRALSEI  61

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFTKEID+AL+  EID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S 
Sbjct  62    GGKGLFTKEIDDALLGGEIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSF  121

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             A++PAGS +G+ASLRR++ IL++YP LKV+  FRGNVQTRLRKL E  V ATLLA+AGL 
Sbjct  122   AEMPAGSVIGSASLRRQAMILNKYPDLKVV-TFRGNVQTRLRKLGEEQVDATLLAMAGLN  180

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL   +  T+ +  +DMLPAVAQGAIGI  R +D +  +++++L+ E + + V  ERA L
Sbjct  181   RLGQPDIATAPISEDDMLPAVAQGAIGITIRENDTQSKDWLSALHCETSAIRVAAERAAL  240

Query  906   TTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRK-GPYTLNDMVLMGEDAG  1082
               LDGSCRTPIA  A   +DG    +  +  PDG+  ++T R      +      G DAG
Sbjct  241   KALDGSCRTPIAALAEFQDDGSMRLRVSIVRPDGSERLDTERMIAKPDMETASTAGTDAG  300

Query  1083  KELLLQAGPGFF  1118
             +EL  + GP F 
Sbjct  301   EELKQRGGPDFI  312



>ref|WP_044558528.1| porphobilinogen deaminase [Azospirillum sp. B4]
Length=319

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 186/312 (60%), Positives = 225/312 (72%), Gaps = 3/312 (1%)
 Frame = +3

Query  183   KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLAD  362
              T +A +RIGTRGSPLALAQA+ETRD+L A+HP LAE GAIEI++IKTTGD+IL + LA+
Sbjct  8     HTSIAPLRIGTRGSPLALAQAHETRDRLGAAHPHLAEPGAIEIVVIKTTGDRILDRTLAE  67

Query  363   IGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaas  542
              GGKGLFTKEI++AL+  E+D+AVHSMKDVPT LPD   + C LPRED RDA+ S S A 
Sbjct  68    AGGKGLFTKEIEDALLAGEVDLAVHSMKDVPTVLPDGLGITCLLPREDPRDAWFSRSGAG  127

Query  543   ladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL  722
             L DLPAG+ VGTASLRR++Q+L R P L V+   RGNVQTRLRKL EG V ATLLA+AGL
Sbjct  128   LLDLPAGAVVGTASLRRQAQVLARRPDLTVVP-LRGNVQTRLRKLAEGEVDATLLAMAGL  186

Query  723   KRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAF  902
             +RLD+ + VT++L  E MLPAVAQGAIGI  R DD+     +A LN  ET L V  ER  
Sbjct  187   RRLDLADRVTAVLEAEMMLPAVAQGAIGIETRLDDDVTRALLAPLNCAETALRVTAERGV  246

Query  903   LTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
             LT LDGSCRTPIA  AR   DG+   + +  SPDG  ++ TSR+ P      +  G DAG
Sbjct  247   LTALDGSCRTPIAALARVLPDGEMDLEAMALSPDGRTIVTTSRRFPAA--QALAAGLDAG  304

Query  1083  KELLLQAGPGFF  1118
             +EL  +   G F
Sbjct  305   QELKDRLPAGIF  316



>ref|WP_007088688.1| porphobilinogen deaminase [Thalassospira xiamenensis]
 gb|AJD53930.1| porphobilinogen deaminase [Thalassospira xiamenensis M-5 = DSM 
17429]
Length=317

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 170/277 (61%), Positives = 207/277 (75%), Gaps = 1/277 (0%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLA+AQA+E RDKL  +HPELA EGAI I +I TTGDKIL + L++IGGKGL
Sbjct  10    LRIGTRGSPLAMAQAHEVRDKLAKAHPELAAEGAIAITVITTTGDKILDRALSEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEID+AL+  EID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S A++PA
Sbjct  70    FTKEIDDALMGGEIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSFAEMPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS +G+ASLRR++ IL++YP LKV+  FRGNVQTRLRKL EG V ATLLA+AGL RL+  
Sbjct  130   GSVIGSASLRRQAMILNKYPDLKVV-TFRGNVQTRLRKLEEGQVDATLLAMAGLNRLNRP  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T+ +  +DMLPAVAQGAIGI  R  D +  N++++LN   + + V  ERA L  LDG
Sbjct  189   EVATAAISEDDMLPAVAQGAIGITIRETDNQTHNWLSALNCPASAIRVTAERAALRALDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSR  1031
             SCRTPIA  A    DG    +  +  PDG+  ++T R
Sbjct  249   SCRTPIAALAEYLPDGRMRLRVSIVRPDGSERLDTER  285



>ref|WP_037988369.1| porphobilinogen deaminase [Thalassospira permensis]
 gb|KEO58305.1| porphobilinogen deaminase [Thalassospira permensis NBRC 106175]
Length=317

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 170/277 (61%), Positives = 207/277 (75%), Gaps = 1/277 (0%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLA+AQA+E RDKL  +HPELA EGAI I +I TTGDKIL + L++IGGKGL
Sbjct  10    LRIGTRGSPLAMAQAHEVRDKLAKAHPELAAEGAIAITVITTTGDKILDRALSEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEID+AL+  EID+AVHSMKDVPT LPD  ILP  LPREDVRDAFISL   S A++PA
Sbjct  70    FTKEIDDALMGGEIDLAVHSMKDVPTVLPDGMILPTILPREDVRDAFISLKYKSFAEMPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS +G+ASLRR++ IL++YP LKV+  FRGNVQTRLRKL EG V ATLLA+AGL RL+  
Sbjct  130   GSVIGSASLRRQAMILNKYPDLKVV-TFRGNVQTRLRKLEEGQVDATLLAMAGLNRLNRP  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T+ +  +DMLPAVAQGAIGI  R  D +  N++++LN   + + V  ERA L  LDG
Sbjct  189   EVATAAIAEDDMLPAVAQGAIGITIRETDNQTHNWLSALNCPASAIRVTAERAALRALDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSR  1031
             SCRTPIA  A    DG    +  +  PDG+  ++T R
Sbjct  249   SCRTPIAALAEYLPDGRMRLRVSIVRPDGSERLDTER  285



>ref|WP_013950414.1| MULTISPECIES: porphobilinogen deaminase [Hyphomicrobium]
 emb|CCB68024.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase) 
(HMBS) (Pre-uroporphyrinogen synthase) [Hyphomicrobium sp. 
MC1]
Length=310

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/301 (56%), Positives = 217/301 (72%), Gaps = 6/301 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGSPLALAQA+E +D+++A+H     + A+ I +IKTTGD++L +PL++IGGKGL
Sbjct  6     IRIGTRGSPLALAQAHEVKDRIIAAH--GLADEAVTIHVIKTTGDRVLDRPLSEIGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL+  EID+AVHSMKD+ T LPD  ++   LPRED RDAFISL   S A LP 
Sbjct  64    FTKEIEEALLTNEIDVAVHSMKDMQTVLPDGLVIGAVLPREDPRDAFISLRHESFATLPQ  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
              + VGT+SLRRK+Q+LH  P L+V+ +FRGNVQTRLRKL +GV +AT LA+AGLKRL MT
Sbjct  124   NAVVGTSSLRRKAQVLHARPDLRVV-DFRGNVQTRLRKLEDGVAEATFLAVAGLKRLGMT  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E +TS + +E MLPAVAQG IG+  R+ DE +   +A+LN E T  AV  ERAFL  L+G
Sbjct  183   ERITSPVSMEHMLPAVAQGVIGLEIRNGDELVTPIVAALNDETTAWAVAAERAFLARLEG  242

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPI G+     D +  F+G + SPDG +  + SR G   + D   +G  A  E+L Q
Sbjct  243   SCRTPIGGHGIVAGD-EVRFRGQLLSPDGKKCYDVSRTG--NVKDAHDLGLSAADEILNQ  299

Query  1101  A  1103
             A
Sbjct  300   A  300



>ref|WP_026987992.1| porphobilinogen deaminase [Fodinicurvata fenggangensis]
Length=313

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 217/307 (71%), Gaps = 3/307 (1%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             ++++GTRGSPLALAQA E R  L A+HP+L  E AIEI+IIKTTGD++L +PLA+IGGKG
Sbjct  3     LLKLGTRGSPLALAQAEEARRLLAAAHPDLRAEDAIEIVIIKTTGDRVLDRPLAEIGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LF KEI+EAL +  ID AVHSMKDVPT+LPD   +   L RED RDAF S   ASLADLP
Sbjct  63    LFVKEIEEALGDGRIDAAVHSMKDVPTWLPDDYTIAAVLEREDPRDAFFSPHGASLADLP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VG+ASLRR+SQI H  P L+V+ NFRGNVQ+RLRKL EG V ATLLALAGLKRL  
Sbjct  123   HGARVGSASLRRQSQIRHARPDLEVV-NFRGNVQSRLRKLGEGQVDATLLALAGLKRLGR  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              + + ++LP+E+MLPA  QGAIG+ CR +D +   Y+ +++H ET L V  ERA L  L+
Sbjct  182   EDLLQAVLPVEEMLPAAGQGAIGLECRREDARTLEYVRAIDHGETSLRVGAERACLDVLE  241

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIA  A     G+   + LVA PDG+ +    R+GP    + +  G   G+EL  
Sbjct  242   GSCRTPIAALAELTAGGELHLRALVAEPDGSALNRAERRGPADQAEEI--GRAVGQELRT  299

Query  1098  QAGPGFF  1118
              AG  FF
Sbjct  300   AAGEAFF  306



>ref|WP_036561184.1| porphobilinogen deaminase [Oceanicola sp. MCTG156(1a)]
Length=320

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 198/313 (63%), Gaps = 6/313 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  + +RIGTRGSPLALAQAYETR +L  +   PE   E  +              +PL 
Sbjct  7     TPASPLRIGTRGSPLALAQAYETRARLSRAFDLPEEVFEIVVIQTTGDNRRMIEADRPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             +IG KGLFTKEI+EA++  +IDI VHSMKD+P   PD   L C LPREDVRDAF+S    
Sbjct  67    EIGNKGLFTKEIEEAMLQGQIDIGVHSMKDMPVAQPDGLCLTCFLPREDVRDAFVSHQGD  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
              L  L  G  VGT+SLRRK+Q+LHR P L+V+E FRGNVQTRLRKL EGV +AT LA+AG
Sbjct  127   GLTALADGDVVGTSSLRRKAQLLHRRPGLRVVE-FRGNVQTRLRKLEEGVAKATFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L RLDM E   + +  EDMLPAVAQGAIGI  R DD   A  + +++H ET   +  ERA
Sbjct  186   LNRLDMAEVPKTPIAPEDMLPAVAQGAIGIERRIDDTNTAELLEAIHHAETAQRLAAERA  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             FL  LDGSC TPIAG A   E G    +G +  PDG+  +  +R  P  + D   +G + 
Sbjct  246   FLGALDGSCETPIAGLAEI-EGGQIRLRGEILRPDGSEALNDARTAP--IEDGAALGREM  302

Query  1080  GKELLLQAGPGFF  1118
             G  L  QAG GFF
Sbjct  303   GAALRAQAGEGFF  315



>ref|WP_045999655.1| porphobilinogen deaminase [Paracoccus sp. 361]
 gb|KIX19566.1| porphobilinogen deaminase [Paracoccus sp. 361]
Length=309

 Score =   283 bits (724),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 218/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETRD+LMA+H     + A +II IKTTGD++L +PL+ IGGKGL
Sbjct  8     LRIGTRGSVLALAQAHETRDRLMAAH--GLPQDAFQIIPIKTTGDRVLDRPLSQIGGKGL  65

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL    IDIAVHSMKD+PT  PD  ++ C LPREDVRDAF+S   AS+  LP 
Sbjct  66    FTREIEEALTEGAIDIAVHSMKDMPTLQPDGLVIDCLLPREDVRDAFVSPHVASITALPQ  125

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV  AT LA+AGL RLDM 
Sbjct  126   GAVVGSSSLRRRAQLAHRRPDLQLVE-FRGNVQTRLQKLADGVAVATFLAMAGLSRLDMR  184

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                 S +  ++MLPAVAQGAIGI  R+DD+  A  ++S+N   T L +  ERAFL  LDG
Sbjct  185   HVAQSAIDPDEMLPAVAQGAIGIERRADDQGCAMLLSSINDPLTALRIEAERAFLRRLDG  244

Query  921   SCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC+TPIAG A    DGD    +G +  PDG+ V+   R G    +D   MG D  +ELL 
Sbjct  245   SCQTPIAGLATL--DGDRMTLRGEILRPDGSEVVAGVRDG--LASDGAAMGTDLAEELLS  300

Query  1098  QAGPGFF  1118
             +AGPGF 
Sbjct  301   RAGPGFL  307



>ref|WP_013419820.1| porphobilinogen deaminase [Rhodomicrobium vannielii]
 gb|ADP71438.1| porphobilinogen deaminase [Rhodomicrobium vannielii ATCC 17100]
Length=313

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 219/306 (72%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGS LALAQA E +++L A +    +E   E ++IKTTGDKIL + L+ +GGKGL
Sbjct  10    IRIGTRGSALALAQATEVQNRLAAIY---GDEVKFERVVIKTTGDKILDKALSLVGGKGL  66

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE++EAL   +IDIAVHSMKDV  +LPD   + CNLPREDVRDAFIS+ A SLAD+P 
Sbjct  67    FTKELEEALFADQIDIAVHSMKDVQAFLPDGLEIACNLPREDVRDAFISMKAKSLADMPE  126

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ +GTAS+RR++ I ++ P LK +  FRGNVQ+RL+KL +GV  ATLLA AGL RL ++
Sbjct  127   GAVIGTASVRREAFIKNKRPDLKTVL-FRGNVQSRLKKLEDGVADATLLASAGLNRLGLS  185

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T  +P+EDMLPA AQGAIGI  RS+D+     I +L+ E T  A+  ERAFL+ LDG
Sbjct  186   DRITQHIPVEDMLPAPAQGAIGIEIRSNDQVTRELIMALHDEATGYAIDAERAFLSELDG  245

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIA  AR    G   FKG + +PDG R+ ET+R+G  + ND   MG+DA +EL  +
Sbjct  246   SCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELYAR  303

Query  1101  AGPGFF  1118
              G   F
Sbjct  304   GGKDVF  309



>ref|WP_036699861.1| porphobilinogen deaminase, partial [Paracoccus sp. 10990]
Length=309

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGS LALAQA+ETRD+L A+H       A EI++IKTTGD++L +PL +I
Sbjct  6     TPDAPLRIGTRGSALALAQAHETRDRLAAAH--GLPADAFEIVVIKTTGDRVLDRPLREI  63

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFT+EI++AL++A IDIAVHSMKD+P   PD  ++ C LPREDVRDAF+S    S+
Sbjct  64    GGKGLFTREIEDALLDARIDIAVHSMKDMPVLQPDGLVIDCYLPREDVRDAFVSARWDSI  123

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             + LPAG+ VG++SLRR++Q+ HR P L ++E FRGNVQTR+RKL EGV +AT LA+AGL 
Sbjct  124   SALPAGTVVGSSSLRRRAQLAHRRPDLALVE-FRGNVQTRMRKLAEGVAEATFLAMAGLT  182

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL M + V S +  E+MLPAVAQGAIG+  R+DD +    +A+++ + T L V  ERAFL
Sbjct  183   RLGMLDVVKSRISPEEMLPAVAQGAIGVERRADDARAGALLAAISDQSTTLRVEAERAFL  242

Query  906   TTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
               LDGSC TPIAG A    DGD  + +G +  PDG+  I  +R+G     D V MG D  
Sbjct  243   RRLDGSCETPIAGLAEL--DGDRLMLRGEILLPDGSISITGTREGSSA--DGVAMGRDLA  298

Query  1083  KELLLQAGPGF  1115
             +ELL QA P F
Sbjct  299   EELLGQAPPEF  309



>ref|WP_015599949.1| porphobilinogen deaminase [Hyphomicrobium denitrificans]
 gb|AGK59935.1| porphobilinogen deaminase [Hyphomicrobium denitrificans 1NES1]
Length=310

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 216/311 (69%), Gaps = 8/311 (3%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             + A IRIGTRGSPLALAQA+E RD+L  +H     E AI I IIKTTGD++  +PL+DIG
Sbjct  2     QAARIRIGTRGSPLALAQAHEVRDRLAKAH--GLPEDAIAITIIKTTGDRVTDRPLSDIG  59

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEI++AL   EID+AVHSMKD+ T LPD   +   LPRED RDAFISL  A++ 
Sbjct  60    GKGLFTKEIEDALFANEIDVAVHSMKDMQTALPDGLAIGATLPREDPRDAFISLKHANIG  119

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
              LP G+ VGT+SLRRKSQ+L   P L V++ FRGNV+TRLRKL +GV +AT LA+AGL R
Sbjct  120   ALPRGAVVGTSSLRRKSQVLSVRPDLSVID-FRGNVETRLRKLKDGVAEATFLAVAGLNR  178

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L + + +T+I+P EDMLPA AQGAIG+  R+ D+  A  +A LN   T LAV  ERAFL 
Sbjct  179   LGLADRITAIVPAEDMLPAAAQGAIGLEIRAGDQGAAALVAPLNDAPTALAVTAERAFLA  238

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              L+GSCRTPIAGYA    DGD + F+G V S DG +  + SR GP   N    +G  A  
Sbjct  239   RLEGSCRTPIAGYAV--IDGDRLSFRGQVLSVDGRQRYDVSRTGPS--NTAHEIGLAAAD  294

Query  1086  ELLLQAGPGFF  1118
             E+L  A P   
Sbjct  295   EVLSNADPAIL  305



>ref|WP_023785686.1| porphobilinogen deaminase [Hyphomicrobium nitrativorans]
 gb|AHB47331.1| porphobilinogen deaminase [Hyphomicrobium nitrativorans NL23]
Length=310

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/282 (61%), Positives = 205/282 (73%), Gaps = 6/282 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             I+RIGTRGSPLALAQA+E R +LM +H   A E A EI I KTTGD IL +PLA++GGKG
Sbjct  5     ILRIGTRGSPLALAQAHEVRGRLMQAH--RASEEAFEIRIYKTTGDMILDRPLAEVGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI+EAL++ EID+AVHSMKD+ T LPD   +   L REDVRDAFISL+  +LA+LP
Sbjct  63    LFTKEIEEALLSGEIDLAVHSMKDMQTLLPDGLGIGAVLEREDVRDAFISLAHRTLAELP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VGT+SLRR++Q+    P L+V+  FRGNVQTRL+KL  GV  AT+LA AGLKRL M
Sbjct  123   KGAVVGTSSLRRQAQVKRLRPDLEVV-GFRGNVQTRLKKLANGVADATMLACAGLKRLGM  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              + +TS +   DMLPAVAQGAI I  R DDE  A  IA LNHE T   V  ERAFLT L+
Sbjct  182   ADRITSPIETADMLPAVAQGAIAIEIRLDDEDAARLIAPLNHEPTAFCVTAERAFLTRLE  241

Query  918   GSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGP  1040
             GSCRTPIAG A    DGD + F+G+  SPDG    E +R GP
Sbjct  242   GSCRTPIAGLAEL--DGDTLAFRGMTFSPDGAECFEIARAGP  281



>ref|WP_022708022.1| porphobilinogen deaminase [Paracoccus zeaxanthinifaciens]
Length=309

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 218/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGS LALAQA+ETRD+LMA+H       A EI++IKTTGD+I  + L +IGGKGL
Sbjct  8     LKIGTRGSILALAQAHETRDRLMAAH--GLPVDAFEIVVIKTTGDRITDRALREIGGKGL  65

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL    IDIAVHSMKD+PT  PD  ++ C LPR DVRDAF+SL   S+A LP 
Sbjct  66    FTREIEEALTEGGIDIAVHSMKDMPTLQPDGLVIDCLLPRNDVRDAFVSLKHDSIASLPK  125

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G  VG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV +AT LA+AGL+R+DMT
Sbjct  126   GVVVGSSSLRRRAQLAHRRPDLQLVE-FRGNVQTRLKKLEDGVAEATFLAMAGLRRMDMT  184

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +     +  E+MLPAV QGAIGI  R  D+ +A  +A +NH ET   +  ERAFL  LDG
Sbjct  185   DVARGAVDPEEMLPAVGQGAIGIERREGDDAVAALLAPINHVETADRLRAERAFLARLDG  244

Query  921   SCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    DGD  I +G +  PDG+ V   +R+G   ++D   MG+D   ELL 
Sbjct  245   SCETPIAGLADL--DGDRLILRGEILRPDGSEVHAATREG--AISDGAAMGQDLADELLK  300

Query  1098  QAGPGFF  1118
             +AGPGF 
Sbjct  301   RAGPGFL  307



>ref|WP_045980881.1| porphobilinogen deaminase [Paracoccus sp. S4493]
 gb|KJZ32962.1| porphobilinogen deaminase [Paracoccus sp. S4493]
Length=312

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 218/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETRD+LMA+H     + A +II IKTTGD++L +PL+ IGGKGL
Sbjct  11    LRIGTRGSVLALAQAHETRDRLMAAH--GLPQDAFQIIPIKTTGDRVLDRPLSQIGGKGL  68

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL    IDIAVHSMKD+PT  PD  ++ C LPREDVRDAF+S   AS+  LP 
Sbjct  69    FTREIEEALTEGAIDIAVHSMKDMPTLQPDGLVIDCLLPREDVRDAFVSPHVASITALPQ  128

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV  AT LA+AGL RLDM 
Sbjct  129   GAVVGSSSLRRRAQLAHRRPDLQLVE-FRGNVQTRLQKLADGVAVATFLAMAGLSRLDMR  187

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                 S +  ++MLPAVAQGAIGI  R DD+  A  ++S+N   T L +  ERAFL  LDG
Sbjct  188   HVAQSAIDPDEMLPAVAQGAIGIERRVDDQGCAMLLSSINDPLTALRIEAERAFLRRLDG  247

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC+TPIAG A    DGD +  +G +  PDG+ V+   R G    +D   MG D  +ELL 
Sbjct  248   SCQTPIAGLATL--DGDRMRLRGEILRPDGSEVVAGVRDG--LASDGAAMGTDLAEELLS  303

Query  1098  QAGPGFF  1118
             +AGPGF 
Sbjct  304   RAGPGFL  310



>ref|XP_005704560.1| hydroxymethylbilane synthase [Galdieria sulphuraria]
 gb|EME28040.1| hydroxymethylbilane synthase [Galdieria sulphuraria]
Length=378

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 210/304 (69%), Gaps = 3/304 (1%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             +GTRGSPLALAQA + R  L            +EI II TTGD++L + LADIGGKGLFT
Sbjct  72    LGTRGSPLALAQANQVRQSLEKLAASQDIPLQVEIKIIHTTGDQVLDRSLADIGGKGLFT  131

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEID A +  EIDIAVHS+KDVPT+LP   +L   LPRED RD F+S  +  L+ LP G+
Sbjct  132   KEIDMAQLRGEIDIAVHSLKDVPTWLPTGIVLGAVLPREDTRDVFLSYHSKDLSALPNGA  191

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VG++SLRR++QIL +YP L+VL NFRGN+QTRL+KL +  V ATLLALAG+ RL +  +
Sbjct  192   VVGSSSLRRQAQILAKYPHLQVL-NFRGNLQTRLKKLEQRQVDATLLALAGMHRLGLEFS  250

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
                +L  E+MLPAVAQGAIG+  R +D     +I+ L+   +R+ V CER+FL+ LDGSC
Sbjct  251   FAHVLSFEEMLPAVAQGAIGVTIRENDHFSYRWISQLDDANSRICVECERSFLSALDGSC  310

Query  927   RTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAG  1106
             RTPIAG A   +D    F+GLVA PDG+ ++ET + G    N  V +G++AG+EL  + G
Sbjct  311   RTPIAGQAWITKDNKLHFRGLVAYPDGSSLVETFKAGELVNN--VEIGKEAGEELRAKIG  368

Query  1107  PGFF  1118
               FF
Sbjct  369   ENFF  372



>ref|WP_037927918.1| porphobilinogen deaminase [Sulfitobacter pseudonitzschiae]
 gb|KEJ95030.1| porphobilinogen deaminase [Sulfitobacter pseudonitzschiae]
Length=312

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 217/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAYETRD+L A+        A EI++IK TGD I  + L +IGGKGL
Sbjct  10    LKIGTRGSPLALAQAYETRDRLAAAF--DLPHAAFEIVVIKVTGDLIQDRALKEIGGKGL  67

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++ L  A+IDIAVHSMKD+PT  P   +L   LPREDVRDAF+SL+ +++ADLP 
Sbjct  68    FTREIEQDLSAAKIDIAVHSMKDMPTEQPPGLLLDTYLPREDVRDAFVSLTHSAIADLPQ  127

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+TVGT+SLRR++Q+LHR P L V+E FRGNVQTRLRKL++GV  AT LA AGL RL+MT
Sbjct  128   GATVGTSSLRRRAQLLHRRPDLNVVE-FRGNVQTRLRKLDDGVAVATFLASAGLNRLNMT  186

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +   + +   DMLPA+AQGAIGI  R+DD   A  + +++H  T   +  ERAFL TLDG
Sbjct  187   DVPATPIDTADMLPAIAQGAIGIERRADDAATAQLLKAIHHTPTGQRLAAERAFLATLDG  246

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    DGD +  +G V  PDG+ VI+ +R GP        MG D  +ELL 
Sbjct  247   SCETPIAGLAVL--DGDTLTLRGEVLRPDGSEVIKGTRTGPIAAG--ADMGRDLAQELLA  302

Query  1098  QAGPGFF  1118
              AGP FF
Sbjct  303   SAGPDFF  309



>ref|WP_008943976.1| porphobilinogen deaminase [Oceanibaculum indicum]
 gb|EKE76896.1| porphobilinogen deaminase [Oceanibaculum indicum P24]
Length=314

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 217/310 (70%), Gaps = 4/310 (1%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             K +++RIGTRGS LALAQA E + +L A+H  L +  A+EI++I TTGD++  +PLA+IG
Sbjct  3     KKSLVRIGTRGSQLALAQASEVKARLAAAHEALRDPDAVEIVVISTTGDRVQDRPLAEIG  62

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEI+E L++  IDIAVHSMKDVPT LPD  ++ C L RED RDAF+S  A+ + 
Sbjct  63    GKGLFTKEIEEGLLDGSIDIAVHSMKDVPTVLPDGLVIDCILEREDARDAFLSGKASGID  122

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             DLPAGS +GT+SLRR++ IL R P LKV+ +FRGNV TRLRKL  G V ATLLA+AGL R
Sbjct  123   DLPAGSVIGTSSLRRQALILSRRPDLKVV-SFRGNVGTRLRKLENGDVDATLLAMAGLNR  181

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L + +  T+ +P + MLPAVAQGAIGI  R  D+++A  +A LNH E+ + V  ERA L 
Sbjct  182   LAIQQTGTTPIPADVMLPAVAQGAIGIERRQSDDRIAGLLAPLNHSESAIRVTAERAMLA  241

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDGSCRTPIA +A     G    KGLV  PDGT+  + +  G     D   +G + G +
Sbjct  242   ELDGSCRTPIAAHAVLA-GGSLSLKGLVVLPDGTQRHDAALDGAP--GDAAALGREVGLQ  298

Query  1089  LLLQAGPGFF  1118
             L  +AGP FF
Sbjct  299   LRREAGPEFF  308



>emb|CFX11370.1| hydroxymethylbilane synthase [Filomicrobium sp. W]
 emb|CPR17267.1| hydroxymethylbilane synthase [Filomicrobium sp. Y]
Length=312

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 209/316 (66%), Gaps = 13/316 (4%)
 Frame = +3

Query  180   QKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLA  359
             QKT    I+IGTRGSPLALAQA+E R +LMA+H    ++ AI +I             LA
Sbjct  3     QKT----IKIGTRGSPLALAQAHEVRARLMAAHGLAEDQFAIVVIKTSGDQVVGS---LA  55

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             D+GGKGLFTKEI+EAL+  EID+AVHSMKD+ T LP    +   LPREDVRDAFISL+  
Sbjct  56    DVGGKGLFTKEIEEALLGEEIDLAVHSMKDMATTLPAGLTISAMLPREDVRDAFISLAYP  115

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             SL  +PAG  +GT+SLRR++Q+  R P L+V+  FRGNVQTRL+KL +GV  AT LA AG
Sbjct  116   SLDAVPAGGRIGTSSLRRQAQVKLRRPDLEVI-GFRGNVQTRLKKLADGVADATFLACAG  174

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RL +T+ +T+ +  + MLPAVAQ AIGI  R+ DE        LN E T L V  ERA
Sbjct  175   LRRLGLTDQITASIETDVMLPAVAQAAIGIEIRAGDEDNNALTGVLNDERTALCVTAERA  234

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             FL  LDGSCRTPIAG A    DGD +  +G + SPDG R   T + G       + +GED
Sbjct  235   FLRILDGSCRTPIAGLAEF--DGDVLRLRGQILSPDGAREFSTVKSGSPA--SAIRLGED  290

Query  1077  AGKELLLQAGPGFFGN  1124
             A +ELL +AGPGF  +
Sbjct  291   AARELLDRAGPGFLSS  306



>ref|WP_037233090.1| porphobilinogen deaminase [Rhodomicrobium udaipurense]
Length=313

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 219/306 (72%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGS LALAQA E +++L A +    +E   E ++IKTTGDKIL + L+ +GGKGL
Sbjct  10    IRIGTRGSALALAQATEVQNRLAAIY---GDEVKFERVVIKTTGDKILDKALSLVGGKGL  66

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE++EAL   +IDIAVHSMKDV  +LPD   + CNLPREDVRDAFIS+ A SLAD+P 
Sbjct  67    FTKELEEALFADQIDIAVHSMKDVQAFLPDGLEIVCNLPREDVRDAFISMKAKSLADMPE  126

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ +GTAS+RR++ I ++ P LK +  FRGNVQ+RL+KL +GV  ATLLA AGL RL ++
Sbjct  127   GAVIGTASIRREAFIKNKRPDLKTVL-FRGNVQSRLKKLEDGVADATLLASAGLNRLGLS  185

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T  +P+E+MLPA AQGAIGI  RS+D+     I +L+ E T  A+  ERAFL+ LDG
Sbjct  186   DRITQHIPVEEMLPAPAQGAIGIEIRSNDQVTRELIMALHDEATGYAIDAERAFLSELDG  245

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIA  AR    G   FKG + +PDG R+ ET+R+G  + ND   MG+DA +EL  +
Sbjct  246   SCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELYAR  303

Query  1101  AGPGFF  1118
              G   F
Sbjct  304   GGKDVF  309



>ref|WP_028957118.1| porphobilinogen deaminase [Sulfitobacter sp. 20_GPM-1509m]
Length=312

 Score =   280 bits (717),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 219/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAYETRD+L A+      + A EI++IK TGD I  + L +IGGKGL
Sbjct  10    LKIGTRGSPLALAQAYETRDRLAAAF--DLPQAAFEIVVIKVTGDLIQDRALKEIGGKGL  67

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++ L  A+IDIAVHSMKD+PT  P   +L   LPREDVRDAF+S + +++ADLP 
Sbjct  68    FTREIEQDLSAAKIDIAVHSMKDMPTEQPPGLLLDTYLPREDVRDAFVSPAYSAIADLPQ  127

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+TVGT+SLRR++Q+LHR P L V+E FRGNVQTRLRKL++GV  AT LA AGL RL+MT
Sbjct  128   GATVGTSSLRRRAQLLHRRPDLNVVE-FRGNVQTRLRKLDDGVAVATFLATAGLNRLNMT  186

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E   + +   DMLPA+AQGAIGI  R+DD   A  + +++   T   +  ERAFL TLDG
Sbjct  187   EVPATPIDPADMLPAIAQGAIGIERRADDAVTAQLLDAIHDTPTGQRLAAERAFLATLDG  246

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    DGD +  +G V  PDG+  I+ +R GP  ++D   MG D  +ELL 
Sbjct  247   SCETPIAGLALL--DGDTLSLRGEVLRPDGSEAIKGTRTGP--ISDGAAMGRDLAQELLA  302

Query  1098  QAGPGFF  1118
             +AGP FF
Sbjct  303   KAGPDFF  309



>ref|WP_036736121.1| porphobilinogen deaminase, partial [Paracoccus sp. 39524]
Length=306

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/307 (55%), Positives = 222/307 (72%), Gaps = 8/307 (3%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGS LALAQA+ETR++L A+H       A EI++IKTTGD++L +PL +I
Sbjct  6     TPDAPLRIGTRGSALALAQAHETRERLAAAH--GLPANAFEIVVIKTTGDRVLDRPLREI  63

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFT+EI++AL++A IDIAVHSMKD+P   PD  ++ C LPREDVRDAF+S    S+
Sbjct  64    GGKGLFTREIEDALLDARIDIAVHSMKDMPVLQPDGLVIDCYLPREDVRDAFVSARWDSI  123

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             + LPAG+ VG++SLRR++Q+ HR P L ++E FRGNVQTR+RKL EGV +AT LA+AGL 
Sbjct  124   SALPAGTVVGSSSLRRRAQLAHRRPDLALVE-FRGNVQTRMRKLAEGVAEATFLAMAGLT  182

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL M + V S +P E+MLPAVAQGAIG+  R+DD +    +A+++ + T L V  ERAFL
Sbjct  183   RLGMLDVVKSRIPPEEMLPAVAQGAIGVERRADDARAGALLAAISDQSTTLRVEAERAFL  242

Query  906   TTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
               LDGSC TPIAG A    DGD  + +G +  PDG+  I  +R G  + +D V MG D  
Sbjct  243   RRLDGSCETPIAGLAEL--DGDRLMLRGEILLPDGSISITGTRAG--SSSDGVAMGRDLA  298

Query  1083  KELLLQA  1103
             +ELL +A
Sbjct  299   EELLGRA  305



>ref|WP_045837491.1| porphobilinogen deaminase [Hyphomicrobium sp. 99]
Length=310

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 214/306 (70%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGSPLALAQA+E R +LMA+H     E AI I +IKTTGD++L +PLAD+GGKGL
Sbjct  6     IRIGTRGSPLALAQAHEVRARLMAAH--GLPESAITINVIKTTGDRVLDRPLADVGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI++AL++ E+D+ VHSMKD+ T LPD  ++   LPRED RDAFISL  A    LP 
Sbjct  64    FTKEIEDALLSNEVDVGVHSMKDMQTVLPDGLVVGAVLPREDPRDAFISLRHADFNSLPL  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
              + VGT+SLRRK+Q+L+  P L+V+E FRGNVQTRLRKL EGV +AT LA+AGLKRL M 
Sbjct  124   NAVVGTSSLRRKAQVLNARPDLRVVE-FRGNVQTRLRKLEEGVAEATFLAVAGLKRLGMQ  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T+ + IE MLPAVAQG I +  R  DE  A  IA LN  ET +A   ER FL  ++G
Sbjct  183   DRITAPVSIEHMLPAVAQGVIALEIRDGDEATAGLIAPLNDPETAVAATAERTFLARMEG  242

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG+A     G+ +F+G + S DG+R  + +R G  +  D   +G  A  E+L +
Sbjct  243   SCRTPIAGHAVINA-GELVFRGQILSVDGSRSYDVTRSG--SPEDAFDLGLAAADEILTE  299

Query  1101  AGPGFF  1118
             A P   
Sbjct  300   ADPAIL  305



>ref|WP_037451402.1| porphobilinogen deaminase [Skermanella stibiiresistens]
 gb|EWY40526.1| porphobilinogen deaminase [Skermanella stibiiresistens SB22]
Length=309

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 215/306 (70%), Gaps = 3/306 (1%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQA++TR +L A+H  LA   AIEI++IKTTGD+I  + L + GGKGL
Sbjct  5     VRIGTRGSPLALAQAHQTRARLAAAHAALAAPDAIEIVVIKTTGDRIQDRTLMEAGGKGL  64

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL    ID+AVHSMKDVPT+LPD   + C LPRED RDAF S  A  L DLP 
Sbjct  65    FTKEIEEALAAGTIDLAVHSMKDVPTWLPDGMEIRCLLPREDPRDAFFSNVAKHLDDLPE  124

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGTASLRR++Q+L R P LKV+   RGNV+TRLRKL +G V ATLLALAGLKRLDMT
Sbjct  125   GAVVGTASLRRQAQVLSRRPDLKVVP-IRGNVETRLRKLADGDVDATLLALAGLKRLDMT  183

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +TS+L  + MLPAVAQGAIGI  RSDDE     +  LN   T + V  ERA L  LDG
Sbjct  184   DRITSVLEPDVMLPAVAQGAIGIETRSDDEVTNALLEPLNCATTMVRVSAERALLAALDG  243

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG A     G    + +VA P G+RV+ T R G  +  D V MG DAG+EL   
Sbjct  244   SCRTPIAGLAVLDAAGALSLEAMVADPAGSRVLTTKRSG--SAADAVAMGRDAGEELKSL  301

Query  1101  AGPGFF  1118
               P FF
Sbjct  302   MPPDFF  307



>gb|KAI96092.1| porphobilinogen deaminase [Rhodomicrobium udaipurense JA643]
Length=304

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 168/306 (55%), Positives = 219/306 (72%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA E +++L A +    +E   E ++IKTTGDKIL + L+ +GGKGL
Sbjct  1     MRIGTRGSALALAQATEVQNRLAAIY---GDEVKFERVVIKTTGDKILDKALSLVGGKGL  57

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE++EAL   +IDIAVHSMKDV  +LPD   + CNLPREDVRDAFIS+ A SLAD+P 
Sbjct  58    FTKELEEALFADQIDIAVHSMKDVQAFLPDGLEIVCNLPREDVRDAFISMKAKSLADMPE  117

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ +GTAS+RR++ I ++ P LK +  FRGNVQ+RL+KL +GV  ATLLA AGL RL ++
Sbjct  118   GAVIGTASIRREAFIKNKRPDLKTV-LFRGNVQSRLKKLEDGVADATLLASAGLNRLGLS  176

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T  +P+E+MLPA AQGAIGI  RS+D+     I +L+ E T  A+  ERAFL+ LDG
Sbjct  177   DRITQHIPVEEMLPAPAQGAIGIEIRSNDQVTRELIMALHDEATGYAIDAERAFLSELDG  236

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIA  AR    G   FKG + +PDG R+ ET+R+G  + ND   MG+DA +EL  +
Sbjct  237   SCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELYAR  294

Query  1101  AGPGFF  1118
              G   F
Sbjct  295   GGKDVF  300



>ref|WP_036711670.1| MULTISPECIES: porphobilinogen deaminase, partial [Paracoccus]
Length=309

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADI  365
             T  A +RIGTRGS LALAQA+ETRD+L A+H       A EI++IKTTGD++L +PL +I
Sbjct  6     TPDAPLRIGTRGSALALAQAHETRDRLAAAH--GLPADAFEIVVIKTTGDRVLDRPLREI  63

Query  366   GGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasl  545
             GGKGLFT+EI++AL++A IDIAVHSMKD+P   PD  ++ C LPREDVRDAF+S    S+
Sbjct  64    GGKGLFTREIEDALLDARIDIAVHSMKDMPVLQPDGLVIDCYLPREDVRDAFVSARWGSI  123

Query  546   adlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLK  725
             + LPAG+ VG++SLRR++Q+ HR P L ++E FRGNVQTR+RKL+EGV +AT LA+AGL 
Sbjct  124   SALPAGTVVGSSSLRRRAQLAHRRPDLTLVE-FRGNVQTRMRKLSEGVAEATFLAMAGLT  182

Query  726   RLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFL  905
             RL M + V S +  ++MLPAVAQGAIG+  R+DD +    +A+++ + T L V  ERAFL
Sbjct  183   RLGMLDVVKSRISPDEMLPAVAQGAIGVERRADDARAGALLAAISDQSTTLRVEAERAFL  242

Query  906   TTLDGSCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAG  1082
               LDGSC TPIAG A    DGD  + +G +  PDG+  I   R+G     D V MG D  
Sbjct  243   RRLDGSCETPIAGLAEL--DGDRLMLRGEILLPDGSISITGIREGSSA--DGVAMGRDLA  298

Query  1083  KELLLQAGPGF  1115
             +ELL +A P F
Sbjct  299   EELLGRAPPEF  309



>ref|WP_041527873.1| porphobilinogen deaminase [Paracoccus aminophilus]
Length=310

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 225/307 (73%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETRD+LMA+H     E A EI++IKTTGD+IL + L +IGGKGL
Sbjct  8     LRIGTRGSVLALAQAHETRDRLMAAH--GLAEDAFEIVVIKTTGDRILDRALKEIGGKGL  65

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL++ EIDIAVHSMKD+PT  P+  ++ C+LPREDVRDAF+SL+  ++++LP 
Sbjct  66    FTREIEDALLSGEIDIAVHSMKDMPTLQPEGLVIDCHLPREDVRDAFVSLTYGTISELPQ  125

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+L   P L ++E FRGNVQTR++KL +GV  AT LA+AGL R++MT
Sbjct  126   GAVVGSSSLRRRAQLLAVRPDLTLVE-FRGNVQTRMKKLEDGVAVATFLAMAGLARMEMT  184

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +     +  ++MLPAVAQG IG+  R+DD  MA  + ++NH ET L V  ERAFL  LDG
Sbjct  185   DAARGAISADEMLPAVAQGCIGVERRADDALMARLLGAINHHETALRVAAERAFLAELDG  244

Query  921   SCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC+TPIAG A    +G+ ++ +G +  PDG+ VI   R+GP +  +   MG D  +EL  
Sbjct  245   SCQTPIAGLAVL--EGESLWLRGEILRPDGSEVISAERRGPAS--EGPAMGRDLAQELRG  300

Query  1098  QAGPGFF  1118
             +A   FF
Sbjct  301   RAPADFF  307



>ref|WP_007255416.1| porphobilinogen deaminase [Oceanicola granulosus]
 gb|EAR50818.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
Length=313

 Score =   278 bits (712),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 213/306 (70%), Gaps = 5/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ETRD+L A+H       A E+++I+TTGD+++ +PL +IGGKGL
Sbjct  11    LKIGTRGSPLALAQAHETRDRLAAAH--GLPGEAFEVVVIRTTGDRVVDRPLKEIGGKGL  68

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EA+++  IDIAVHSMKD+P   P+  +L C LPRED RDAF+SL  A +  LP 
Sbjct  69    FTKEIEEAMLSGAIDIAVHSMKDMPVAQPEGLVLDCYLPREDPRDAFVSLLHAGIKALPD  128

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+TVGT+SLRRK+Q+LHR P L V+E FRGNVQTRLRKL  GV  AT LA+AGL RL   
Sbjct  129   GATVGTSSLRRKAQLLHRRPDLHVVE-FRGNVQTRLRKLESGVAVATFLAVAGLNRLGAD  187

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +   + +  EDMLPAVAQGAIGI  R+ DE +   +A+++   T   +  ERAFL  LDG
Sbjct  188   DVPQAPIAPEDMLPAVAQGAIGIERRASDEGLGEMLAAIHDRATGERLAAERAFLAALDG  247

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A    DG    +G + + DG+R +  + +    + D   +G D  + LL Q
Sbjct  248   SCETPIAGLAELIGDGRLRLRGEILAHDGSRCL--ADEAEAQIADGAALGTDMARRLLAQ  305

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  306   AGPGFF  311



>ref|WP_038132319.1| porphobilinogen deaminase [Thioclava sp. DT23-4]
Length=317

 Score =   278 bits (712),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 209/308 (68%), Gaps = 6/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +LMA+H  PE A E  +                L +IGGK
Sbjct  11    LKIGTRGSPLALAQAYETRSRLMAAHGLPEAAFEVVVIKTSGDDRAQIAADMSLKEIGGK  70

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EA+++  IDIAVHSMKD+PT  P+  IL C LPREDVRDAF+SL+ A +ADL
Sbjct  71    GLFTKEIEEAMVDGRIDIAVHSMKDMPTEQPEGLILNCYLPREDVRDAFVSLNHAGIADL  130

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VG++SLRR+SQ+ +R P LK+++ FRGNVQTRL+KL EGV +AT LA+AGL RL 
Sbjct  131   PEGAVVGSSSLRRRSQLAYRRPDLKLVQ-FRGNVQTRLKKLQEGVAEATFLAMAGLTRLG  189

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M E   S +  E+MLPAVAQGAIGI  R  D +    +A ++H  T   +  ERA+L TL
Sbjct  190   MLEVAKSAIAPEEMLPAVAQGAIGIERRVSDARSEALLAPIHHLPTAQRLAAERAYLATL  249

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSC TPIAG A   E  +   +G +  PDG+  I  S +G  ++++   +G+D  + LL
Sbjct  250   DGSCETPIAGLAII-EGDELWLRGEILRPDGSEAI--SGEGRASISEGAALGDDLARRLL  306

Query  1095  LQAGPGFF  1118
              +A  GFF
Sbjct  307   AKAPTGFF  314



>ref|WP_039540721.1| porphobilinogen deaminase [Ruegeria sp. ANG-R]
 gb|KIC40148.1| porphobilinogen deaminase [Ruegeria sp. ANG-R]
Length=318

 Score =   278 bits (711),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 160/313 (51%), Positives = 206/313 (66%), Gaps = 6/313 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  + ++IGTRGSPLALAQAYETR +L A+   PE A E  +              +PL 
Sbjct  7     TPASPLKIGTRGSPLALAQAYETRQRLGAAFDLPEDAFEIVVIKTTGDNRAMIDADRPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             +IG KGLFTKEI+EA++   IDIAVHS KD+P   P+  +L   LPREDVRDAFIS + +
Sbjct  67    EIGNKGLFTKEIEEAMLKGGIDIAVHSTKDMPVEQPEGLVLDTFLPREDVRDAFISPTLS  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             S+ +LP G+ VGT+SLRR++Q+L+R P LKV+E FRGNVQTRL+KL +GV   T LA+AG
Sbjct  127   SIHELPEGAVVGTSSLRRRAQLLNRRPDLKVVE-FRGNVQTRLKKLADGVADCTFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RLDM +   + +  EDMLPA+AQG IGI  RSDD + A  + +++H ET   +  ER+
Sbjct  186   LRRLDMKDVPATAISPEDMLPAIAQGTIGIERRSDDSRAAEMLTAIHHVETGQRLAAERS  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
              L  LDGSC TPIAG A+   DG    +G V  PDG+  I     GP  L D   +G+  
Sbjct  246   LLAGLDGSCETPIAGLAQV-RDGQLHLRGEVLRPDGSEAISEDAAGP--LGDGAELGQSM  302

Query  1080  GKELLLQAGPGFF  1118
              + LL QAGPGFF
Sbjct  303   AESLLKQAGPGFF  315



>gb|KEO55605.1| porphobilinogen deaminase [Thioclava sp. DT23-4]
Length=316

 Score =   278 bits (711),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 209/308 (68%), Gaps = 6/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +LMA+H  PE A E  +                L +IGGK
Sbjct  10    LKIGTRGSPLALAQAYETRSRLMAAHGLPEAAFEVVVIKTSGDDRAQIAADMSLKEIGGK  69

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EA+++  IDIAVHSMKD+PT  P+  IL C LPREDVRDAF+SL+ A +ADL
Sbjct  70    GLFTKEIEEAMVDGRIDIAVHSMKDMPTEQPEGLILNCYLPREDVRDAFVSLNHAGIADL  129

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VG++SLRR+SQ+ +R P LK+++ FRGNVQTRL+KL EGV +AT LA+AGL RL 
Sbjct  130   PEGAVVGSSSLRRRSQLAYRRPDLKLVQ-FRGNVQTRLKKLQEGVAEATFLAMAGLTRLG  188

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M E   S +  E+MLPAVAQGAIGI  R  D +    +A ++H  T   +  ERA+L TL
Sbjct  189   MLEVAKSAIAPEEMLPAVAQGAIGIERRVSDARSEALLAPIHHLPTAQRLAAERAYLATL  248

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSC TPIAG A   E  +   +G +  PDG+  I  S +G  ++++   +G+D  + LL
Sbjct  249   DGSCETPIAGLAII-EGDELWLRGEILRPDGSEAI--SGEGRASISEGAALGDDLARRLL  305

Query  1095  LQAGPGFF  1118
              +A  GFF
Sbjct  306   AKAPTGFF  313



>ref|WP_024810783.1| porphobilinogen deaminase [Oceanicola sp. HL-35]
Length=320

 Score =   278 bits (711),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 206/309 (67%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMA--SHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             +RIGTRGSPLALAQAYETR +LM   S PE A E  +              +PL +IG K
Sbjct  12    LRIGTRGSPLALAQAYETRTRLMRAFSLPEEAFEIVVIKTTGDNRAMIDADRPLKEIGNK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EAL    IDIAVHSMKD+PT  P   +L C LPRED RDAF+S++A SL DL
Sbjct  72    GLFTKEIEEALTGGRIDIAVHSMKDMPTQQPAGLVLDCYLPREDTRDAFVSVTADSLQDL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VG++SLRR++Q+L+R+P L+V+E FRGNVQTR++KL++GV QAT LA AGL RL 
Sbjct  132   PQGAIVGSSSLRRRAQLLNRFPHLRVVE-FRGNVQTRMKKLHDGVAQATFLAQAGLNRLG  190

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +     +  EDMLPA+AQGAIGI  RSDD   A  + +++  +T   +  ERAFL  L
Sbjct  191   MADVARQAIAPEDMLPAIAQGAIGIERRSDDLDSAAMLEAIHDGQTGQRLAAERAFLAAL  250

Query  915   DGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    DG+ +  +G V  PDG+  I   R  P    D V M +   ++L
Sbjct  251   DGSCETPIAGLAEL--DGNALRLRGEVLRPDGSDRIGADRTAPIV--DGVAMAQAMARDL  306

Query  1092  LLQAGPGFF  1118
             L +AGPGFF
Sbjct  307   LDEAGPGFF  315



>ref|WP_023851157.1| porphobilinogen deaminase [Rhodobacteraceae bacterium PD-2]
 gb|ETA51097.1| porphobilinogen deaminase [Rhodobacteraceae bacterium PD-2]
Length=317

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 205/311 (66%), Gaps = 8/311 (3%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiik--ttgdkilSQPLADIG  368
             A +RIGTRGSPLALAQAYETR +L  +H    +   I +I             +PL +IG
Sbjct  9     APLRIGTRGSPLALAQAYETRARLATAHGLTEDAFEIVVIKTTGDNRAMIEADRPLKEIG  68

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
              KGLFT+EI+E L   +IDIAVHSMKD+PT  P   +L C LPREDVRDAFIS +   +A
Sbjct  69    NKGLFTREIEEQLAAGDIDIAVHSMKDMPTEQPPGLVLDCYLPREDVRDAFISPAGGGIA  128

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
              LP G+ VGT+SLRR++Q+LHR P L V+E FRGN+QTRL+KL +GV QAT LA AGLKR
Sbjct  129   GLPEGAVVGTSSLRRRAQLLHRRPDLTVVE-FRGNLQTRLKKLEDGVAQATFLACAGLKR  187

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             + +TE   + +  EDMLPA+AQGAIGI  R++D ++A  +A ++   T   +  ERAFL 
Sbjct  188   MGLTEVPATPIAPEDMLPAIAQGAIGIERRANDTRVAGMLAEIHDTPTAQRLAAERAFLA  247

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              LDGSC TPIAG A    DGD +  +G V  PDG+     +R GP  + +   MG     
Sbjct  248   ALDGSCETPIAGLAEL--DGDSLHLRGQVLRPDGSVAHAGARSGP--IAEGAAMGRALAA  303

Query  1086  ELLLQAGPGFF  1118
             ELL +AGPGFF
Sbjct  304   ELLERAGPGFF  314



>ref|WP_022729432.1| porphobilinogen deaminase [Fodinicurvata sediminis]
Length=312

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 216/307 (70%), Gaps = 4/307 (1%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             ++++GTRGS LALAQA E +  L A+HPEL  E AIEI++IKTTGD++L +PLA+IGGKG
Sbjct  3     LLKLGTRGSLLALAQAEEAKRLLAAAHPELRAEDAIEIVVIKTTGDRVLDRPLAEIGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LF KEI+EAL +  ID AVHSMKDVPT+LPD   +   L RED RDAF SL  ASLADLP
Sbjct  63    LFVKEIEEALGDGRIDAAVHSMKDVPTWLPDGYAIAVILEREDPRDAFFSLHGASLADLP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VG+ASLRR+SQI H  P L+V+ NFRGNVQ+RLRKL EG V ATLLALAGLKRL  
Sbjct  123   RGARVGSASLRRQSQIRHARPDLEVV-NFRGNVQSRLRKLEEGQVDATLLALAGLKRLGR  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              + + ++LP+E+MLPA  QGAIG+ CR  D +   Y+ S++H ET + V  ERA L  L+
Sbjct  182   EDLLQAVLPVEEMLPAAGQGAIGLECRQGDSRTLEYVRSIDHAETSIRVNAERACLDVLE  241

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIA  A    D +   + LVA PDG+ +    R GP   +  V +G + G EL  
Sbjct  242   GSCRTPIAALAELSGD-ELRLRALVAEPDGSALNRAERSGPA--DQAVEIGREVGHELRE  298

Query  1098  QAGPGFF  1118
              AG  FF
Sbjct  299   AAGEAFF  305



>ref|WP_029058080.1| porphobilinogen deaminase [Stappia stellulata]
Length=311

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 222/313 (71%), Gaps = 8/313 (3%)
 Frame = +3

Query  183   KTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLAD  362
             K   +  RIGTRGS LALAQA+ETRD+L+A+H     E A EII+IKT+GD+I  +PL++
Sbjct  4     KPSASQFRIGTRGSALALAQAHETRDRLIAAH--GLPESAFEIIVIKTSGDRIQDRPLSE  61

Query  363   IGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaas  542
             +GGKGLFTKEI++A+++ +IDIAVHS KD+PT LP+   L   LPREDVRDAF+S  A  
Sbjct  62    VGGKGLFTKEIEQAMVDGDIDIAVHSAKDMPTVLPEGLELIAFLPREDVRDAFLSPKAQK  121

Query  543   ladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGL  722
             + DLP G+ +G++SLRR++ I    P ++V+  +RGNVQTRL+KL +GVV ATLLA AGL
Sbjct  122   IQDLPQGAVIGSSSLRRQAMIKRMRPDIEVV-MYRGNVQTRLKKLADGVVDATLLATAGL  180

Query  723   KRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAF  902
             +RL + + +TS++   + LPAV QGAI I  R+DD    + +A+++H ET + +  ERAF
Sbjct  181   RRLGLGDVITSVIDPAEFLPAVGQGAICIEARADDTATRDMLAAIHHRETEICLTAERAF  240

Query  903   LTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             L  LDGSC+TPI G A+   DGD I   GL+  PDG+   ET R GP +  D   +G+DA
Sbjct  241   LAELDGSCQTPIGGLAKL--DGDRIRLDGLILRPDGSEAHETFRDGPAS--DAAALGQDA  296

Query  1080  GKELLLQAGPGFF  1118
             G EL  + GPGFF
Sbjct  297   GAELKRRGGPGFF  309



>ref|WP_026758124.1| porphobilinogen deaminase [Sediminimonas qiaohouensis]
Length=314

 Score =   276 bits (707),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 210/306 (69%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQAYETRD+L  S     ++ A EI++IKTTGDK+  +PL +IGGKGL
Sbjct  12    LRIGTRGSPLALAQAYETRDRL--SSAFDLDQEAFEIVVIKTTGDKVQDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL +  IDIAVHSMKD+P+  P    L   LPRED RDAF+SL   SLA+LP 
Sbjct  70    FTKEIEEALTSGAIDIAVHSMKDMPSAQPPGLTLDTYLPREDARDAFVSLKYQSLAELPE  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+LHR+P L+V+E FRGNVQTRLRKL+E V  AT LA+AGL RLDM 
Sbjct  130   GTRVGSSSLRRRAQLLHRFPHLEVVE-FRGNVQTRLRKLSEEVASATFLAMAGLNRLDMA  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                 S +  EDMLPAVAQGAIGI  R DD + A  +A+++   T   +  ERAFL  LDG
Sbjct  189   HVARSAIAPEDMLPAVAQGAIGIERREDDSRAAEMLAAIHDHGTATLLAAERAFLAGLDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPI G A     G    +G V  PDG+ VI  +R GP  + D   +G      LL Q
Sbjct  249   SCETPIGGLAEI-TGGTLHLRGEVLRPDGSEVISDARSGP--VEDGAEIGRAMAAFLLTQ  305

Query  1101  AGPGFF  1118
             AG  FF
Sbjct  306   AGRDFF  311



>ref|WP_011539846.1| porphobilinogen deaminase [Ruegeria sp. TM1040]
 gb|ABF65261.1| porphobilinogen deaminase [Ruegeria sp. TM1040]
Length=318

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 203/311 (65%), Gaps = 7/311 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPe--laeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETRD+L  +      A +  +              +PL +IG K
Sbjct  12    LKIGTRGSPLALAQAYETRDRLARAFELEPTAFDIVVIKTTGDNRAMIDADRPLKEIGNK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EAL++  IDIAVHSMKD+PT  P+   L C LPREDVRDAF+S    S+ADL
Sbjct  72    GLFTKEIEEALLSGGIDIAVHSMKDMPTLQPEGLTLDCYLPREDVRDAFVSPGIHSIADL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VGT+SLRR++Q+LHR P L+V+E FRGNVQTRL+KL  GV  AT LA+AGL+RLD
Sbjct  132   PEGAVVGTSSLRRRAQLLHRRPDLQVVE-FRGNVQTRLQKLENGVASATFLAMAGLRRLD  190

Query  735   MTENVTSI-LPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTT  911
             M E V +  + ++DMLPAVAQGAIGI  RS D   A  + +++H ET L +  ERAFL  
Sbjct  191   MAEAVPATPISVDDMLPAVAQGAIGIERRSSDITTAAMLEAIHHAETSLRLAAERAFLAA  250

Query  912   LDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             LDGSC TPIA  A     G    +G +  PDG+  +   + G   + D   +G   G+ L
Sbjct  251   LDGSCETPIAALADL-SGGTIQLRGQILRPDGSEALSDEQDG--AIEDGAELGRQMGETL  307

Query  1092  LLQAGPGFFGN  1124
               +AG GFF +
Sbjct  308   RARAGAGFFAH  318



>ref|WP_007793611.1| porphobilinogen deaminase [Pelagibaca bermudensis]
 gb|EAU44875.1| porphobilinogen deaminase [Roseovarius sp. HTCC2601]
Length=319

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 209/314 (67%), Gaps = 8/314 (3%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             +  A ++IGTRGSPLALAQA+ETRD+L A+   P+ A E  +              +PL 
Sbjct  7     SPAAPLKIGTRGSPLALAQAHETRDRLAAAFDLPQDAFEIVVIKTTGDDRAMIAADRPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             +IG KGLFTKEI+E L++  IDIAVHSMKD+PT  P+  +L C LPRED RDAFIS   A
Sbjct  67    EIGNKGLFTKEIEEQLLSGGIDIAVHSMKDMPTEQPEGLVLDCYLPREDERDAFISPGHA  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
              LA LP G+ VGT+SLRR++Q+L+R P L+V+E FRGNVQTRL+KL +GV  AT LA+AG
Sbjct  127   GLAALPEGTVVGTSSLRRRAQLLNRRPDLQVVE-FRGNVQTRLKKLEDGVAAATFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+R+DMT+   + +  +DMLPA+AQGAIGI  RSDD +  + +A+++  +T   +  ER 
Sbjct  186   LRRMDMTDIPMTAMSPDDMLPAIAQGAIGIERRSDDSRTGDMLAAIHDTDTATRLAAERT  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             FL  LDGSC TPIAG A    DGD +  +G + +PDG+        GP    D   MG  
Sbjct  246   FLAALDGSCETPIAGLAEL--DGDRLRLRGEILAPDGSASHAGELSGPAA--DGPAMGRA  301

Query  1077  AGKELLLQAGPGFF  1118
               +ELL +AGP FF
Sbjct  302   LAEELLARAGPDFF  315



>ref|WP_027287453.1| porphobilinogen deaminase [Rhodovibrio salinarum]
Length=319

 Score =   275 bits (704),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/308 (53%), Positives = 219/308 (71%), Gaps = 5/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +R+GTRGS LALAQAYET+ KL A+HPELA EG IE++ +KTTGD    + LA+IGGKGL
Sbjct  8     LRLGTRGSKLALAQAYETKAKLEAAHPELAAEGRIEVVEVKTTGDIEQKRRLAEIGGKGL  67

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKE+++AL +  +D+AVHSMKDVPT+LP+   +   LPRED RDA+    AAS+A+LP 
Sbjct  68    FTKELEDALHDGRVDVAVHSMKDVPTWLPEGLEITTILPREDPRDAWFCDKAASIAELPK  127

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+TVGT+SLRR++Q++   P L V+ NFRGN+QTRL+KL EG V AT+LALAGL+R+ + 
Sbjct  128   GATVGTSSLRRQAQVMALRPDLSVV-NFRGNLQTRLQKLREGQVDATMLALAGLRRMGIA  186

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E+ T++L  +++LPAVAQGAIG+  R+DD+     I++++H  +RL VV ERA L  L+G
Sbjct  187   EDATAVLSTDELLPAVAQGAIGLEIRADDDWARTLISAIDHAPSRLRVVTERACLEELEG  246

Query  921   SCRTPIAGYARRGEDG--DCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             SCRTPI       +D       + L+A PDG++     R GP +  D   +  DAG+EL 
Sbjct  247   SCRTPIGVLCDYTDDAQQQIRLRALLAEPDGSKAWRAERAGPVSEADA--LARDAGRELR  304

Query  1095  LQAGPGFF  1118
               AG  FF
Sbjct  305   ATAGEEFF  312



>ref|WP_043767487.1| porphobilinogen deaminase [Roseivivax isoporae]
 gb|ETX29859.1| porphobilinogen deaminase [Roseivivax isoporae LMG 25204]
Length=319

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 208/311 (67%), Gaps = 8/311 (3%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIG  368
             A ++IGTRGSPLALAQA+ETRD+L A+H  P  A E  +              +PL +IG
Sbjct  10    APLKIGTRGSPLALAQAHETRDRLSAAHGLPVAAFEIVVIKTTGDDRALIDADRPLKEIG  69

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
              KGLF +EI++A+++ +IDIAVHSMKD+P   P+  +L C LPRED RDAF+S     +A
Sbjct  70    NKGLFVREIEQAMLSGDIDIAVHSMKDMPVLQPEGLVLDCYLPREDPRDAFLSPGYDGIA  129

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
              LPAGS VG++SLRR+SQ+LHR P L+V+E FRGNVQTRLRKL +GV   T LA AGL R
Sbjct  130   ALPAGSVVGSSSLRRRSQVLHRRPDLRVVE-FRGNVQTRLRKLQDGVATGTFLARAGLNR  188

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L MT+   S +  EDMLPAVAQGAIGI  RSDD+  A  +A+++   T   +  ERAFL 
Sbjct  189   LGMTDLPHSPIAPEDMLPAVAQGAIGIERRSDDDATAALLAAIHDRATGERLAAERAFLA  248

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              LDGSC TPIAG A    DGD +  +G V  PDG+     SR G  ++ D   MG D  +
Sbjct  249   ALDGSCETPIAGLAE--IDGDVLTLRGEVLRPDGSEAHSGSRTG--SVADGPDMGRDLAR  304

Query  1086  ELLLQAGPGFF  1118
             ELL +AGPGFF
Sbjct  305   ELLDRAGPGFF  315



>ref|WP_009177806.1| porphobilinogen deaminase [Silicibacter sp. TrichCH4B]
 gb|EEW58311.1| porphobilinogen deaminase [Silicibacter sp. TrichCH4B]
Length=318

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 202/312 (65%), Gaps = 9/312 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaee--gaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETRD+L  +           +              +PL +IG K
Sbjct  12    LKIGTRGSPLALAQAYETRDRLARAFELEPTAFDIVVIKTTGDNRAMIDADRPLKEIGNK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EAL +  ID+AVHSMKD+PT  P+  +L C LPREDVRDAF+S    ++ADL
Sbjct  72    GLFTKEIEEALTSGGIDLAVHSMKDMPTEQPEGLMLDCYLPREDVRDAFVSPQIRAIADL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VGT+SLRR++Q+LHR P L+V+E FRGNVQTRL+KL +GV  AT LA+AGL+RL+
Sbjct  132   PEGAVVGTSSLRRRAQLLHRRPDLQVVE-FRGNVQTRLQKLQDGVASATFLAMAGLRRLN  190

Query  735   MTENV--TSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             M E V  T I P EDMLPAVAQGAIGI  RSDD   A  + +++H ET L +  ERAFL 
Sbjct  191   MAEEVPATPIAP-EDMLPAVAQGAIGIERRSDDTTAAAMLEAIHHAETSLRLAAERAFLA  249

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDGSC TPIA  A     G    +G +  PDG+  +   +     + D   +G   G+ 
Sbjct  250   ALDGSCETPIAALADLS-GGTLQLRGQILRPDGSEALADQQS--CAIEDGAELGRRMGEA  306

Query  1089  LLLQAGPGFFGN  1124
             L  +AG GFF +
Sbjct  307   LRARAGEGFFSH  318



>ref|WP_009798520.1| porphobilinogen deaminase [Nitrobacter sp. Nb-311A]
 gb|EAQ37457.1| porphobilinogen deaminase [Nitrobacter sp. Nb-311A]
Length=316

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 203/289 (70%), Gaps = 7/289 (2%)
 Frame = +3

Query  171   QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
             Q + +T++ +  IGTRGSPLALAQA+E RD+L  +H        I I  I+T+GD I  +
Sbjct  2     QSSDETEI-LATIGTRGSPLALAQAHEVRDRLARAH--QVAPERIAIKTIRTSGDAIQDR  58

Query  351   PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
             PL D+GGKGLFTKEI+EAL+   ID AVHS KDVPT+LPD T LP  LPREDVRD FIS 
Sbjct  59    PLFDVGGKGLFTKEIEEALLAGAIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDVFISP  118

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
              AASL DLPAGS VGTASLRR++ +L   P LKV    RGNV+TRLRK++ G   ATLLA
Sbjct  119   RAASLHDLPAGSIVGTASLRRQAMVLRLRPDLKV-NALRGNVETRLRKIDAGEADATLLA  177

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             LAGL RL + +  T IL  E+ LPAV QGAI I  R DD+++  ++ ++   ET +A+  
Sbjct  178   LAGLNRLGLQDKATRILETEEFLPAVGQGAIAIESRRDDDRINAFVKAIGDSETEVALSA  237

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRK  1034
             ER+FL  LDGSCRTPI G+ R   +GD I F+GL+ SPDGT   ET+R+
Sbjct  238   ERSFLALLDGSCRTPIGGHCR--VNGDRIHFRGLIISPDGTESYETTRE  284



>ref|WP_046002114.1| porphobilinogen deaminase [Ruegeria mobilis]
 gb|KJZ25744.1| porphobilinogen deaminase [Ruegeria mobilis]
Length=318

 Score =   273 bits (698),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 204/312 (65%), Gaps = 9/312 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPe--laeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETRD+L  +      A +  +              +PL +IG K
Sbjct  12    LKIGTRGSPLALAQAYETRDRLARAFELEPTAFDIVVIKTTGDNRAMIDADRPLKEIGNK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EAL +  ID+AVHSMKD+PT  P   +L C LPREDVRDAF+S    ++ADL
Sbjct  72    GLFTKEIEEALTSGGIDLAVHSMKDMPTEQPAGLMLDCYLPREDVRDAFVSPQIRAIADL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VGT+SLRR++Q+LHR P L+V+E FRGNVQTRL+KL++GV  AT LA+AGL+RL+
Sbjct  132   PEGAVVGTSSLRRRAQLLHRRPDLQVVE-FRGNVQTRLQKLHDGVASATFLAMAGLRRLN  190

Query  735   MTENV--TSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             M E V  T I P EDMLPAVAQGAIGI  RSDD   A  + +++H ET L +  ERAFL 
Sbjct  191   MAEEVPATPIAP-EDMLPAVAQGAIGIERRSDDTIAAAMLEAIHHAETSLRLAAERAFLA  249

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
              LDGSC TPIA  A     G    +G +  PDG+  +   +     + D   +G   G+ 
Sbjct  250   ALDGSCETPIAALAELS-GGTLQLRGQILRPDGSEALADQQS--CAIEDGAELGRRMGEA  306

Query  1089  LLLQAGPGFFGN  1124
             L  +AG GFF +
Sbjct  307   LRARAGEGFFSH  318



>ref|WP_045369227.1| porphobilinogen deaminase [Methyloceanibacter caenitepidi]
Length=312

 Score =   273 bits (697),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 170/305 (56%), Positives = 210/305 (69%), Gaps = 8/305 (3%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLAL QA   RD+L A H    + GA  + +I T+GD+I  +PLAD GGKGLFT
Sbjct  11    IGTRGSPLALWQAEHVRDRLAAHH--GPDRGAASLSVITTSGDRIQDKPLADFGGKGLFT  68

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEIDEAL+  +I +AVHSMKD+PT LPD   L   LPR DVRDAF+S SAASLA LPAG+
Sbjct  69    KEIDEALLRGDIALAVHSMKDLPTQLPDGLCLAAVLPRADVRDAFLSPSAASLAALPAGA  128

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VGT+SLRR +Q+    P ++V+ +FRGNVQTR+RKL EGV  ATLLA AGL RL + + 
Sbjct  129   VVGTSSLRRGAQVKRARPDVRVV-DFRGNVQTRMRKLAEGVADATLLAKAGLDRLGLADA  187

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
              TS+L +++MLPAVAQGAIG+  R DD++    +  LN   T  AV CERAFL  LDGSC
Sbjct  188   ATSVLSVDEMLPAVAQGAIGVVTRCDDDETRALLQPLNDSATETAVTCERAFLAELDGSC  247

Query  927   RTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQA  1103
             RTPIAG A    +GD I F+GL+ SPDG    E    GP    + +  G  AG+++  +A
Sbjct  248   RTPIAGLA--AVEGDTIRFRGLILSPDGAEWHEVEMTGPVAEAEAI--GHRAGEDVRGRA  303

Query  1104  GPGFF  1118
             GP F 
Sbjct  304   GPAFL  308



>ref|WP_028030585.1| porphobilinogen deaminase [Gemmobacter nectariphilus]
Length=315

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 205/306 (67%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGSPLALAQA+ETRD+LMA+H    +   I +I +     +  S  L + GGKGL
Sbjct  12    LRIGTRGSPLALAQAHETRDRLMAAHELPEDAFEIVVIKVTGDRIQDRS--LREAGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL++  IDIAVHS KD+PT  PD  +L C LPREDVRDAF+S  A  LADLP 
Sbjct  70    FTREIEEALLDGSIDIAVHSTKDMPTLQPDGLVLDCYLPREDVRDAFLSDVAGGLADLPP  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q++HR P L V+E FRGNVQTRL+KL +GV  AT LA+AGL RL + 
Sbjct  130   GAVVGSSSLRRRAQLIHRRPDLVVVE-FRGNVQTRLQKLRDGVAGATFLAMAGLNRLGLA  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                 S +  +DMLPAV QGAIGI  R+ D ++A  +  ++H +T L +  ERA L  LDG
Sbjct  189   HLARSAIEPDDMLPAVGQGAIGIERRAGDARVAALLDPIHHAQTGLRLAAERAMLRVLDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC+TPIAG A   E G    +G V  PDG+  I+   +G     D V +GED  + LL  
Sbjct  249   SCQTPIAGLALV-EGGQIRLRGEVLRPDGSEAIQL--EGSAGSGDAVALGEDLARRLLAA  305

Query  1101  AGPGFF  1118
             A  GFF
Sbjct  306   APSGFF  311



>ref|WP_038072126.1| porphobilinogen deaminase [Thioclava pacifica]
 gb|KEO55993.1| hypothetical protein TP2_00305 [Thioclava pacifica DSM 10166]
Length=317

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 203/309 (66%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +LMA+H  PE A E  +               PL +IG K
Sbjct  11    LKIGTRGSPLALAQAYETRQRLMAAHGLPEDAFEIVVIKTTGDDRALIASDTPLKEIGNK  70

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EA+++  IDIAVHSMKD+PT  P+  +L C LPREDVRDAF+SL   S+  L
Sbjct  71    GLFTKEIEEAMVDGRIDIAVHSMKDMPTEQPEGLVLDCYLPREDVRDAFVSLHHESIKAL  130

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VG++SLRR++Q+ H  P L+++E FRGNVQTRL+KL +GV  AT LA+AGL RL 
Sbjct  131   PEGAKVGSSSLRRRAQLGHVRPDLELVE-FRGNVQTRLKKLEDGVAAATFLAMAGLNRLG  189

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +     +  E+MLPAVAQGAIGI  R  D +    +  ++   T   +  ERAFL TL
Sbjct  190   MADVARCAIEPEEMLPAVAQGAIGIERRMSDARAEALLDPIHDVPTAQRLAAERAFLATL  249

Query  915   DGSCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    +GD ++ +G +  PDG+  I   R G   ++D   MGE   ++L
Sbjct  250   DGSCETPIAGLALI--EGDRLWLRGEILRPDGSEAISGERWG--DIDDGAAMGEHLARDL  305

Query  1092  LLQAGPGFF  1118
             L QAG GFF
Sbjct  306   LSQAGEGFF  314



>ref|WP_036722300.1| porphobilinogen deaminase, partial [Paracoccus sphaerophysae]
Length=310

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 218/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETRD+L A+H     + A  I +IKTTGD++L +PL +IGGKGL
Sbjct  11    MRIGTRGSALALAQAHETRDRLAAAH--GLSQDAFVIEVIKTTGDRVLDRPLREIGGKGL  68

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL++A IDIAVHSMKD+P   P+  +L C LPREDVRDAF+S    ++ADLPA
Sbjct  69    FTREIEDALLDARIDIAVHSMKDMPVLQPEGLVLDCYLPREDVRDAFVSRRWNAIADLPA  128

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+ HR P L ++E FRGNVQTR+RKL+EGV +AT LA+AGL RL M 
Sbjct  129   GTIVGSSSLRRRAQLSHRRPDLTLVE-FRGNVQTRMRKLDEGVAEATFLAMAGLTRLGML  187

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + V   +  ++MLPAVAQGAIG+  R+DD      +A+++   T L V  ERAFL  LDG
Sbjct  188   DVVRGRISPDEMLPAVAQGAIGVERRADDPVAGAMLAAISDLPTVLRVEAERAFLRRLDG  247

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    DGD +  +G +  PDG+  I   R+G  T  D   MG D  +ELL 
Sbjct  248   SCETPIAGLAEL--DGDRLRLRGEILLPDGSVSITGVREGLAT--DGPAMGRDLAEELLG  303

Query  1098  QAGPGFF  1118
             +A P FF
Sbjct  304   RAPPAFF  310



>ref|WP_013217400.1| porphobilinogen deaminase [Hyphomicrobium denitrificans]
 gb|ADJ25241.1| porphobilinogen deaminase [Hyphomicrobium denitrificans ATCC 
51888]
Length=310

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 217/311 (70%), Gaps = 8/311 (3%)
 Frame = +3

Query  189   KVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIG  368
             + A IRIGTRGSPLALAQA+E RD+L  +H     E AI I IIKTTGD++  +PL+DIG
Sbjct  2     QAARIRIGTRGSPLALAQAHEVRDRLAKAH--GLSEDAISITIIKTTGDRVTDRPLSDIG  59

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
             GKGLFTKEI++AL   EIDIAVHSMKD+ T LPD   L   LPRED RDAFISL  A+++
Sbjct  60    GKGLFTKEIEDALFAREIDIAVHSMKDMQTELPDGLALGAVLPREDPRDAFISLKHANIS  119

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
              LP G+ VGT+SLRRKSQ+L   P L V+ +FRGNV+TRLRKL +G+ +AT LA+AGL R
Sbjct  120   ALPTGAIVGTSSLRRKSQVLSIRPDLSVI-DFRGNVETRLRKLKDGIAEATFLAVAGLNR  178

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             L +++ +T+I+P  DMLPA AQGAIG+  R+ D++   ++A LN   ++ AV  ERAFL 
Sbjct  179   LGLSDRITAIVPSADMLPAAAQGAIGLEIRTGDKEAEAFVAPLNDVNSQRAVTAERAFLA  238

Query  909   TLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGK  1085
              L+GSCRTPIA +A    DG+ + F+G V S DG +  + SR G    N    +G  A  
Sbjct  239   RLEGSCRTPIAAHAT--IDGEQLSFRGQVLSLDGQQKYDVSRSGAA--NASRDIGLAAAD  294

Query  1086  ELLLQAGPGFF  1118
             E+L +A P   
Sbjct  295   EVLSKADPALL  305



>ref|WP_011313802.1| porphobilinogen deaminase [Nitrobacter winogradskyi]
 sp|Q3SVF3.1|HEM3_NITWN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName: 
Full=Hydroxymethylbilane synthase; Short=HMBS; AltName: Full=Pre-uroporphyrinogen 
synthase [Nitrobacter winogradskyi Nb-255]
 gb|ABA03738.1| porphobilinogen deaminase [Nitrobacter winogradskyi Nb-255]
Length=316

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/289 (56%), Positives = 203/289 (70%), Gaps = 7/289 (2%)
 Frame = +3

Query  171   QQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQ  350
             Q + +T + +  IGTRGSPLALAQA+E RD+L  +H        I I  I+T+GD I  +
Sbjct  2     QSSDETDI-LATIGTRGSPLALAQAHEVRDRLARAH--QVAPERIAIKTIRTSGDAIQDR  58

Query  351   PLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIsl  530
             PL D+GGKGLFTKEI+EAL+   ID AVHS KDVPT+LPD T LP  LPREDVRD FIS 
Sbjct  59    PLFDVGGKGLFTKEIEEALLAGTIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDVFISP  118

Query  531   saasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLA  710
              A SL DLPAG+TVGTASLRR++ +L   P LKV  + RGNV+TRLRK++ G   ATLLA
Sbjct  119   HAGSLNDLPAGATVGTASLRRQAMVLKLRPDLKV-NSLRGNVETRLRKISVGEADATLLA  177

Query  711   LAGLKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVC  890
             LAGL RL + +  T IL  ++ LPAV QGAI I  R DD+++  ++ ++   ET +A+  
Sbjct  178   LAGLNRLGLQDKATRILETDEFLPAVGQGAIAIESRRDDDRINAFVKAIGDPETEVALSA  237

Query  891   ERAFLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRK  1034
             ER+FL  LDGSCRTPI G+ R   +GD I F+GL+ SPDGT   ET+R+
Sbjct  238   ERSFLALLDGSCRTPIGGHCR--VNGDRIDFRGLIISPDGTEFYETTRE  284



>ref|WP_009818330.1| porphobilinogen deaminase [Roseovarius sp. 217]
 gb|EAQ25033.1| porphobilinogen deaminase [Roseovarius sp. 217]
Length=315

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 217/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ETR +L A+      E   EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  12    LKIGTRGSPLALAQAFETRARLGAAF--DLPEEVFEIVVIKTTGDQIIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL+  EIDIAVHSMKD+P   P+  +L   LPREDVRDAF+S    SLADLPA
Sbjct  70    FTREIEQALLTGEIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPLVGSLADLPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRRK+Q+L  YP L+V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  130   GALVGTSSLRRKAQVLVAYPHLQVVE-FRGNVQTRLKKLADGVATCTFLAMAGLNRLGRS  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T  +  E MLPAVAQGAIGI  R+DD + A  +A+++H+ET   +V ERAFL  LDG
Sbjct  189   EVATGAIDPEVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    +G+ +  +G +  PDG+  +   +  P  + D   +G     +LL 
Sbjct  249   SCETPIAGLAEL--NGNTLRLRGEILRPDGSESLTDDQSAP--IEDGADLGRAMAAKLLA  304

Query  1098  QAGPGFF  1118
             QAGPGFF
Sbjct  305   QAGPGFF  311



>ref|WP_011456959.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
 gb|ABD56762.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
Length=318

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 204/313 (65%), Gaps = 6/313 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  A +RIGTRGSPLALAQA ETR +LMA+   PE A E  +                L 
Sbjct  7     TPAAPLRIGTRGSPLALAQARETRARLMAAWDLPEDAFEIVVIKTTGDDRSLIDADVALK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             ++GGKGLFTKEI+E ++ + IDIAVHSMKD+PT  PD  +L C LPREDVRDAF+S++  
Sbjct  67    ELGGKGLFTKEIEEDMLTSSIDIAVHSMKDMPTVQPDGLMLDCYLPREDVRDAFVSVNHD  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
              L  LP G+ VG++SLRR++Q+  R P L V+E FRGNVQTR++KL  GV  AT LA+AG
Sbjct  127   GLHALPEGAIVGSSSLRRRAQLFARRPDLNVVE-FRGNVQTRMKKLGGGVADATFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RL M E V S + +EDMLPAVAQGAIGI  R  D +  + +A++++ ET   +  ER+
Sbjct  186   LRRLGMEEVVKSAIEVEDMLPAVAQGAIGIERRVSDTRAGDMLAAIHNTETGQRLAAERS  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
             FL  LDGSC+TPIA  A   + G    +G +  PDG+ V+   R  P  + D   +G D 
Sbjct  246   FLKGLDGSCQTPIAALAEL-DGGTLRLRGEILRPDGSEVLTDDRTAP--IEDGAALGADM  302

Query  1080  GKELLLQAGPGFF  1118
              ++L  +AG GFF
Sbjct  303   ARDLRARAGDGFF  315



>ref|WP_037260363.1| porphobilinogen deaminase [Roseivivax halodurans]
 gb|ETX15477.1| porphobilinogen deaminase [Roseivivax halodurans JCM 10272]
Length=317

 Score =   271 bits (694),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 219/309 (71%), Gaps = 8/309 (3%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             A +RIGTRGSPLALAQA ETRD+L A+        A EI++IKTTGD+I+ +PL +IGGK
Sbjct  10    AALRIGTRGSPLALAQANETRDRLAAAF--DLPHEAFEIVVIKTTGDRIIDRPLKEIGGK  67

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFT+EI+ A+++ EID+AVHSMKD+PT  P+  IL   LPRED RDAFIS   + +ADL
Sbjct  68    GLFTREIEAAMVSGEIDLAVHSMKDMPTLQPEGLILDTYLPREDPRDAFISPEFSRIADL  127

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+ VGT+SLRR++Q+ HR P L+V+E FRGNVQTRLRKL +GV + T LA AGL RL+
Sbjct  128   PEGAVVGTSSLRRRAQVQHRRPDLQVVE-FRGNVQTRLRKLEDGVARCTFLACAGLNRLE  186

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             MT+   + +  EDMLPAVAQGAIGI  R DD++ A  +A+++  ET   +  ERA+L  L
Sbjct  187   MTDLPQTPVDPEDMLPAVAQGAIGIERRIDDDRAAEMLAAIHDLETAQRIAAERAYLAAL  246

Query  915   DGSCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    DGD ++ +G V  PDG+      R+G  ++ D   MG D  +EL
Sbjct  247   DGSCETPIAGLALL--DGDRLWLRGEVLRPDGSEAHSGEREG--SIADGPDMGRDLAREL  302

Query  1092  LLQAGPGFF  1118
             L +AG  FF
Sbjct  303   LDRAGTDFF  311



>ref|WP_010443568.1| porphobilinogen deaminase [Ruegeria conchae]
Length=318

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/313 (51%), Positives = 203/313 (65%), Gaps = 6/313 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  + ++IGTRGSPLALAQAYETR +L A+   PE A E  +              +PL 
Sbjct  7     TPASPLKIGTRGSPLALAQAYETRQRLGAAFDLPEDAFEIVVIKTTGDNRAMIDADRPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             +IG KGLFTKEI+EA++  EIDIAVHS KD+P   PD   L   LPREDVRDAFIS S +
Sbjct  67    EIGNKGLFTKEIEEAMLKGEIDIAVHSTKDMPVEQPDGLALDTFLPREDVRDAFISPSLS  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             S+ +LP G+ VGT+SLRR++Q+L+R P L V+E FRGNVQTRL+KL +GV   T LA+AG
Sbjct  127   SIHELPEGAVVGTSSLRRRAQLLNRRPDLNVVE-FRGNVQTRLKKLADGVADCTFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RLDM +   + +   DMLPA+AQG IGI  RSDD   A  +A+++H ET   +  ER+
Sbjct  186   LRRLDMKDVPATAISTVDMLPAIAQGTIGIERRSDDTLAAEMLAAIHHVETSQRLAAERS  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
              L  LDGSC TPIAG A    DG    +G V  PDG+  I        +++D + +G+  
Sbjct  246   LLAGLDGSCETPIAGLAEI-RDGRLHLRGEVLRPDGSEAINDEVTA--SVDDGIELGQSM  302

Query  1080  GKELLLQAGPGFF  1118
                LL QAGPGFF
Sbjct  303   AASLLKQAGPGFF  315



>ref|WP_025310957.1| porphobilinogen deaminase [Roseibacterium elongatum]
 gb|AHM03062.1| Porphobilinogen deaminase [Roseibacterium elongatum DSM 19469]
Length=320

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 162/314 (52%), Positives = 209/314 (67%), Gaps = 8/314 (3%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  + ++IGTRGSPLALAQAYETR +LMA+   PE A E  +        G     +PL 
Sbjct  7     TPASPLKIGTRGSPLALAQAYETRTRLMAAFDLPEEAFEIVVIKTTGDDRGLIDADKPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             ++GGKGLFTKEI+EA++   IDIAVHSMKD+P   P   IL   LPREDVRDAF+SL+  
Sbjct  67    ELGGKGLFTKEIEEAMLTGGIDIAVHSMKDMPVEQPPGLILDTYLPREDVRDAFVSLNHD  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             SLA LP G+ VG++SLRR++Q+  R P L+V+E FRGNVQTR++KL +GV  AT LA+AG
Sbjct  127   SLAALPEGARVGSSSLRRRAQLKARRPDLQVVE-FRGNVQTRMKKLGDGVADATFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RL MTE V S + +ED+LPAVAQGAIGI  R DD + A  +A+++   T   +  ERA
Sbjct  186   LRRLGMTEVVKSAIEVEDVLPAVAQGAIGIERRIDDTRAAEMLAAIHDGPTGQRLAAERA  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGED  1076
             FL  LDGSC TPIAG A    DG  +  +G +  PDG+ V+   R  P  + D   +G +
Sbjct  246   FLAGLDGSCETPIAGLAEL--DGTMLRLRGEILRPDGSEVLTADRTAP--IEDGAKLGAE  301

Query  1077  AGKELLLQAGPGFF  1118
                +L  +AG GFF
Sbjct  302   MAADLRAEAGEGFF  315



>ref|WP_036346454.1| porphobilinogen deaminase [Microvirga sp. BSC39]
 gb|KFG70632.1| porphobilinogen deaminase [Microvirga sp. BSC39]
Length=313

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 213/307 (69%), Gaps = 7/307 (2%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaiei---iiikttgdkilSQPLADIGGKG  377
             IGTRGSPLALAQA+ET+ +L+A+H    +   +E     IIKTTGD I  +PL++ GGKG
Sbjct  9     IGTRGSPLALAQAHETQHRLVAAHGSTGDGWTVEHLPLSIIKTTGDAIQDRPLSEAGGKG  68

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKE+D AL+   ID+AVHS KD+PT LP+  ++   LPREDVRDAFIS    S++DLP
Sbjct  69    LFTKELDIALLEGSIDLAVHSAKDLPTTLPEGIVIAGFLPREDVRDAFISHRFKSISDLP  128

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VG+ASLRR++Q+    P L+V    RGNVQTRL KL  G V ATLLA+AGL+RL +
Sbjct  129   QGAVVGSASLRRQAQVRRLRPDLQV-TLLRGNVQTRLAKLERGEVDATLLAMAGLRRLGL  187

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
             T++VT++L  +D LPAV QGAI IA R++DE++   +  +    T  A+  ERAFLT LD
Sbjct  188   TDHVTTMLETDDFLPAVGQGAIAIAIRAEDERVREALQPILDAPTGHALAAERAFLTILD  247

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIAG+AR    G+  F+GLV  PDG+  +E  R+G  +L D V +G DAG EL  
Sbjct  248   GSCRTPIAGHARL-VGGELEFRGLVLRPDGSESLEAVRRG--SLGDAVALGRDAGSELRA  304

Query  1098  QAGPGFF  1118
             +  P F 
Sbjct  305   RMPPDFL  311



>ref|WP_024351921.1| porphobilinogen deaminase [Aurantimonas coralicida]
Length=311

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 160/307 (52%), Positives = 203/307 (66%), Gaps = 5/307 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             IIRIGTRGS LA AQA E R +LMA+H    E   IE+I           +PL+++GGKG
Sbjct  5     IIRIGTRGSQLAKAQASEVRARLMAAHDLPEEAFEIEVISTTGDRIL--DRPLSEVGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI+ ALI+  IDIA HS KD+ T  P+   +   LPREDVRDAFI  +AA++ +LP
Sbjct  63    LFTKEIEAALIDGRIDIAAHSSKDMATASPEGLEVSAYLPREDVRDAFIGRTAATIDELP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+T+G+ASLRR+S +    P LKV+  FRGNVQ+RLRKL EG V ATLLALAGL R+ M
Sbjct  123   HGATIGSASLRRQSLLKRMRPDLKVI-TFRGNVQSRLRKLEEGQVDATLLALAGLNRMAM  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              +  T IL +E  LPA  QGAI I  R  DE++   +A++    T +A+  ERAFL  LD
Sbjct  182   QDVATEILEVERFLPAPGQGAICIQNRIGDERVHGLVAAIADPRTTVALTAERAFLAELD  241

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIA +A   EDG     G++ +PDG+R+ ET R G  T  D   +G  AG+++L 
Sbjct  242   GSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTGIAT--DAEALGRLAGRDVLD  299

Query  1098  QAGPGFF  1118
              AGPGFF
Sbjct  300   AAGPGFF  306



>ref|WP_037242990.1| porphobilinogen deaminase [Roseovarius sp. MCTG156(2b)]
Length=315

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 218/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ETR +L  +      E   EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  12    LKIGTRGSPLALAQAHETRARLGTAF--DLPEEVFEIVVIKTTGDQIIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL+  EIDIAVHSMKD+P   P+  +L   LPREDVRDAF+S S  SLADLPA
Sbjct  70    FTREIEQALLTGEIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPSVGSLADLPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRRK+Q+L  YP L+V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  130   GALVGTSSLRRKAQVLVAYPHLEVVE-FRGNVQTRLKKLADGVAVCTFLAMAGLNRLGRS  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + VTS +  E MLPAVAQGAIGI  R DD + A+ +A+++H+ET   +V ERAFL TLDG
Sbjct  189   DVVTSAISPEVMLPAVAQGAIGIERRIDDHRAADMLAAIHHKETGQRLVSERAFLATLDG  248

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    DG  +  +G +  PDG+  +   +  P  + D   +G     +LL 
Sbjct  249   SCETPIAGLAEI--DGTTLRLRGEILRPDGSESLTDDQSAP--IEDGAELGRAMATKLLA  304

Query  1098  QAGPGFF  1118
             QAG GFF
Sbjct  305   QAGEGFF  311



>ref|WP_008559063.1| porphobilinogen deaminase [Ruegeria sp. R11]
 gb|EEB69685.1| porphobilinogen deaminase [Ruegeria sp. R11]
Length=320

 Score =   271 bits (692),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 204/309 (66%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +L A+   P+ A E  +              +PL ++GGK
Sbjct  13    LKIGTRGSPLALAQAYETRARLAAAFDLPDDAFEIVVIKTTGDNQALIAADKPLKELGGK  72

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+E L++  IDIAVHSMKD+P   PD  +L   LPREDVRDAFIS S  S+ DL
Sbjct  73    GLFTKEIEEDLLSGAIDIAVHSMKDMPVQQPDGLVLDTYLPREDVRDAFISPSLTSIHDL  132

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
               G+ VGT+SLRR++Q+LHR P L V++ FRGNVQTRLRKL+EGV + T LA+AGL RL 
Sbjct  133   AKGAVVGTSSLRRRAQLLHRRPDLNVVQ-FRGNVQTRLRKLSEGVAECTFLAMAGLNRLA  191

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +   + +   DMLPAVAQGAIGI  R+ D + A+ +A+++ ++T   +  ERAFL  L
Sbjct  192   MADVPANAIETNDMLPAVAQGAIGIERRTSDNRAADMLAAIHDQQTGQRLAAERAFLAAL  251

Query  915   DGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    DG  +  +G V  PDG+  I   ++ P  + D   +G     +L
Sbjct  252   DGSCETPIAGLAEL--DGTTLRLRGEVLRPDGSEAISDDQRCP--IEDGAELGRAMAAKL  307

Query  1092  LLQAGPGFF  1118
             L QAG GFF
Sbjct  308   LDQAGEGFF  316



>ref|WP_008282440.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
 gb|EDM30563.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
Length=315

 Score =   270 bits (691),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 219/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ETR +L A+      E A EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  12    LKIGTRGSPLALAQAFETRARLGAAF--DLPEEAFEIVVIKTTGDQIIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++A++  +IDIAVHSMKD+P   P+  +L   LPREDVRDAF+S + ASLADLPA
Sbjct  70    FTREIEQAMLTGDIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPTVASLADLPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VGT+SLRRK+Q+L  YP L+V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  130   GSLVGTSSLRRKAQVLVAYPHLEVVE-FRGNVQTRLKKLEDGVAACTFLAMAGLNRLGRS  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T  +  + MLPAVAQGAIGI  R+DD + A  +A+++H+ET   +V ERAFL  LDG
Sbjct  189   EVATCAIDADVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    +G  +  +G +  PDG+  +   +  P  + D   +G     +LL 
Sbjct  249   SCETPIAGLAEL--NGSTLRLRGEILRPDGSESLTDDQSAP--IEDGAELGRAMAAKLLA  304

Query  1098  QAGPGFF  1118
             QAGPGFF
Sbjct  305   QAGPGFF  311



>ref|WP_009806314.1| porphobilinogen deaminase [Oceanicola batsensis]
 gb|EAQ03661.1| porphobilinogen deaminase [Oceanicola batsensis HTCC2597]
Length=315

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 204/306 (67%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+E RD+L  +H       A E+ +I+TTGD++  +PL +IGGKGL
Sbjct  12    LKIGTRGSPLALAQAHEARDRL--AHAFDLPPEAFEVCVIQTTGDRVQDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+ AL+   IDIAVHSMKD+P   P+  +L C LPRED RDAF+S     L  +PA
Sbjct  70    FTREIEHALLTGGIDIAVHSMKDMPVLQPEGLLLDCYLPREDPRDAFVSNLYERLDQIPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRR++Q+L R P L+V+E FRGNVQTRLRKL +GV  AT LA+AGL RLD  
Sbjct  130   GARVGTSSLRRRAQVLVRRPDLEVVE-FRGNVQTRLRKLADGVASATFLAMAGLNRLDRA  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                 S L  ++MLPAVAQGAIGI  R DD   A  + +++  ET   +  ERAFL  LDG
Sbjct  189   SIARSALATDEMLPAVAQGAIGIERREDDHATAALLEAIHDPETARQLAAERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A   E G    +G +  PDG+  ++  R  P  + D   +G + G  LL Q
Sbjct  249   SCETPIAGLADL-EGGTLRLRGEILRPDGSEALKDDRSAP--VEDGAKLGREMGAALLAQ  305

Query  1101  AGPGFF  1118
             AG GFF
Sbjct  306   AGDGFF  311



>ref|WP_035707557.1| porphobilinogen deaminase [Niveispirillum irakense]
Length=319

 Score =   270 bits (691),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 215/308 (70%), Gaps = 4/308 (1%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGK  374
             A+IRIGTRGSPLALAQA+ETRD+L A  PELAE GA+EI+  KT GD+I  + L   GGK
Sbjct  4     ALIRIGTRGSPLALAQAHETRDRLAALFPELAEPGAVEIVTFKTEGDRIQDRTLMAAGGK  63

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI++AL++  +D+AVHSMKDVPT+LPD   +   LPRED RD +IS  AA+L DL
Sbjct  64    GLFTKEIEDALLDGRVDLAVHSMKDVPTWLPDGLSISALLPREDHRDGWISFKAATLDDL  123

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             PAGS VGTASLRR++ +L R P L+V+  FRGNVQTRLRKL EG V ATLLA+AG++RL 
Sbjct  124   PAGSVVGTASLRRQALVLMRRPDLRVVP-FRGNVQTRLRKLEEGQVDATLLAMAGMRRLG  182

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             + + VTS++  + MLPAVAQGAIGI  R +D+++  Y+ +LN   T   V  ER  L TL
Sbjct  183   LADRVTSVIEPDVMLPAVAQGAIGIETRINDDRVNRYVMALNCPATAARVAAERGVLATL  242

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSCRTPIA  A        + + LV  P+G +   T+R G   ++D   MG DAG EL 
Sbjct  243   DGSCRTPIAALALISGAALSV-QALVIRPNGQQWFVTARTG--AISDAAAMGIDAGNELK  299

Query  1095  LQAGPGFF  1118
                   FF
Sbjct  300   SMLPSDFF  307



>ref|WP_006327152.1| hydroxymethylbilane synthase [Mesorhizobium sp. STM 4661]
 emb|CCV10692.1| hydroxymethylbilane synthase [Mesorhizobium sp. STM 4661]
Length=308

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 209/306 (68%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ET+ +LMA+H       A EI++I T+GD+I  +PL++ GGKGL
Sbjct  5     LKIGTRGSPLALAQAHETQARLMAAH--DMPVEAFEIVVISTSGDRIQDRPLSEAGGKGL  62

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL+   IDIAVHS KD+PT LPD   L   LPRED RDAFI  +A ++A+LP 
Sbjct  63    FTKEIEEALLERRIDIAVHSSKDMPTILPDGLELSAFLPREDARDAFIGKAAKAIAELPQ  122

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++ I    P L V+  FRGNVQTRLRKL+EGV   T+LA AGLKRL + 
Sbjct  123   GAKVGSSSLRRQALIRRMRPDLHVV-MFRGNVQTRLRKLDEGVADGTILAFAGLKRLGLE  181

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T ++P+E   PA  QGAIGI  R  D K+   +A+++   T  A+ CERAFL  LDG
Sbjct  182   DVITDLMPLETFPPAPGQGAIGIETRIGDRKVEKMLAAIHDVPTGQALACERAFLEALDG  241

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG+A     G   F GL+ SPDGT   E   +GP    D  L+G DA + +  +
Sbjct  242   SCRTPIAGHATI-SGGTLSFAGLIISPDGTDWHEVETQGPA--GDAALIGADAARTVRAK  298

Query  1101  AGPGFF  1118
             AG  FF
Sbjct  299   AGEKFF  304



>gb|ESR22575.1| Porphobilinogen deaminase [Lutibaculum baratangense AMV1]
Length=310

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 211/307 (69%), Gaps = 9/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RI TRGSPLALAQA+E RD+L A+H     + A EI++I+TTGD+I  +PL++ GGKGL
Sbjct  6     VRIATRGSPLALAQAHEVRDRLAAAH--NLGQEAFEIVVIRTTGDRITDRPLSEAGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL +   D+AVHS KDVPT+LPD   L   LPRED RDAFIS  A+ LA LP 
Sbjct  64    FTKEIEEALADDRADLAVHSAKDVPTWLPDGMTLSAVLPREDPRDAFISHVASDLAGLPR  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VGTASLRR++ +    P L+V+  FRGNVQTRL KL  G VQATLLA AGL RL M 
Sbjct  124   GSVVGTASLRRQALVRRARPDLEVV-TFRGNVQTRLEKLRRGEVQATLLAAAGLNRLGMP  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  TS+      LPA+ QG I I  R+    MA ++A+++H ++  A+ CERAFLT LDG
Sbjct  183   EVATSVFDPAGFLPALGQGIIAIETRAGG-AMAAFVAAIDHADSAAALQCERAFLTVLDG  241

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SCRTPIAG+A    +GD I F GLV SPDG     TSR G   + +   +G+DA +E++ 
Sbjct  242   SCRTPIAGHAT--VEGDRISFSGLVISPDGRTEFATSRSG--AVGEAGALGQDAAEEIIA  297

Query  1098  QAGPGFF  1118
             +AG  F 
Sbjct  298   EAGEAFL  304



>ref|WP_040486198.1| porphobilinogen deaminase [Lutibaculum baratangense]
Length=309

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 211/307 (69%), Gaps = 9/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RI TRGSPLALAQA+E RD+L A+H     + A EI++I+TTGD+I  +PL++ GGKGL
Sbjct  5     VRIATRGSPLALAQAHEVRDRLAAAH--NLGQEAFEIVVIRTTGDRITDRPLSEAGGKGL  62

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL +   D+AVHS KDVPT+LPD   L   LPRED RDAFIS  A+ LA LP 
Sbjct  63    FTKEIEEALADDRADLAVHSAKDVPTWLPDGMTLSAVLPREDPRDAFISHVASDLAGLPR  122

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             GS VGTASLRR++ +    P L+V+  FRGNVQTRL KL  G VQATLLA AGL RL M 
Sbjct  123   GSVVGTASLRRQALVRRARPDLEVV-TFRGNVQTRLEKLRRGEVQATLLAAAGLNRLGMP  181

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  TS+      LPA+ QG I I  R+    MA ++A+++H ++  A+ CERAFLT LDG
Sbjct  182   EVATSVFDPAGFLPALGQGIIAIETRAGG-AMAAFVAAIDHADSAAALQCERAFLTVLDG  240

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SCRTPIAG+A    +GD I F GLV SPDG     TSR G   + +   +G+DA +E++ 
Sbjct  241   SCRTPIAGHAT--VEGDRISFSGLVISPDGRTEFATSRSG--AVGEAGALGQDAAEEIIA  296

Query  1098  QAGPGFF  1118
             +AG  F 
Sbjct  297   EAGEAFL  303



>ref|WP_038148380.1| porphobilinogen deaminase [Thioclava sp. 13D2W-2]
Length=317

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 204/309 (66%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQA ETR +LMA+H  PE A E  +               PL +IG K
Sbjct  11    LKIGTRGSPLALAQARETRQRLMAAHGLPEEAFEIVVIKTTGDDRAMIAADTPLKEIGNK  70

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EA+I   IDIAVHSMKD+PT  P+  +L C LPREDVRDAF+ L   S+  L
Sbjct  71    GLFTKEIEEAMIAGRIDIAVHSMKDMPTEQPEGLVLDCYLPREDVRDAFVCLDHDSIGML  130

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+TVG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV  AT LA+AGL+RL 
Sbjct  131   PHGATVGSSSLRRRAQLAHRRPDLELVE-FRGNVQTRLKKLEDGVAAATFLAMAGLRRLG  189

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +   + +  E+MLPAVAQGAIGI  R  D +    + +++  ET   +  ERAFL TL
Sbjct  190   MEDVARAAISPEEMLPAVAQGAIGIERRMADARAEALLDAIHDIETEHRLAAERAFLATL  249

Query  915   DGSCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    +GD ++ +G +  PDG+  +   R G   ++D   MGE   ++L
Sbjct  250   DGSCETPIAGLAVI--EGDRLWLRGEILRPDGSEALSDDRWG--DISDGAAMGEHLARDL  305

Query  1092  LLQAGPGFF  1118
             L +A   FF
Sbjct  306   LSRAPKNFF  314



>ref|WP_045681231.1| porphobilinogen deaminase [Roseovarius sp. BRH_c41]
 gb|KJS45021.1| porphobilinogen deaminase [Roseovarius sp. BRH_c41]
Length=315

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 217/307 (71%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ETR +L  +      E A EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  12    LKIGTRGSPLALAQAFETRARLGTAF--DLPEEAFEIVVIKTTGDQIIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL+  EIDIAVHSMKD+P   P+  +L   LPREDVRDAF+S    SLADLPA
Sbjct  70    FTREIEQALLIGEIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPLVGSLADLPA  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRRK+Q+L  YP L+V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  130   GALVGTSSLRRKAQVLVAYPHLQVVE-FRGNVQTRLKKLADGVATCTFLAMAGLNRLGRS  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T  +  E MLPAVAQGAIGI  R+DD + A  +A+++H+ET   +V ERAFL  LDG
Sbjct  189   EVATGAIDPEVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    +G+ +  +G +  PDG+  +   +  P  + D   +G     +LL 
Sbjct  249   SCETPIAGLAEL--NGNTLRLRGEILRPDGSESLTDDQSAP--IEDGADLGRAMAAKLLA  304

Query  1098  QAGPGFF  1118
             QAGPGFF
Sbjct  305   QAGPGFF  311



>gb|KFE33690.1| porphobilinogen deaminase [Thioclava sp. 13D2W-2]
Length=319

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 204/309 (66%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQA ETR +LMA+H  PE A E  +               PL +IG K
Sbjct  13    LKIGTRGSPLALAQARETRQRLMAAHGLPEEAFEIVVIKTTGDDRAMIAADTPLKEIGNK  72

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+EA+I   IDIAVHSMKD+PT  P+  +L C LPREDVRDAF+ L   S+  L
Sbjct  73    GLFTKEIEEAMIAGRIDIAVHSMKDMPTEQPEGLVLDCYLPREDVRDAFVCLDHDSIGML  132

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
             P G+TVG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV  AT LA+AGL+RL 
Sbjct  133   PHGATVGSSSLRRRAQLAHRRPDLELVE-FRGNVQTRLKKLEDGVAAATFLAMAGLRRLG  191

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +   + +  E+MLPAVAQGAIGI  R  D +    + +++  ET   +  ERAFL TL
Sbjct  192   MEDVARAAISPEEMLPAVAQGAIGIERRMADARAEALLDAIHDIETEHRLAAERAFLATL  251

Query  915   DGSCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    +GD ++ +G +  PDG+  +   R G   ++D   MGE   ++L
Sbjct  252   DGSCETPIAGLAVI--EGDRLWLRGEILRPDGSEALSDDRWG--DISDGAAMGEHLARDL  307

Query  1092  LLQAGPGFF  1118
             L +A   FF
Sbjct  308   LSRAPKNFF  316



>ref|WP_008208997.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
 gb|EBA15148.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
Length=319

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 200/308 (65%), Gaps = 6/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +L  +   P+ A E  +              +PL ++GGK
Sbjct  12    LKIGTRGSPLALAQAYETRARLAKAFDLPQEAFEIVVIKTTGDNQALIAADKPLKELGGK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+E L++  IDIAVHSMKD+P   P+  +L C LPREDVRDAF+S   + L DL
Sbjct  72    GLFTKEIEEDLLSGAIDIAVHSMKDMPVLQPEGLLLDCYLPREDVRDAFVSPKFSRLQDL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
              AG+ VGT+SLRR++Q+++R P LKV+E FRGNVQTRL+KL +GV + T LA+AGL RL 
Sbjct  132   AAGAVVGTSSLRRRAQLMNRRPDLKVVE-FRGNVQTRLKKLEDGVAECTFLAMAGLNRLA  190

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M     + +   DMLPAVAQGAIGI  RSDD ++A  + +++ + T   +  ERAFL  L
Sbjct  191   MESVPATAIETTDMLPAVAQGAIGIERRSDDSRVAAMLEAIHDKATGQRLAAERAFLAAL  250

Query  915   DGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             DGSC TPIAG A   + G    +G V  PDG+  I   +     + D   +G D   +LL
Sbjct  251   DGSCETPIAGLAEL-DGGTLRMRGEVLRPDGSEAIAEDQS--CAIEDGAALGRDMAAKLL  307

Query  1095  LQAGPGFF  1118
              QAGP FF
Sbjct  308   DQAGPSFF  315



>ref|WP_009493632.1| porphobilinogen deaminase [Microvirga lotononidis]
 gb|EIM25275.1| porphobilinogen deaminase [Microvirga lotononidis]
Length=308

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 213/304 (70%), Gaps = 6/304 (2%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLALAQA+ET+D+L+A+H        + + IIKTTGD I  +PL++ GGKGLFT
Sbjct  9     IGTRGSPLALAQAHETQDRLVAAH--GWTVEHLPLSIIKTTGDAIQDRPLSEAGGKGLFT  66

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KE+D AL++  ID+AVHS KD+PT LP+  ++   LPREDVRDAFIS    SL+DLP G+
Sbjct  67    KELDIALLDGSIDLAVHSAKDLPTALPEGIVIAGFLPREDVRDAFISHRYRSLSDLPQGA  126

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VG+ASLRR++Q+    P L+V    RGNVQTRL KL  G V ATLLA+AGL+RL +T++
Sbjct  127   VVGSASLRRQAQVRRLRPDLQV-TLLRGNVQTRLAKLERGEVDATLLAMAGLRRLGLTDH  185

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
             VT++L  +D LPAV QGAI IA R++DE++   +A +    T  A+  ERAFLT LDGSC
Sbjct  186   VTTVLETDDFLPAVGQGAIAIAIRAEDERVRAALAPILDMATAHALAAERAFLTILDGSC  245

Query  927   RTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAG  1106
             RTPIAG+AR    G+   +GLV  PDG+  +E  R+G  + +D   +G +AG EL  +  
Sbjct  246   RTPIAGHARL-VGGELEIRGLVLRPDGSECLEAIRRG--SPDDAAALGREAGSELRSRMP  302

Query  1107  PGFF  1118
             P F 
Sbjct  303   PDFL  306



>ref|WP_009211454.1| porphobilinogen deaminase [Aurantimonas manganoxydans]
 gb|EAS48485.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
Length=311

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 202/307 (66%), Gaps = 5/307 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             IIRIGTRGS LA AQA E R +LMA+H    E   IE+I           +PL+++GGKG
Sbjct  5     IIRIGTRGSQLAKAQASEVRARLMAAHDLPEEAFEIEVISTTGDRIL--DRPLSEVGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI+ ALI+  +DIA HS KD+ T  P+   +   LPREDVRDAFI  +AA++ +LP
Sbjct  63    LFTKEIEAALIDGRVDIAAHSSKDMATASPEGLEVSAYLPREDVRDAFIGRTAATIDELP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+T+G+ASLRR+S +    P LKV+  FRGNVQ+RLRKL EG V ATLLALAGL R+ M
Sbjct  123   HGATIGSASLRRQSLLKRMRPDLKVI-TFRGNVQSRLRKLEEGQVDATLLALAGLNRMAM  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              +  T IL +E  LPA  QGAI I  R  DE++   +A++    T +A+  ERAFL  LD
Sbjct  182   QDVATEILEVERFLPAPGQGAICIQNRIGDERVHGLVAAIADPRTTVALTAERAFLAELD  241

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIA +A   EDG     G++ +PDG+R+ ET R G     D   +G  AG+++L 
Sbjct  242   GSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTG--IAADAEALGRLAGRDVLD  299

Query  1098  QAGPGFF  1118
              AGPGFF
Sbjct  300   AAGPGFF  306



>ref|WP_008384225.1| porphobilinogen deaminase [Rhodovulum sp. PH10]
 gb|EJW12661.1| Porphobilinogen deaminase [Rhodovulum sp. PH10]
Length=310

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 163/308 (53%), Positives = 211/308 (69%), Gaps = 8/308 (3%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
              +RIGTRGSPLAL QA+ET+ +L A+H       AI I +IKTTGD I  +PLA++GGKG
Sbjct  8     FLRIGTRGSPLALWQAHETQRRLAAAH--GVPLEAITITVIKTTGDAIQDRPLAEVGGKG  65

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI++AL +  ID+AVHS KD+ T LPD  +L   LPREDVRDAFI   A +LA+LP
Sbjct  66    LFTKEIEQALFDETIDLAVHSAKDMETALPDGLVLTACLPREDVRDAFICAKAKTLAELP  125

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
             AGS VGTASLRR + +    P ++V+ + RGNV TRLRK++ G V ATLLALAGLKRL +
Sbjct  126   AGSKVGTASLRRGAMVKRLRPDIEVV-SIRGNVDTRLRKISSGEVDATLLALAGLKRLGI  184

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              +   S+   E  LPAV QGA+ I  R+ D +    +A+++  +TR+A+  ERAFL  LD
Sbjct  185   ADKAASVFDAETFLPAVGQGAVAIETRAGDSRTRELLAAIDCRDTRIALTAERAFLGALD  244

Query  918   GSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             GSCRTPIAG+A    DG+ +  +GL+   DG+   ETSR G  T+ +   +G DAG EL 
Sbjct  245   GSCRTPIAGHAT--VDGERLALRGLIVKTDGSVAHETSRAG--TVGEAEALGADAGAELK  300

Query  1095  LQAGPGFF  1118
              + G GFF
Sbjct  301   ARGGAGFF  308



>ref|WP_039682060.1| porphobilinogen deaminase [Tateyamaria sp. ANG-S1]
 gb|KIC51909.1| porphobilinogen deaminase [Tateyamaria sp. ANG-S1]
Length=318

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 163/310 (53%), Positives = 204/310 (66%), Gaps = 6/310 (2%)
 Frame = +3

Query  195   AIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIG  368
             A ++IGTRGSPLALAQAYETR +L  +   PE + E  +  +           +PL +IG
Sbjct  10    APLKIGTRGSPLALAQAYETRQRLGTAFDLPEESFEIVVIKVTGDNRSMIDADRPLKEIG  69

Query  369   GKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasla  548
              KGLFT+EI+E L+  +IDIAVHS KD+PT  PD  +L   LPREDVRDAFIS S  S+A
Sbjct  70    NKGLFTREIEEDLLAGKIDIAVHSTKDMPTVQPDGLVLDTFLPREDVRDAFISHSLTSIA  129

Query  549   dlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKR  728
             DLP G+TVGT+SLRR++Q+L + P L V+E FRGNVQTRL+KL +GV   T LA AGL R
Sbjct  130   DLPKGATVGTSSLRRRAQLLVKRPDLNVVE-FRGNVQTRLQKLADGVADCTFLAHAGLNR  188

Query  729   LDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLT  908
             LDM++   + +   DMLPA+AQGAIGI  RS+D   A  +AS++   T   V+ ER FL 
Sbjct  189   LDMSDVPATPIEPTDMLPAIAQGAIGIERRSNDTNTAELLASIHDTPTGQRVMTERQFLF  248

Query  909   TLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKE  1088
             TLDGSC TPIAG A   ED      G V  PDG+     +R+GP  ++D   MG D  +E
Sbjct  249   TLDGSCETPIAGLATI-EDDTLTLMGEVLRPDGSDARSGTRQGP--VSDGAAMGTDLAQE  305

Query  1089  LLLQAGPGFF  1118
             LL  AG GFF
Sbjct  306   LLKTAGKGFF  315



>ref|WP_046120534.1| porphobilinogen deaminase [Sinorhizobium sp. PC2]
Length=309

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 212/311 (68%), Gaps = 8/311 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
              RIGTRGSPLALAQ +ETRD+L A+H         E++++ T GD+I  +PL++IGGKGL
Sbjct  6     FRIGTRGSPLALAQTHETRDRLAAAH--GLPPEMFEVVVLSTKGDRITDRPLSEIGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+E+++ L++ E+D AVHS KD+PT LPD   L   LPRED+RDAFI  +AA L DLP 
Sbjct  64    FTEELEQQLLSGELDFAVHSSKDMPTKLPDGLFLSAFLPREDIRDAFIGRTAAKLVDLPQ  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+TVG++SLRR++ I    P + V+  +RG V+TRLRKL EG V  TLLA AGL+RL MT
Sbjct  124   GATVGSSSLRRQALIRRLRPDINVI-TYRGQVETRLRKLAEGQVDGTLLAFAGLRRLGMT  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +  T +L  E+  PA AQGAI I  R  D+++   +A+++ + T  AV CER FL TLDG
Sbjct  183   DVPTELLDPEEFPPAPAQGAICIESRIGDQRVNALLAAIDDQRTHEAVFCERGFLATLDG  242

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SCRTPIAGYAR   DG  I F G++ +PDGT     + +G     D   +G  AG+E+  
Sbjct  243   SCRTPIAGYAR--SDGTHIRFSGMILTPDGTTCHRIAIEGKAA--DATELGRKAGEEIRA  298

Query  1098  QAGPGFFGN*I  1130
             +AGPGFF + I
Sbjct  299   KAGPGFFSSWI  309



>ref|WP_008757068.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
 gb|EEE37894.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
Length=318

 Score =   268 bits (684),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 201/313 (64%), Gaps = 6/313 (2%)
 Frame = +3

Query  186   TKVAIIRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLA  359
             T  + ++IGTRGSPLALAQAYETR +L  +   PE A E  +              +PL 
Sbjct  7     TPASPLKIGTRGSPLALAQAYETRRRLSTAFDLPEDAFEIVVIKTTGDNRAMIDADRPLK  66

Query  360   DIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaa  539
             ++G KGLFTKEI+EA++  EIDIAVHS KD+P   P   +L   LPREDVRDAFIS    
Sbjct  67    EVGNKGLFTKEIEEAMLKGEIDIAVHSTKDMPVAQPQGLVLDTFLPREDVRDAFISPGLN  126

Query  540   sladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAG  719
             S+ DLP G+ VGT+SLRR++Q+L+R P LKV+E FRGNVQTRL+KL +GV   T LA+AG
Sbjct  127   SIHDLPRGAVVGTSSLRRRAQLLNRRPDLKVVE-FRGNVQTRLKKLADGVADCTFLAMAG  185

Query  720   LKRLDMTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERA  899
             L+RL+M +   + +  +DMLPA+AQGAIGI  R+DD + A  +A+++H ET   +  ER+
Sbjct  186   LRRLEMADVPATAISPDDMLPAIAQGAIGIERRNDDSRAAGMLAAIHHPETAQRLAAERS  245

Query  900   FLTTLDGSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDA  1079
              L  LDGSC TPIAG A    DG    +G V  PDGT  I     GP  +     MG+  
Sbjct  246   LLAGLDGSCETPIAGLAEI-RDGQLRLRGEVLRPDGTESIHEEAFGP--VESGAKMGQAM  302

Query  1080  GKELLLQAGPGFF  1118
                LL +AGP FF
Sbjct  303   ADTLLKKAGPNFF  315



>ref|WP_011509156.1| porphobilinogen deaminase [Nitrobacter hamburgensis]
 sp|Q1QQP5.1|HEM3_NITHX RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName: 
Full=Hydroxymethylbilane synthase; Short=HMBS; AltName: Full=Pre-uroporphyrinogen 
synthase [Nitrobacter hamburgensis X14]
 gb|ABE61452.1| porphobilinogen deaminase [Nitrobacter hamburgensis X14]
Length=316

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 161/277 (58%), Positives = 195/277 (70%), Gaps = 6/277 (2%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGS LALAQA E RD+L  +H        I I  I+T+GD I  +PL D+GGKGLFT
Sbjct  13    IGTRGSALALAQANEVRDRLARAH--QVAPERIVIKTIRTSGDAIQDRPLFDVGGKGLFT  70

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KEI+EAL+   ID AVHS KDVPT+LPD T LP  LPREDVRDAFIS  AASL DLPAGS
Sbjct  71    KEIEEALLAGSIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDAFISPRAASLNDLPAGS  130

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VGTASLRR++ +L   P LKV    RGNV+TRLRKL  G   ATLLALAGL RL + + 
Sbjct  131   IVGTASLRRQAMVLRLRPDLKV-SVIRGNVETRLRKLVAGEADATLLALAGLNRLGLQDR  189

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
              T IL  ++ LPAV QGAI I  R DD+++  ++ ++   ET +A+  ER+FL  LDGSC
Sbjct  190   ATRILETDEFLPAVGQGAIAIESRRDDDRINAFVKAIGDSETEVALSAERSFLALLDGSC  249

Query  927   RTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRK  1034
             RTPI G+ R   +GD I F+GL+ SPDGT+  ET+R+
Sbjct  250   RTPIGGHCR--VNGDRIHFRGLIISPDGTQSYETTRE  284



>ref|WP_038034928.1| porphobilinogen deaminase [Thermopetrobacter sp. TC1]
Length=304

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/302 (53%), Positives = 212/302 (70%), Gaps = 6/302 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGS LALAQA+ETR +LMA+H     E  +EI+II+TTGD +  +PLA+IGGKGL
Sbjct  4     VKIGTRGSKLALAQAHETRRRLMAAH--GLAEDEVEIVIIRTTGDAVQDRPLAEIGGKGL  61

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL +  +DIAVHSMKDVP + P +  +   LPREDVRDAFIS  A S+A LPA
Sbjct  62    FTKEIEEALADGRVDIAVHSMKDVPAFPPPELDIAACLPREDVRDAFISPLAESIAALPA  121

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+S+RR +Q+L   P + ++  FRGNV TRLRKL +GV  AT LA AGL RL + 
Sbjct  122   GARVGTSSVRRAAQLLAMRPDITIV-PFRGNVDTRLRKLEDGVADATFLACAGLNRLGLA  180

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + +T  +PIE+MLPA+AQGAIG+  R DDE     +++L+ E+TR+AV+ ER F+  L+G
Sbjct  181   DVITQAVPIEEMLPAIAQGAIGLQIRRDDEATRALVSALDDEKTRIAVIAERGFMMELEG  240

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTP+A +AR  E+G+        + DG +   T R+G   L D   +G DAG E+   
Sbjct  241   SCRTPLAAHARV-ENGEVHLICEALTLDGKKRWRTERRG--ALADAEALGRDAGAEIRTA  297

Query  1101  AG  1106
             AG
Sbjct  298   AG  299



>ref|WP_027316789.1| porphobilinogen deaminase [Microvirga flocculans]
Length=308

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 210/304 (69%), Gaps = 6/304 (2%)
 Frame = +3

Query  207   IGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGLFT  386
             IGTRGSPLALAQA+ET+D+L+A+H        + + IIKTTGD I  +PL++ GGKGLFT
Sbjct  9     IGTRGSPLALAQAHETQDRLVAAH--GWTVEQLPLSIIKTTGDAIQDRPLSEAGGKGLFT  66

Query  387   KEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPAGS  566
             KE+D AL++  ID+AVHS KD+PT LP+   +   LPREDVRDAFIS    SLADLP G+
Sbjct  67    KELDIALLDGSIDLAVHSAKDLPTTLPEGIAIAGFLPREDVRDAFISHRFKSLADLPEGA  126

Query  567   TVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMTEN  746
              VG+ASLRR++QI    P L+V    RGNVQTRL KL  G V ATLLA+AGL+RL +T++
Sbjct  127   VVGSASLRRQAQIRRLRPDLQV-TLLRGNVQTRLAKLERGEVDATLLAMAGLRRLGLTDH  185

Query  747   VTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDGSC  926
             VT++L  +D LPAV QGAI IA R+ DE++   +  +    T  A+  ERAFLT LDGSC
Sbjct  186   VTAVLDTQDFLPAVGQGAIAIAVRAADERVRAALQPILDAPTAQALAAERAFLTVLDGSC  245

Query  927   RTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQAG  1106
             RTPIAG+AR   + D   +GLV  PDG+  +ET R+G    +D   +G DAG EL  +  
Sbjct  246   RTPIAGHARLIGN-DLEIRGLVLRPDGSESLETVRRGAP--DDAAALGRDAGSELRARMP  302

Query  1107  PGFF  1118
              GF 
Sbjct  303   AGFL  306



>ref|WP_008192927.1| porphobilinogen deaminase [Labrenzia alexandrii]
 gb|EEE45174.1| porphobilinogen deaminase [Labrenzia alexandrii DFL-11]
Length=308

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 204/308 (66%), Gaps = 6/308 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETR +LMA+H    +   I +I       +   +PL+++GGKGL
Sbjct  6     LRIGTRGSALALAQAHETRARLMAAHDLPEDAFEIVVIKTSGDQIQ--DRPLSEVGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EA+++  ID+AVHS KD+PT LPD   L   LPREDVRDAF+S  A +L DLP 
Sbjct  64    FTKEIEEAMLDGRIDLAVHSSKDMPTVLPDGLALTAFLPREDVRDAFLSPKAKTLMDLPH  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++ I    P ++V+  +RGN+QTRLRKL EG V ATLLA AGL+RL + 
Sbjct  124   GAVVGSSSLRRQAMIKRLRPDIEVV-MYRGNLQTRLRKLAEGEVDATLLAYAGLRRLGLE  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E VTS+L  ED LPAV QGAI I  R  DE+    + +++  ET++ +  ERAFL  LDG
Sbjct  183   EEVTSLLETEDFLPAVGQGAICIESREGDERTLEMLQAIHDRETQIRLDAERAFLAVLDG  242

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPI G A    D +   KG V  PDG+ V +  R G     D V +G+ AG+ L  +
Sbjct  243   SCRTPIGGLALLNGD-ELTLKGTVLKPDGSEVHDEVRSGGAV--DAVQIGQAAGEALKAK  299

Query  1101  AGPGFFGN  1124
              GPGF  +
Sbjct  300   MGPGFLSS  307



>ref|WP_042250405.1| porphobilinogen deaminase [Paracoccus sp. PAMC 22219]
Length=324

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 213/302 (71%), Gaps = 8/302 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +RIGTRGS LALAQA+ETR +LMA+H     + A  I+ IKTTGD++L +PL+ IGGKGL
Sbjct  11    LRIGTRGSVLALAQAHETRGRLMAAH--GLPQDAFRIVPIKTTGDRVLDRPLSQIGGKGL  68

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL    IDIAVHSMKD+PT  PD  ++ C LPREDVRDAF+S   AS+  LP 
Sbjct  69    FTREIEEALTEGAIDIAVHSMKDMPTLQPDGLVIDCLLPREDVRDAFVSPHVASIGALPH  128

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+ HR P L+++E FRGNVQTRL+KL +GV  AT LA+AGL RLDM 
Sbjct  129   GAVVGSSSLRRRAQLAHRRPDLQLVE-FRGNVQTRLQKLADGVAVATFLAMAGLSRLDMR  187

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
                   +  ++MLPAVAQGAIGI  R+DD+   + +A++N   T   +  ERAFL  LDG
Sbjct  188   HVAQGAIEPDEMLPAVAQGAIGIERRADDQDCTSLLAAINDPLTASRIAAERAFLRRLDG  247

Query  921   SCRTPIAGYARRGEDGD-CIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC+TPIAG A    DGD  + +G +  PDG+ V+   R+G    +D  +MG D  +ELL 
Sbjct  248   SCQTPIAGLAV--LDGDRMMLRGEILRPDGSEVVAAGREG--LASDGPMMGVDLAEELLS  303

Query  1098  QA  1103
             +A
Sbjct  304   RA  305



>gb|EDM70283.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
Length=304

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 213/306 (70%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +++GTRGSPLALAQAYETR +L A+        A EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  1     MKLGTRGSPLALAQAYETRSRLSAAF--DLPPEAFEIVVIKTTGDRIIDRPLKEIGGKGL  58

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EA+++ EIDIA+HSMKD+P   P+  +L   LPREDVRDAF+S     LADL  
Sbjct  59    FTREIEEAMLSGEIDIAIHSMKDMPVLQPEGLVLDTYLPREDVRDAFVSPHVGGLADLEP  118

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRRK+Q+L  YP L V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  119   GAKVGTSSLRRKAQVLVAYPHLDVVE-FRGNVQTRLKKLQDGVAACTFLAMAGLNRLGRS  177

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T+ +  ++MLPAVAQGAIGI  R DD + A  +A+++   T   +  ERAFL  LDG
Sbjct  178   EVATAAIETDEMLPAVAQGAIGIERRRDDTRTAEMLAAIHDTPTGQRLAAERAFLAALDG  237

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A   + G    +G V  PDG+  ++  +  P  + D   +G + G++LL +
Sbjct  238   SCETPIAGLAEL-DGGTLRLRGQVLRPDGSEALDDDQSAP--IEDGAKLGHEMGRKLLER  294

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  295   AGPGFF  300



>gb|ACJ85312.1| unknown [Medicago truncatula]
Length=243

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +3

Query  147  VRASIAVEQQAQKTKVAIIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikt  326
            +RAS+AVEQQ Q+TK AIIRIGTRGSPLALAQA+ETRDKL+ASH ELAEEGAI+I+IIKT
Sbjct  44   IRASVAVEQQTQQTKTAIIRIGTRGSPLALAQAHETRDKLIASHTELAEEGAIQIVIIKT  103

Query  327  tgdkilSQPLADIGGKGLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPRED  506
            TGDKILSQPLADIGGKGLFTKEIDEALIN +IDIAVHSMKDVPTYLP+KTILPCNLPRED
Sbjct  104  TGDKILSQPLADIGGKGLFTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPRED  163

Query  507  VRDAFIslsaasladlPAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEG  686
            VRDAFISLSAASLADLPAGS +GTASLRRKSQILHRYPSL V +NFRGNVQT L + + G
Sbjct  164  VRDAFISLSAASLADLPAGSVIGTASLRRKSQILHRYPSLSVQDNFRGNVQTSL-ETSGG  222

Query  687  VVQATLLALAGLKRLDMTE  743
              Q+ L+  +  +RL+MTE
Sbjct  223  GCQSYLIGSSWTERLNMTE  241



>ref|WP_036485948.1| porphobilinogen deaminase [Nitratireductor basaltis]
 gb|KFB08793.1| Porphobilinogen deaminase [Nitratireductor basaltis]
Length=309

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 199/307 (65%), Gaps = 6/307 (2%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             ++RIGTRGS LALAQA ETR +LMA+H    E   I +I       +   +PL++ GGKG
Sbjct  5     VVRIGTRGSQLALAQAAETRARLMAAHDLPEEAFEIVVIRTSGDRIQ--DRPLSEAGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI+EAL +  ID+AVHS KD+PT LPD   +   L REDVRD FI  S   + DLP
Sbjct  63    LFTKEIEEALFDGRIDLAVHSSKDMPTVLPDGLEISAFLEREDVRDVFIGRSVKRIRDLP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ +GT+SLRR++ +L   P L+V   FRGNVQTRLRKL  GV + TLLAL+GLKRL M
Sbjct  123   KGAKLGTSSLRRQALVLRMRPDLEV-GMFRGNVQTRLRKLENGVAEGTLLALSGLKRLQM  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
                 T I+  ++  PA+ QGAI I  R  DE++   +  ++HE T   + CERAFL TLD
Sbjct  182   EHVATEIMDAQEFPPALGQGAICIESRIGDERIKAMLGPIHHEPTGTKLACERAFLATLD  241

Query  918   GSCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             GSCRTPIAG A+  +DG   F G++ +PDG  V E +  G  +  D + +G DAG  +  
Sbjct  242   GSCRTPIAGEAKL-DDGRLNFYGMILTPDGREVHEVTGDGAAS--DAIAIGRDAGARIRD  298

Query  1098  QAGPGFF  1118
              AGPGFF
Sbjct  299   SAGPGFF  305



>gb|EAP75274.1| porphobilinogen deaminase [Roseovarius nubinhibens ISM]
Length=304

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 212/306 (69%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAYETRD+L+A+      E A EI+II TTGD+++ +PL +IGGKGL
Sbjct  1     MKIGTRGSPLALAQAYETRDRLVAAF--DLPETAFEIVIITTTGDRVIDRPLKEIGGKGL  58

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL+  +ID+AVHSMKD+P   P+  I+ C LPREDVRDAFI  +  +L+++  
Sbjct  59    FTREIEDALLTGDIDLAVHSMKDMPVLQPEGLIIDCYLPREDVRDAFICPTGRNLSEMAP  118

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+L  +P L+V+E FRGNVQTRLRKL+EGV   T LA+AGL RL  T
Sbjct  119   GTKVGSSSLRRRAQVLVAHPQLEVVE-FRGNVQTRLRKLDEGVAACTFLAMAGLNRLKRT  177

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E +T  L  E+MLPAVAQGAIGI  R DD   A  + +++H  T   +  ERAFL  LDG
Sbjct  178   EVITRALEPEEMLPAVAQGAIGIERRRDDSGAAMMLEAIHHGPTGQRLAAERAFLAALDG  237

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A   + G    +G +  PDG+  +   R  P  + D   +G     +LL Q
Sbjct  238   SCETPIAGLAEL-QGGTLRLRGEILRPDGSERLCDDRSAP--VEDGAELGRAMAVDLLAQ  294

Query  1101  AGPGFF  1118
             AGP FF
Sbjct  295   AGPDFF  300



>ref|WP_039149675.1| porphobilinogen deaminase [Leisingera sp. ANG-DT]
 gb|KIC16660.1| porphobilinogen deaminase [Leisingera sp. ANG-DT]
Length=319

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 202/309 (65%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +L A+   P+ A E  +              +PL ++GGK
Sbjct  12    LKIGTRGSPLALAQAYETRARLAAAFDLPQEAFEIVVIKTTGDNQALIAADKPLKELGGK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+E L++  IDIAVHSMKD+P   P+   L   LPREDVRDAFIS +  SL DL
Sbjct  72    GLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLALDTYLPREDVRDAFISPALKSLHDL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
               G+ VGT+SLRR++Q+L+R P LKV+E FRGNVQTRLRKL+EGV + T LA+AGL RL 
Sbjct  132   AEGAVVGTSSLRRRAQLLNRRPDLKVVE-FRGNVQTRLRKLSEGVAECTFLAMAGLNRLA  190

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +   + +   DMLPAVAQGAIGI  RSDD +  + +A+++  ET   +  ERAFL  L
Sbjct  191   MDDVPATAIETSDMLPAVAQGAIGIERRSDDSRAGDMLAAIHDHETGQRLAAERAFLAAL  250

Query  915   DGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    DG  +  +G V  PDG+  I   +     + D   +G +   +L
Sbjct  251   DGSCETPIAGLAEL--DGTTLRLRGEVLRPDGSEAISDDQT--CAVEDGAELGREMAAKL  306

Query  1092  LLQAGPGFF  1118
             L +AG GFF
Sbjct  307   LEKAGKGFF  315



>ref|WP_040618046.1| porphobilinogen deaminase [Roseovarius nubinhibens]
Length=315

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 212/306 (69%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAYETRD+L+A+      E A EI+II TTGD+++ +PL +IGGKGL
Sbjct  12    MKIGTRGSPLALAQAYETRDRLVAAF--DLPETAFEIVIITTTGDRVIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI++AL+  +ID+AVHSMKD+P   P+  I+ C LPREDVRDAFI  +  +L+++  
Sbjct  70    FTREIEDALLTGDIDLAVHSMKDMPVLQPEGLIIDCYLPREDVRDAFICPTGRNLSEMAP  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+L  +P L+V+E FRGNVQTRLRKL+EGV   T LA+AGL RL  T
Sbjct  130   GTKVGSSSLRRRAQVLVAHPQLEVVE-FRGNVQTRLRKLDEGVAACTFLAMAGLNRLKRT  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E +T  L  E+MLPAVAQGAIGI  R DD   A  + +++H  T   +  ERAFL  LDG
Sbjct  189   EVITRALEPEEMLPAVAQGAIGIERRRDDSGAAMMLEAIHHGPTGQRLAAERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A   + G    +G +  PDG+  +   R  P  + D   +G     +LL Q
Sbjct  249   SCETPIAGLAEL-QGGTLRLRGEILRPDGSERLCDDRSAP--VEDGAELGRAMAVDLLAQ  305

Query  1101  AGPGFF  1118
             AGP FF
Sbjct  306   AGPDFF  311



>ref|WP_009466433.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
 gb|EFO33454.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
Length=307

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 219/308 (71%), Gaps = 8/308 (3%)
 Frame = +3

Query  198   IIRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKG  377
             ++RIGTRGS LALAQA+ETRD+LMA+H     E A EI+++KT+GD+I  +PL+++GGKG
Sbjct  5     LLRIGTRGSQLALAQAHETRDRLMAAH--GLPEDAFEIVVVKTSGDQIQDRPLSEVGGKG  62

Query  378   LFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlP  557
             LFTKEI++ L++  +D+AVHS KD+PT LP    +   LPREDVRDAFIS  A +L DLP
Sbjct  63    LFTKEIEDMLLDGSLDLAVHSSKDMPTVLPAGLDITAFLPREDVRDAFISPKAKTLRDLP  122

Query  558   AGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDM  737
              G+ VG++SLRR++ +    P + V+  +RGNVQTRLRKL+EGVV ATLLA AGLKRL +
Sbjct  123   HGAVVGSSSLRRQAMVKRLRPDIDVV-MYRGNVQTRLRKLDEGVVDATLLAHAGLKRLGL  181

Query  738   TENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLD  917
              + VTS++  +D +PAV QGAI +  R DDEK    ++++N  ETR+ +  ERAFL  LD
Sbjct  182   GDVVTSVIEADDFVPAVGQGAICLESRLDDEKTNGLLSAINDPETRVRLEAERAFLGVLD  241

Query  918   GSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELL  1094
             G+CRTPI G A    DGD +  KG++  PDG+++ E    G  ++ D   +G  AG+EL 
Sbjct  242   GTCRTPIGGLAT--VDGDTLTLKGVILKPDGSQMHEVEHSG--SVQDAEAIGLAAGEELK  297

Query  1095  LQAGPGFF  1118
              +AGP F 
Sbjct  298   SKAGPNFL  305



>ref|WP_008873487.1| hydroxymethylbilane synthase [Mesorhizobium metallidurans]
 emb|CCV04512.1| hydroxymethylbilane synthase [Mesorhizobium metallidurans STM 
2683]
Length=308

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 207/306 (68%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQA+ET+ +LMA+H     E A E+++I T+GD+I  +PL++ GGKGL
Sbjct  5     LKIGTRGSPLALAQAHETQARLMAAH--GLPEDAFEVVVISTSGDRIQDRPLSEAGGKGL  62

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL+   IDIAVHS KD+PT LPD   L   LPRED RDAFI  +A ++ +LP 
Sbjct  63    FTKEIEEALLERRIDIAVHSSKDMPTLLPDGLELSAFLPREDARDAFIGKAAKAIVELPQ  122

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++ I    P L V+  FRGNVQTRLRKL+EGV   T+LA AGLKRL + 
Sbjct  123   GAKVGSSSLRRQALIRRMRPDLDVV-MFRGNVQTRLRKLDEGVADGTILAYAGLKRLGLE  181

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
               VT ++P+E   PA  QGAIGI  R  D  +   + +++   T  A+ CERAFL  LDG
Sbjct  182   HVVTDLMPLETFPPAPGQGAIGIETRIGDGDVEKMLTAIHDLATGQALACERAFLAALDG  241

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SCRTPIAG+A   E+    F GL+ SPDGT   E   +GP    D  L+G DA + +  +
Sbjct  242   SCRTPIAGHATIAEE-TVFFAGLIISPDGTDWHEVKTQGPA--GDAALIGADAARTVRAK  298

Query  1101  AGPGFF  1118
             AG  FF
Sbjct  299   AGEKFF  304



>ref|WP_037296007.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
Length=315

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/306 (53%), Positives = 213/306 (70%), Gaps = 6/306 (2%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             +++GTRGSPLALAQAYETR +L A+        A EI++IKTTGD+I+ +PL +IGGKGL
Sbjct  12    MKLGTRGSPLALAQAYETRSRLSAAF--DLPPEAFEIVVIKTTGDRIIDRPLKEIGGKGL  69

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EA+++ EIDIA+HSMKD+P   P+  +L   LPREDVRDAF+S     LADL  
Sbjct  70    FTREIEEAMLSGEIDIAIHSMKDMPVLQPEGLVLDTYLPREDVRDAFVSPHVGGLADLEP  129

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VGT+SLRRK+Q+L  YP L V+E FRGNVQTRL+KL +GV   T LA+AGL RL  +
Sbjct  130   GAKVGTSSLRRKAQVLVAYPHLDVVE-FRGNVQTRLKKLQDGVAACTFLAMAGLNRLGRS  188

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             E  T+ +  ++MLPAVAQGAIGI  R DD + A  +A+++   T   +  ERAFL  LDG
Sbjct  189   EVATAAIETDEMLPAVAQGAIGIERRRDDTRTAEMLAAIHDTPTGQRLAAERAFLAALDG  248

Query  921   SCRTPIAGYARRGEDGDCIFKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLLQ  1100
             SC TPIAG A   + G    +G V  PDG+  ++  +  P  + D   +G + G++LL +
Sbjct  249   SCETPIAGLAEL-DGGTLRLRGQVLRPDGSEALDDDQSAP--IEDGAKLGHEMGRKLLER  305

Query  1101  AGPGFF  1118
             AGPGFF
Sbjct  306   AGPGFF  311



>ref|WP_008551662.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
 gb|EEA93137.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
Length=307

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 213/307 (69%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             IRIGTRGS LALAQA+ETR +L  +H     +   EI++IKTTGD+I  +PL++ GGKGL
Sbjct  6     IRIGTRGSALALAQAHETRARLAKAH--GLTDDDFEIVVIKTTGDQIQDRPLSEAGGKGL  63

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FTKEI+EAL++  ID+AVHS KD+PT LPD   +   LPREDVRDAFIS     L DLP 
Sbjct  64    FTKEIEEALLDKSIDLAVHSSKDMPTVLPDGLGMTAYLPREDVRDAFISPKVEKLTDLPQ  123

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++QI    P L V+  +RGN+QTRLRKL+EGVV AT LA AGL+RL   
Sbjct  124   GAVVGSSSLRRQAQIKRLRPDLDVV-MYRGNLQTRLRKLDEGVVDATFLAYAGLRRLGQG  182

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             + VTS++ +E  LPAV QGAIGI  R  DE+ A  +A ++H ET   ++ ERA+L  +DG
Sbjct  183   DLVTSLMDLEHFLPAVGQGAIGIEARLGDEETARILAPIHHAETESRLLLERAYLAEMDG  242

Query  921   SCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SCRTPIAG +    +GD I F+G V  PDG++      +GP  ++D   +G + GKEL  
Sbjct  243   SCRTPIAGLSHV--EGDRIKFRGEVIKPDGSQTHTVEGEGP--VSDAEEIGRELGKELKA  298

Query  1098  QAGPGFF  1118
             ++GP F 
Sbjct  299   KSGPNFL  305



>gb|KFI30717.1| porphobilinogen deaminase [Paenirhodobacter enshiensis]
Length=312

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 220/307 (72%), Gaps = 8/307 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASHPelaeegaieiiiikttgdkilSQPLADIGGKGL  380
             ++IGTRGSPLALAQAYETRD+LMA+H     E A E+++IKTTGDK+L + L +IGGKGL
Sbjct  10    LKIGTRGSPLALAQAYETRDRLMAAH--GLAEAAFEVVVIKTTGDKVLDRALKEIGGKGL  67

Query  381   FTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladlPA  560
             FT+EI+EAL +  IDIAVHSMKD+PT  P   IL C LPREDVRDAF+S    S+ +LP 
Sbjct  68    FTREIEEALSSGAIDIAVHSMKDMPTVQPGGLILDCLLPREDVRDAFVSRQVGSIHELPQ  127

Query  561   GSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLDMT  740
             G+ VG++SLRR++Q+ +R P LK++E FRGNVQTRL KL++GV  AT LA+AGL RL M 
Sbjct  128   GAVVGSSSLRRRAQLANRRPDLKLVE-FRGNVQTRLGKLDDGVAVATFLAMAGLNRLGMA  186

Query  741   ENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTLDG  920
             +  +S +  E+MLPA+AQGAIGI  R  D+++A  +A ++H  T + +  ER+FL TLDG
Sbjct  187   DVASSAIEPEEMLPALAQGAIGIERREADDRVAALLAPIHHAPTGMRLAAERSFLKTLDG  246

Query  921   SCRTPIAGYARRGEDGDCIF-KGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKELLL  1097
             SC TPIAG A    +GD ++ +G +  PDG+  I    +G   L++   +G+   ++L+ 
Sbjct  247   SCETPIAGLALI--EGDRLWLRGEILRPDGSDAIRGEIRG--ALSEGAEIGDTLARQLMA  302

Query  1098  QAGPGFF  1118
             +A   FF
Sbjct  303   EAPKDFF  309



>ref|WP_039173953.1| porphobilinogen deaminase [Leisingera sp. ANG-S5]
 gb|KIC31820.1| porphobilinogen deaminase [Leisingera sp. ANG-S5]
Length=319

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 201/309 (65%), Gaps = 8/309 (3%)
 Frame = +3

Query  201   IRIGTRGSPLALAQAYETRDKLMASH--PelaeegaieiiiikttgdkilSQPLADIGGK  374
             ++IGTRGSPLALAQAYETR +L A+   P  A E  +              +PL ++GGK
Sbjct  12    LKIGTRGSPLALAQAYETRARLAAAFDLPLEAFEIVVIKTTGDNQALIAADKPLKELGGK  71

Query  375   GLFTKEIDEALINAEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFIslsaasladl  554
             GLFTKEI+E L++  IDIAVHSMKD+P   P+   L   LPREDVRDAFIS +  SL DL
Sbjct  72    GLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLALDTYLPREDVRDAFISPALKSLHDL  131

Query  555   PAGSTVGTASLRRKSQILHRYPSLKVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLD  734
               G+ VGT+SLRR++Q+L+R P LKV+E FRGNVQTRLRKL+EGV + T LA+AGL RL 
Sbjct  132   AEGAVVGTSSLRRRAQLLNRRPDLKVVE-FRGNVQTRLRKLSEGVAECTFLAMAGLNRLA  190

Query  735   MTENVTSILPIEDMLPAVAQGAIGIACRSDDEKMANYIASLNHEETRLAVVCERAFLTTL  914
             M +   + +   DMLPAVAQGAIGI  RSDD +  + +A+++  ET   +  ERAFL  L
Sbjct  191   MDDVPATAIETSDMLPAVAQGAIGIERRSDDSRAGDMLAAIHDHETGQRLAAERAFLAAL  250

Query  915   DGSCRTPIAGYARRGEDGDCI-FKGLVASPDGTRVIETSRKGPYTLNDMVLMGEDAGKEL  1091
             DGSC TPIAG A    DG  +  +G V  PDG+  I   +     + D   +G +   +L
Sbjct  251   DGSCETPIAGLAEL--DGTTLHLRGEVLRPDGSEAISDDQT--CAVEDGAELGREMAAKL  306

Query  1092  LLQAGPGFF  1118
             L +AG GFF
Sbjct  307   LEKAGKGFF  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4255375658633