BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6331

Length=1046
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGW47883.1|  beta-galactosidase precursor                            601   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001234465.1|  beta-galactosidase precursor                       599   0.0      Solanum lycopersicum
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 597   0.0      Solanum tuberosum [potatoes]
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      597   0.0      Nicotiana tomentosiformis
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 595   0.0      Nicotiana tomentosiformis
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 591   0.0      Sesamum indicum [beniseed]
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 590   0.0      Nicotiana sylvestris
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      589   0.0      Nicotiana sylvestris
ref|NP_001234303.1|  beta-galactosidase precursor                       586   0.0      Solanum lycopersicum
gb|ADO34788.1|  beta-galactosidase STBG3                                586   0.0      Solanum lycopersicum
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 585   0.0      Nicotiana sylvestris
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 585   0.0      
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 583   0.0      Solanum tuberosum [potatoes]
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 582   0.0      
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 578   0.0      Solanum lycopersicum
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                570   0.0      Erythranthe guttata [common monkey flower]
gb|ACC60981.1|  beta-galactosidase 1 precursor                          575   0.0      Petunia x hybrida [garden petunia]
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 575   0.0      Sesamum indicum [beniseed]
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   555   0.0      Citrus sinensis [apfelsine]
ref|XP_010686091.1|  PREDICTED: beta-galactosidase 1                    561   0.0      Beta vulgaris subsp. vulgaris [field beet]
gb|KJB17252.1|  hypothetical protein B456_003G0595002                   553   0.0      Gossypium raimondii
gb|KJB17255.1|  hypothetical protein B456_003G0595002                   553   0.0      Gossypium raimondii
gb|KJB17254.1|  hypothetical protein B456_003G0595002                   553   0.0      Gossypium raimondii
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                556   0.0      Erythranthe guttata [common monkey flower]
emb|CAC44500.1|  beta-galactosidase                                     558   0.0      Fragaria x ananassa
ref|XP_011463326.1|  PREDICTED: beta-galactosidase 1                    558   0.0      Fragaria vesca subsp. vesca
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   555   0.0      Citrus sinensis [apfelsine]
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      554   0.0      Gossypium arboreum [tree cotton]
ref|XP_007024475.1|  Beta galactosidase 1                               555   0.0      
emb|CDO97918.1|  unnamed protein product                                553   0.0      Coffea canephora [robusta coffee]
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   554   0.0      Citrus sinensis [apfelsine]
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               554   0.0      Citrus sinensis [apfelsine]
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             554   0.0      Citrus clementina [clementine]
gb|AHG94611.1|  beta-galactosidase                                      554   0.0      Camellia sinensis [black tea]
ref|XP_010106660.1|  Beta-galactosidase 1                               553   0.0      Morus notabilis
gb|ABK96254.1|  unknown                                                 552   0.0      Populus trichocarpa x Populus deltoides
ref|XP_006385360.1|  beta-galactosidase 1 family protein                552   0.0      
ref|XP_002527409.1|  beta-galactosidase, putative                       551   0.0      
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      550   0.0      Gossypium arboreum [tree cotton]
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               550   0.0      Populus euphratica
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           550   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           550   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               549   0.0      Tarenaya hassleriana [spider flower]
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             549   0.0      Citrus clementina [clementine]
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               544   0.0      Eucalyptus grandis [rose gum]
ref|XP_010534899.1|  PREDICTED: beta-galactosidase 1                    543   0.0      Tarenaya hassleriana [spider flower]
gb|KJB70255.1|  hypothetical protein B456_011G065300                    536   0.0      Gossypium raimondii
gb|KJB70253.1|  hypothetical protein B456_011G065300                    537   0.0      Gossypium raimondii
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      539   0.0      Nelumbo nucifera [Indian lotus]
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   540   0.0      Citrus sinensis [apfelsine]
gb|ABV32545.1|  beta-galactosidase protein 2                            538   0.0      Prunus persica
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             538   0.0      Prunus persica
gb|KJB56893.1|  hypothetical protein B456_009G140800                    536   0.0      Gossypium raimondii
gb|KJB17253.1|  hypothetical protein B456_003G0595002                   527   0.0      Gossypium raimondii
gb|KJB56892.1|  hypothetical protein B456_009G140800                    537   0.0      Gossypium raimondii
gb|KJB70254.1|  hypothetical protein B456_011G065300                    535   0.0      Gossypium raimondii
gb|KJB70252.1|  hypothetical protein B456_011G065300                    536   0.0      Gossypium raimondii
gb|KJB70251.1|  hypothetical protein B456_011G065300                    536   0.0      Gossypium raimondii
emb|CBI35944.3|  unnamed protein product                                536   0.0      Vitis vinifera
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    536   0.0      Vitis vinifera
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   530   0.0      Citrus sinensis [apfelsine]
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    535   1e-180   Prunus mume [ume]
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    534   2e-180   Malus domestica [apple tree]
ref|XP_008447606.1|  PREDICTED: beta-galactosidase 1                    534   3e-180   Cucumis melo [Oriental melon]
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    533   3e-180   Pyrus x bretschneideri [bai li]
ref|XP_006369293.1|  beta-galactosidase 1 family protein                533   4e-180   
ref|XP_004146823.1|  PREDICTED: beta-galactosidase 1                    533   5e-180   Cucumis sativus [cucumbers]
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               531   3e-179   Populus euphratica
gb|ACP18875.1|  beta-galactosidase pBG(a)                               528   3e-178   Carica papaya [mamon]
gb|KEH18344.1|  beta-galactosidase                                      527   1e-177   Medicago truncatula
dbj|BAF02242.1|  putative galactosidase                                 518   1e-177   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98342.1|  Beta-galactosidase 1 -like protein                      526   2e-177   Gossypium arboreum [tree cotton]
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     521   3e-177   Eucalyptus grandis [rose gum]
dbj|BAH20412.1|  AT3G13750                                              518   3e-177   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF31233.1|  beta-D-galactosidase                                   525   8e-177   Persea americana
gb|EPS65481.1|  beta-galactosidase                                      511   1e-176   Genlisea aurea
gb|ADV41669.1|  beta-D-galactosidase                                    518   7e-176   Actinidia deliciosa var. deliciosa
ref|XP_007135555.1|  hypothetical protein PHAVU_010G139300g             521   2e-175   Phaseolus vulgaris [French bean]
ref|XP_012068994.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    521   3e-175   Jatropha curcas
ref|XP_006300095.1|  hypothetical protein CARUB_v10016323mg             519   1e-174   Capsella rubella
ref|XP_003531618.1|  PREDICTED: beta-galactosidase 1-like               518   2e-174   Glycine max [soybeans]
ref|NP_187988.1|  beta galactosidase 1                                  518   2e-174   Arabidopsis thaliana [mouse-ear cress]
emb|CDY51738.1|  BnaA01g37210D                                          518   2e-174   Brassica napus [oilseed rape]
ref|XP_009146456.1|  PREDICTED: beta-galactosidase 1                    518   4e-174   
ref|XP_009117469.1|  PREDICTED: beta-galactosidase 1-like               518   4e-174   Brassica rapa
emb|CDY37486.1|  BnaC01g37460D                                          518   4e-174   Brassica napus [oilseed rape]
gb|AAM13196.1|  galactosidase, putative                                 518   5e-174   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97513.1|  BnaA05g25660D                                          517   6e-174   
ref|XP_010465236.1|  PREDICTED: beta-galactosidase 1                    516   1e-173   Camelina sativa [gold-of-pleasure]
ref|XP_007012844.1|  Beta-galactosidase                                 516   2e-173   
ref|XP_003546676.1|  PREDICTED: beta-galactosidase 1-like               516   2e-173   Glycine max [soybeans]
ref|XP_006407174.1|  hypothetical protein EUTSA_v10020056mg             516   2e-173   Eutrema salsugineum [saltwater cress]
gb|KHN32687.1|  Beta-galactosidase 1                                    515   2e-173   Glycine soja [wild soybean]
emb|CDY23637.1|  BnaC05g39570D                                          515   4e-173   Brassica napus [oilseed rape]
ref|XP_003529875.1|  PREDICTED: beta-galactosidase 1-like               515   4e-173   Glycine max [soybeans]
gb|KHN39301.1|  Beta-galactosidase 1                                    515   5e-173   Glycine soja [wild soybean]
ref|XP_010487145.1|  PREDICTED: beta-galactosidase 1-like               515   6e-173   Camelina sativa [gold-of-pleasure]
ref|XP_010501131.1|  PREDICTED: beta-galactosidase 1-like               514   7e-173   Camelina sativa [gold-of-pleasure]
ref|XP_002882842.1|  hypothetical protein ARALYDRAFT_897617             514   8e-173   Arabidopsis lyrata subsp. lyrata
gb|KHN30042.1|  Beta-galactosidase 1                                    513   3e-172   Glycine soja [wild soybean]
ref|XP_012076927.1|  PREDICTED: beta-galactosidase-like                 511   2e-171   Jatropha curcas
ref|XP_003543598.1|  PREDICTED: beta-galactosidase 1-like               511   2e-171   Glycine max [soybeans]
emb|CAJ09952.1|  beta-galactosidase                                     493   3e-171   Mangifera indica
ref|XP_011659980.1|  PREDICTED: beta-galactosidase-like                 503   4e-170   Cucumis sativus [cucumbers]
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 503   6e-170   Cucumis melo [Oriental melon]
ref|XP_004486826.1|  PREDICTED: beta-galactosidase 1-like               505   3e-169   Cicer arietinum [garbanzo]
ref|XP_002514108.1|  beta-galactosidase, putative                       505   4e-169   
ref|NP_001266102.1|  beta-galactosidase 1-like precursor                504   7e-169   Cicer arietinum [garbanzo]
gb|KHG11296.1|  Beta-galactosidase                                      499   8e-169   Gossypium arboreum [tree cotton]
ref|XP_006451462.1|  hypothetical protein CICLE_v10007531mg             495   1e-168   
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      504   1e-168   Populus euphratica
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             503   1e-168   Populus trichocarpa [western balsam poplar]
gb|ERM94020.1|  hypothetical protein AMTR_s00136p00108810               501   2e-168   Amborella trichopoda
ref|XP_006826783.2|  PREDICTED: beta-galactosidase                      502   2e-168   
gb|AAQ21370.1|  beta-galactosidase                                      493   4e-168   Sandersonia aurantiaca [Chinese-lantern lily]
emb|CBI27912.3|  unnamed protein product                                502   5e-168   Vitis vinifera
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      501   7e-168   Vitis vinifera
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      503   8e-168   Populus euphratica
gb|KDO57771.1|  hypothetical protein CISIN_1g004219mg                   493   1e-167   Citrus sinensis [apfelsine]
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 497   2e-167   Cucumis sativus [cucumbers]
ref|XP_003597608.1|  Beta-galactosidase                                 499   8e-167   Medicago truncatula
ref|XP_007150529.1|  hypothetical protein PHAVU_005G160000g             499   8e-167   Phaseolus vulgaris [French bean]
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             499   8e-167   Prunus persica
gb|KDO57770.1|  hypothetical protein CISIN_1g004219mg                   493   1e-166   Citrus sinensis [apfelsine]
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             495   2e-166   Citrus clementina [clementine]
gb|AHG94613.1|  beta-galactosidase                                      494   2e-166   Camellia sinensis [black tea]
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   494   3e-166   Citrus sinensis [apfelsine]
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    497   3e-166   
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    496   5e-166   Asparagus officinalis
gb|KJB07252.1|  hypothetical protein B456_001G011600                    493   5e-166   Gossypium raimondii
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 493   8e-166   Cucumis melo [Oriental melon]
gb|ABV32546.1|  beta-galactosidase protein 1                            495   2e-165   Prunus persica
ref|XP_010090040.1|  hypothetical protein L484_027271                   495   2e-165   Morus notabilis
ref|NP_001275845.1|  beta-galactosidase                                 490   1e-164   Citrus sinensis [apfelsine]
gb|ABY71826.1|  beta-galactosidase                                      492   3e-164   Prunus salicina [Japanese plum]
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 488   4e-164   Eucalyptus grandis [rose gum]
gb|AAQ21369.1|  beta-galactosidase                                      489   5e-163   Sandersonia aurantiaca [Chinese-lantern lily]
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     484   6e-163   Eucalyptus grandis [rose gum]
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   485   9e-163   Tarenaya hassleriana [spider flower]
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 484   1e-162   
gb|KJB65169.1|  hypothetical protein B456_010G082900                    487   2e-162   Gossypium raimondii
gb|KJB65170.1|  hypothetical protein B456_010G082900                    487   4e-162   Gossypium raimondii
ref|XP_009768469.1|  PREDICTED: beta-galactosidase-like                 486   9e-162   Nicotiana sylvestris
gb|AAC77377.1|  beta-galactosidase precursor                            482   1e-161   Carica papaya [mamon]
gb|ACC78255.1|  beta-galactosidase                                      482   1e-161   Carica papaya [mamon]
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 481   2e-161   Nicotiana sylvestris
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 481   4e-161   Sesamum indicum [beniseed]
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    484   6e-161   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN06610.1|  Beta-galactosidase                                      483   9e-161   Glycine soja [wild soybean]
gb|KJB65167.1|  hypothetical protein B456_010G082900                    483   2e-160   Gossypium raimondii
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             480   2e-160   Citrus clementina [clementine]
ref|NP_001043405.1|  Os01g0580200                                       481   3e-160   
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      482   3e-160   Nicotiana sylvestris
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   479   4e-160   Citrus sinensis [apfelsine]
gb|EEE54862.1|  hypothetical protein OsJ_02342                          481   5e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      481   7e-160   Nicotiana tomentosiformis
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 477   1e-159   Nicotiana tomentosiformis
ref|XP_010047575.1|  PREDICTED: beta-galactosidase-like                 480   4e-159   Eucalyptus grandis [rose gum]
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      479   5e-159   Nicotiana sylvestris
ref|XP_006838689.1|  PREDICTED: beta-galactosidase 5                    478   9e-159   Amborella trichopoda
gb|AFD54987.1|  beta-galactosidase                                      474   1e-158   Momordica charantia [balsam pear]
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      478   1e-158   Nicotiana tomentosiformis
ref|XP_007154660.1|  hypothetical protein PHAVU_003G137000g             478   1e-158   Phaseolus vulgaris [French bean]
gb|AAK40304.1|  beta-galactosidase                                      473   3e-158   Capsicum annuum
dbj|BAC10578.2|  beta-galactosidase                                     473   3e-158   Capsicum annuum
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 473   4e-158   Eucalyptus grandis [rose gum]
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             472   5e-158   
gb|KHN17668.1|  Beta-galactosidase                                      474   5e-158   Glycine soja [wild soybean]
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   471   8e-158   Citrus sinensis [apfelsine]
gb|KJB07254.1|  hypothetical protein B456_001G011600                    471   1e-157   Gossypium raimondii
ref|XP_011093727.1|  PREDICTED: beta-galactosidase-like                 472   1e-157   Sesamum indicum [beniseed]
ref|XP_003550633.1|  PREDICTED: beta-galactosidase-like                 475   2e-157   Glycine max [soybeans]
ref|XP_009760185.1|  PREDICTED: beta-galactosidase-like isoform X2      475   2e-157   Nicotiana sylvestris
ref|NP_001266133.1|  beta-galactosidase-like                            471   3e-157   Cicer arietinum [garbanzo]
emb|CDX76254.1|  BnaA04g05180D                                          466   4e-157   
ref|XP_010062625.1|  PREDICTED: beta-galactosidase 1                    473   5e-157   
dbj|BAB83260.1|  beta-D-galactosidase                                   471   5e-157   Persea americana
tpg|DAA58691.1|  TPA: hypothetical protein ZEAMMB73_223728              468   5e-157   
ref|NP_001265889.1|  beta-galactosidase-like precursor                  469   9e-157   Cicer arietinum [garbanzo]
ref|XP_009148744.1|  PREDICTED: beta-galactosidase 2 isoform X2         463   1e-156   
ref|XP_006646030.1|  PREDICTED: beta-galactosidase 2-like               472   2e-156   Oryza brachyantha
sp|P48981.1|BGAL_MALDO  RecName: Full=Beta-galactosidase; AltName...    468   3e-156   Malus domestica [apple tree]
ref|XP_009760184.1|  PREDICTED: beta-galactosidase-like isoform X1      472   3e-156   Nicotiana sylvestris
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               471   5e-156   Phoenix dactylifera
ref|XP_003589081.1|  Beta-galactosidase                                 462   6e-156   
ref|XP_003595162.1|  Beta-galactosidase                                 467   7e-156   Medicago truncatula
ref|XP_010545348.1|  PREDICTED: beta-galactosidase 12-like isofor...    466   1e-155   Tarenaya hassleriana [spider flower]
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 466   2e-155   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413222.1|  hypothetical protein EUTSA_v10024511mg             466   3e-155   Eutrema salsugineum [saltwater cress]
ref|XP_010313633.1|  PREDICTED: ss-galactosidase isoform X1             461   3e-155   Solanum lycopersicum
gb|KJB65166.1|  hypothetical protein B456_010G082900                    464   7e-155   Gossypium raimondii
ref|NP_001280755.1|  beta-galactosidase precursor                       464   7e-155   Malus domestica [apple tree]
ref|XP_002867577.1|  beta-galactosidase 12                              464   9e-155   
dbj|BAE72073.1|  pear beta-galactosidase1                               464   1e-154   Pyrus communis
dbj|BAB21492.1|  beta-D-galactosidase                                   464   1e-154   Pyrus pyrifolia [sha li]
emb|CDX95380.1|  BnaC04g27780D                                          464   1e-154   
ref|XP_009352652.1|  PREDICTED: beta-galactosidase                      464   1e-154   Pyrus x bretschneideri [bai li]
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               467   2e-154   Elaeis guineensis
ref|XP_008672351.1|  PREDICTED: hypothetical protein isoform X1         466   2e-154   
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    467   3e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009148743.1|  PREDICTED: beta-galactosidase 2 isoform X1         463   3e-154   Brassica rapa
ref|XP_006285652.1|  hypothetical protein CARUB_v10007108mg             463   4e-154   Capsella rubella
emb|CAH18936.1|  beta-galactosidase                                     462   5e-154   Pyrus communis
ref|XP_003589080.1|  Beta-galactosidase                                 462   6e-154   
ref|NP_849553.1|  beta-galactosidase 12                                 462   8e-154   Arabidopsis thaliana [mouse-ear cress]
gb|AES59331.2|  beta-like galactosidase                                 462   1e-153   Medicago truncatula
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               465   1e-153   Phoenix dactylifera
ref|XP_002455836.1|  hypothetical protein SORBIDRAFT_03g025990          463   1e-153   
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               465   1e-153   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011077977.1|  PREDICTED: beta-galactosidase-like                 460   5e-153   Sesamum indicum [beniseed]
ref|NP_001234842.1|  ss-galactosidase precursor                         459   6e-153   
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               463   6e-153   Elaeis guineensis
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    463   6e-153   Musa acuminata subsp. malaccensis [pisang utan]
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    459   9e-153   Solanum lycopersicum
ref|XP_009418404.1|  PREDICTED: beta-galactosidase 5-like isoform X1    463   9e-153   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC25984.1|  beta-galactosidase                                      459   1e-152   Solanum lycopersicum
ref|XP_010515759.1|  PREDICTED: beta-galactosidase 2 isoform X2         454   2e-152   Camelina sativa [gold-of-pleasure]
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               462   2e-152   Nelumbo nucifera [Indian lotus]
emb|CDY69471.1|  BnaAnng30540D                                          447   3e-152   Brassica napus [oilseed rape]
gb|AAF67341.1|  beta galactosidase                                      457   3e-152   Vigna radiata [mung bean]
ref|XP_006353531.1|  PREDICTED: beta-galactosidase-like                 457   3e-152   Solanum tuberosum [potatoes]
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             457   4e-152   Phaseolus vulgaris [French bean]
gb|EMT02336.1|  Beta-galactosidase 2                                    460   5e-152   
emb|CAB39679.1|  putative beta-galactosidase                            457   5e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217046.1|  hypothetical protein PRUPE_ppa001415mg             461   6e-152   Prunus persica
gb|ACF22882.1|  beta-galactosidase                                      456   8e-152   Glycine max [soybeans]
ref|NP_001289260.1|  beta-galactosidase precursor                       456   1e-151   Pyrus x bretschneideri [bai li]
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               460   1e-151   Phoenix dactylifera
emb|CDY70594.1|  BnaCnng68980D                                          446   1e-151   Brassica napus [oilseed rape]
gb|KHG01120.1|  Beta-galactosidase                                      459   2e-151   Gossypium arboreum [tree cotton]
ref|XP_003566806.1|  PREDICTED: beta-galactosidase 2                    459   2e-151   Brachypodium distachyon [annual false brome]
ref|XP_004969419.1|  PREDICTED: beta-galactosidase 2-like               458   3e-151   Setaria italica
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               459   3e-151   Elaeis guineensis
emb|CDX94367.1|  BnaC01g18170D                                          455   3e-151   
ref|XP_010433545.1|  PREDICTED: beta-galactosidase 12-like isofor...    455   4e-151   Camelina sativa [gold-of-pleasure]
ref|XP_010448320.1|  PREDICTED: beta-galactosidase 12-like isofor...    455   5e-151   Camelina sativa [gold-of-pleasure]
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      458   6e-151   Phoenix dactylifera
ref|XP_010254673.1|  PREDICTED: beta-galactosidase 3-like               458   6e-151   Nelumbo nucifera [Indian lotus]
emb|CAC44502.1|  beta-galactosidase                                     454   6e-151   Fragaria x ananassa
gb|ADO34789.1|  beta-galactosidase STBG4                                454   8e-151   Solanum lycopersicum
ref|XP_008805774.1|  PREDICTED: beta-galactosidase-like isoform X2      457   9e-151   Phoenix dactylifera
ref|XP_008805772.1|  PREDICTED: beta-galactosidase-like isoform X1      457   9e-151   Phoenix dactylifera
ref|XP_010438797.1|  PREDICTED: beta-galactosidase 12 isoform X2        454   1e-150   Camelina sativa [gold-of-pleasure]
ref|XP_004287559.1|  PREDICTED: beta-galactosidase isoform X5           453   2e-150   Fragaria vesca subsp. vesca
ref|XP_010515757.1|  PREDICTED: beta-galactosidase 2 isoform X1         453   2e-150   Camelina sativa [gold-of-pleasure]
ref|XP_010426910.1|  PREDICTED: beta-galactosidase 2-like               452   3e-150   
gb|KHN24609.1|  Beta-galactosidase                                      452   4e-150   Glycine soja [wild soybean]
gb|AGR44464.1|  beta-D-galactosidase 5                                  451   4e-150   Pyrus x bretschneideri [bai li]
ref|XP_002876169.1|  AT3g52840/F8J2_10                                  452   5e-150   
ref|XP_003546457.1|  PREDICTED: beta-galactosidase-like isoform X1      452   6e-150   Glycine max [soybeans]
ref|XP_009139949.1|  PREDICTED: beta-galactosidase 12 isoform X2        452   7e-150   Brassica rapa
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 452   7e-150   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010504030.1|  PREDICTED: beta-galactosidase 2-like               452   8e-150   Camelina sativa [gold-of-pleasure]
gb|EMS53990.1|  Beta-galactosidase 2                                    454   8e-150   Triticum urartu
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 451   1e-149   Cucumis melo [Oriental melon]
ref|XP_010433544.1|  PREDICTED: beta-galactosidase 12-like isofor...    451   1e-149   Camelina sativa [gold-of-pleasure]
ref|XP_010448319.1|  PREDICTED: beta-galactosidase 12-like isofor...    451   2e-149   Camelina sativa [gold-of-pleasure]
dbj|BAE72074.1|  pear beta-galactosidase2                               451   2e-149   Pyrus communis
dbj|BAH20357.1|  AT5G56870                                              447   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 451   2e-149   
emb|CDP01954.1|  unnamed protein product                                454   3e-149   Coffea canephora [robusta coffee]
emb|CAA09467.1|  exo galactanase                                        450   3e-149   Lupinus angustifolius
emb|CAB86888.1|  beta-galactosidase precursor-like protein              450   3e-149   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190852.2|  beta-galactosidase 2                                  450   4e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438795.1|  PREDICTED: beta-galactosidase 12 isoform X1        450   4e-149   Camelina sativa [gold-of-pleasure]
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 450   4e-149   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX89360.1|  BnaA01g15330D                                          448   7e-149   
ref|XP_006403764.1|  hypothetical protein EUTSA_v10010152mg             449   7e-149   Eutrema salsugineum [saltwater cress]
ref|XP_011460033.1|  PREDICTED: beta-galactosidase isoform X3           449   1e-148   Fragaria vesca subsp. vesca
ref|XP_011659982.1|  PREDICTED: beta-galactosidase-like                 448   2e-148   Cucumis sativus [cucumbers]
ref|XP_011460028.1|  PREDICTED: beta-galactosidase isoform X2           449   3e-148   Fragaria vesca subsp. vesca
ref|XP_004287560.2|  PREDICTED: beta-galactosidase isoform X1           449   3e-148   Fragaria vesca subsp. vesca
gb|EEC70952.1|  hypothetical protein OsI_02561                          450   3e-148   Oryza sativa Indica Group [Indian rice]
ref|NP_200498.1|  beta-galactosidase 4                                  447   4e-148   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96780.1|  beta-galactosidase                                      447   4e-148   Arabidopsis thaliana [mouse-ear cress]
gb|AES65414.2|  beta-like galactosidase                                 446   5e-148   Medicago truncatula
ref|XP_009139943.1|  PREDICTED: beta-galactosidase 12 isoform X1        447   6e-148   Brassica rapa
ref|XP_011025878.1|  PREDICTED: beta-galactosidase 3                    450   6e-148   Populus euphratica
ref|XP_002310279.2|  beta-galactosidase family protein                  450   7e-148   
dbj|BAD91082.1|  beta-D-galactosidase                                   451   7e-148   
gb|EYU28411.1|  hypothetical protein MIMGU_mgv1a024117mg                446   1e-147   
ref|XP_004509327.1|  PREDICTED: beta-galactosidase 3-like               450   1e-147   
ref|XP_010483173.1|  PREDICTED: beta-galactosidase 4                    445   3e-147   
ref|XP_009132166.1|  PREDICTED: beta-galactosidase 4                    445   3e-147   
gb|EPS64494.1|  beta-galactosidase                                      445   4e-147   
emb|CDY11899.1|  BnaC03g13250D                                          444   4e-147   
emb|CDX92753.1|  BnaC07g40110D                                          444   5e-147   
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     447   9e-147   
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               447   1e-146   
ref|XP_011460037.1|  PREDICTED: beta-galactosidase isoform X4           444   1e-146   
ref|XP_010443345.1|  PREDICTED: beta-galactosidase 4-like               444   1e-146   
ref|XP_002306893.1|  beta-galactosidase family protein                  447   1e-146   
gb|EPS62826.1|  beta-galactosidase                                      441   1e-146   
ref|XP_010029731.1|  PREDICTED: beta-galactosidase 3                    447   1e-146   
gb|KFK34528.1|  hypothetical protein AALP_AA5G157800                    442   2e-146   
gb|KCW82245.1|  hypothetical protein EUGRSUZ_C03662                     444   2e-146   
ref|XP_010051543.1|  PREDICTED: beta-galactosidase                      444   2e-146   
dbj|BAF31234.1|  beta-D-galactosidase                                   446   3e-146   
ref|XP_003612093.1|  Beta-galactosidase                                 435   3e-146   
gb|KJB17716.1|  hypothetical protein B456_003G011900                    446   5e-146   
ref|XP_011048837.1|  PREDICTED: beta-galactosidase 5                    446   5e-146   
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    446   6e-146   
ref|XP_010649088.1|  PREDICTED: beta-galactosidase 3                    445   6e-146   
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               445   8e-146   
ref|XP_010451557.1|  PREDICTED: beta-galactosidase 4-like               441   1e-145   
gb|KDP32675.1|  hypothetical protein JCGZ_13673                         442   2e-145   
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 441   2e-145   
ref|XP_010915229.1|  PREDICTED: beta-galactosidase isoform X2           444   2e-145   
ref|XP_010531064.1|  PREDICTED: beta-galactosidase 3                    444   2e-145   
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   443   2e-145   
ref|XP_010915228.1|  PREDICTED: beta-galactosidase isoform X1           444   2e-145   
gb|KFK36177.1|  hypothetical protein AALP_AA4G088200                    439   3e-145   
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     438   3e-145   
ref|XP_012078404.1|  PREDICTED: beta-galactosidase 3                    443   3e-145   
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               443   4e-145   
dbj|BAF01862.1|  beta-galactosidase like protein                        435   4e-145   
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             443   4e-145   
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               443   7e-145   
ref|XP_002864484.1|  predicted protein                                  439   7e-145   
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   442   8e-145   
gb|KHN27041.1|  Beta-galactosidase 3                                    442   9e-145   
ref|XP_002510455.1|  beta-galactosidase, putative                       442   1e-144   
gb|KHN41933.1|  Beta-galactosidase 3                                    442   1e-144   
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                442   1e-144   
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               441   2e-144   
gb|KJB43423.1|  hypothetical protein B456_007G198900                    440   3e-144   
gb|AEG76892.1|  putative beta-galactosidase                             437   5e-144   
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               440   5e-144   
ref|XP_007156097.1|  hypothetical protein PHAVU_003G258300g             440   8e-144   
gb|KHN36067.1|  Beta-galactosidase 3                                    440   9e-144   
ref|XP_010446807.1|  PREDICTED: beta-galactosidase 3                    440   1e-143   
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3                    440   1e-143   
ref|XP_010432182.1|  PREDICTED: beta-galactosidase 3-like               440   1e-143   
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 436   1e-143   
ref|XP_006283100.1|  hypothetical protein CARUB_v10004117mg             438   1e-143   
emb|CDY42755.1|  BnaA03g47840D                                          435   1e-143   
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    439   1e-143   
dbj|BAJ34544.1|  unnamed protein product                                439   1e-143   
gb|KJB43424.1|  hypothetical protein B456_007G198900                    439   1e-143   
ref|XP_002891311.1|  hypothetical protein ARALYDRAFT_473836             436   1e-143   
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3                    439   1e-143   
ref|XP_006412011.1|  hypothetical protein EUTSA_v10024387mg             439   2e-143   
gb|AAW47739.1|  beta-galactosidase                                      439   2e-143   
ref|XP_008466519.1|  PREDICTED: beta-galactosidase 5-like               438   3e-143   
ref|XP_006283101.1|  hypothetical protein CARUB_v10004117mg             439   3e-143   
ref|XP_004985589.1|  PREDICTED: beta-galactosidase 5-like isoform X2    435   5e-143   
ref|XP_009137581.1|  PREDICTED: beta-galactosidase 12-like              434   5e-143   
ref|XP_010437358.1|  PREDICTED: beta-galactosidase 3-like               438   5e-143   
ref|XP_009145073.1|  PREDICTED: beta-galactosidase 3                    438   6e-143   
ref|XP_002305449.1|  beta-galactosidase family protein                  434   6e-143   
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    438   6e-143   
emb|CDP07463.1|  unnamed protein product                                437   7e-143   
emb|CDX75569.1|  BnaA01g01330D                                          437   8e-143   
ref|XP_006435077.1|  hypothetical protein CICLE_v10000260mg             431   1e-142   
emb|CDX69219.1|  BnaC01g02340D                                          436   1e-142   
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               435   1e-142   
ref|XP_007158611.1|  hypothetical protein PHAVU_002G1672001g            425   2e-142   
ref|XP_012076925.1|  PREDICTED: beta-galactosidase-like                 435   3e-142   
emb|CAB64741.1|  putative beta-galactosidase                            432   3e-142   
ref|NP_175127.1|  beta-galactosidase 5                                  432   3e-142   
gb|KDP41747.1|  hypothetical protein JCGZ_26765                         430   3e-142   
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               435   4e-142   
ref|XP_002263382.2|  PREDICTED: beta-galactosidase 3                    435   4e-142   
ref|XP_002867020.1|  hypothetical protein ARALYDRAFT_491000             435   6e-142   
gb|KDP33830.1|  hypothetical protein JCGZ_07401                         427   6e-142   
ref|XP_004147848.1|  PREDICTED: beta-galactosidase 5-like               435   6e-142   
ref|XP_012067207.1|  PREDICTED: beta-galactosidase 3-like               431   7e-142   
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       434   1e-141   
gb|EEE58382.1|  hypothetical protein OsJ_09539                          434   1e-141   
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   428   1e-141   
gb|EEC74580.1|  hypothetical protein OsI_10152                          434   1e-141   
gb|AAL24206.1|  At1g45130/F27F5_20                                      431   1e-141   
ref|NP_001049068.1|  Os03g0165400                                       434   1e-141   
gb|KJB43419.1|  hypothetical protein B456_007G198900                    434   2e-141   
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             430   2e-141   
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               430   2e-141   
ref|NP_001268162.1|  beta-galactosidase BG1-like precursor              434   2e-141   
emb|CBI19767.3|  unnamed protein product                                434   2e-141   
emb|CAN78072.1|  hypothetical protein VITISV_013292                     434   2e-141   
ref|XP_002465807.1|  hypothetical protein SORBIDRAFT_01g046160          434   2e-141   
ref|NP_001234317.1|  TBG6 protein precursor                             433   2e-141   
gb|ADO34791.1|  beta-galactosidase STBG6                                433   2e-141   
gb|KFK30264.1|  hypothetical protein AALP_AA7G238600                    434   2e-141   
ref|XP_007042085.1|  Beta-galactosidase 3 isoform 3                     425   2e-141   
ref|XP_006306871.1|  hypothetical protein CARUB_v10008424mg             430   3e-141   
ref|XP_003612092.1|  Beta-galactosidase                                 433   3e-141   
ref|XP_004985588.1|  PREDICTED: beta-galactosidase 5-like isoform X1    433   3e-141   
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    430   3e-141   
gb|KDO84693.1|  hypothetical protein CISIN_1g003076mg                   429   3e-141   
ref|XP_007017652.1|  Beta-galactosidase 5 isoform 2                     428   3e-141   
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     429   4e-141   
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               432   5e-141   
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    432   6e-141   
emb|CDY59693.1|  BnaC07g51120D                                          432   6e-141   
ref|XP_010315322.1|  PREDICTED: beta-galactosidase 3-like               429   6e-141   
ref|NP_001168664.1|  uncharacterized protein LOC100382452               431   7e-141   
gb|KHN00504.1|  Beta-galactosidase 3                                    432   8e-141   
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               432   8e-141   
ref|NP_568001.1|  beta-galactosidase 3                                  432   8e-141   
emb|CDY47949.1|  BnaA10g28210D                                          429   8e-141   
ref|NP_849506.1|  beta-galactosidase 3                                  432   9e-141   
ref|XP_009129554.1|  PREDICTED: beta-galactosidase 5                    429   9e-141   
emb|CAB16852.1|  beta-galactosidase like protein                        432   1e-140   
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    432   1e-140   
ref|XP_006393673.1|  hypothetical protein EUTSA_v10011265mg             428   1e-140   
ref|XP_010552493.1|  PREDICTED: beta-galactosidase 5                    428   1e-140   
ref|XP_009777047.1|  PREDICTED: beta-galactosidase 3-like               428   1e-140   
ref|XP_007017651.1|  Beta-galactosidase 5 isoform 1                     429   2e-140   
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    428   2e-140   
ref|XP_010463222.1|  PREDICTED: beta-galactosidase 5-like               427   2e-140   
ref|XP_008643999.1|  PREDICTED: uncharacterized protein LOC100382...    431   2e-140   
emb|CDY53959.1|  BnaCnng25850D                                          427   3e-140   
tpg|DAA43551.1|  TPA: beta-galactosidase                                431   7e-140   
ref|XP_006435076.1|  hypothetical protein CICLE_v10000260mg             429   8e-140   
gb|KJB58182.1|  hypothetical protein B456_009G198100                    426   9e-140   
emb|CDO97013.1|  unnamed protein product                                426   1e-139   
ref|XP_010090042.1|  Beta-galactosidase 1                               426   1e-139   
gb|AAM22973.1|AF499737_1  beta-galactosidase                            428   2e-139   
ref|XP_004951447.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    424   3e-139   
ref|XP_007042083.1|  Beta-galactosidase 3 isoform 1                     424   3e-139   
gb|KDO84689.1|  hypothetical protein CISIN_1g003076mg                   427   3e-139   
gb|KDO84690.1|  hypothetical protein CISIN_1g003076mg                   427   3e-139   
gb|KFK27244.1|  hypothetical protein AALP_AA8G356800                    424   3e-139   
ref|XP_002514109.1|  beta-galactosidase, putative                       427   5e-139   
ref|XP_008660537.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    427   7e-139   
gb|KDO84688.1|  hypothetical protein CISIN_1g003076mg                   427   7e-139   
ref|XP_006473573.1|  PREDICTED: beta-galactosidase 3-like               427   8e-139   
ref|XP_011083163.1|  PREDICTED: beta-galactosidase 3                    427   8e-139   
gb|AFW89719.1|  hypothetical protein ZEAMMB73_400203                    426   8e-139   
ref|XP_012076926.1|  PREDICTED: beta-galactosidase-like                 426   9e-139   
ref|XP_009614464.1|  PREDICTED: beta-galactosidase 3-like               423   1e-138   
gb|AAB61470.1|  beta-D-galactosidase                                    421   1e-138   
ref|XP_012071945.1|  PREDICTED: beta-galactosidase 5                    426   1e-138   
ref|XP_010113483.1|  Beta-galactosidase 3                               426   2e-138   
emb|CDY32919.1|  BnaC02g12030D                                          422   2e-138   
ref|XP_010679814.1|  PREDICTED: beta-galactosidase 3                    426   2e-138   
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    422   2e-138   
ref|XP_010479073.1|  PREDICTED: beta-galactosidase 5                    422   2e-138   
gb|KJB43422.1|  hypothetical protein B456_007G198900                    426   2e-138   
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               426   2e-138   
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    422   3e-138   
ref|XP_007199661.1|  hypothetical protein PRUPE_ppa001363mg             425   3e-138   
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             420   5e-138   
emb|CDY20708.1|  BnaA02g08480D                                          420   1e-137   
ref|XP_009126921.1|  PREDICTED: beta-galactosidase 4-like               420   1e-137   
ref|XP_002512959.1|  beta-galactosidase, putative                       420   2e-137   
ref|XP_008230925.1|  PREDICTED: beta-galactosidase-like                 422   2e-137   
ref|XP_006280080.1|  hypothetical protein CARUB_v10025963mg             419   4e-137   
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               422   5e-137   
ref|XP_006362025.1|  PREDICTED: beta-galactosidase 3-like               419   6e-137   
gb|KJB43418.1|  hypothetical protein B456_007G198900                    417   7e-137   
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               422   7e-137   
gb|KHG20819.1|  Beta-galactosidase 3                                    411   9e-137   
emb|CDP21667.1|  unnamed protein product                                404   1e-136   
ref|XP_007042086.1|  Beta-galactosidase 3 isoform 4                     412   1e-136   
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      417   2e-136   
ref|XP_008236954.1|  PREDICTED: beta-galactosidase 3-like               421   2e-136   
gb|KHG23756.1|  Beta-galactosidase 5 -like protein                      417   2e-136   
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               419   2e-136   
gb|KJB63585.1|  hypothetical protein B456_010G007300                    417   4e-136   
gb|KCW68186.1|  hypothetical protein EUGRSUZ_F01855                     415   5e-136   
gb|EPS69033.1|  beta-galactosidase                                      416   6e-136   
ref|XP_010061261.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    416   9e-136   
ref|XP_009107461.1|  PREDICTED: beta-galactosidase 5-like isoform X1    416   1e-135   
ref|XP_010110010.1|  Beta-galactosidase 3                               418   1e-135   
ref|XP_004291830.1|  PREDICTED: beta-galactosidase 5                    415   1e-135   
gb|KHG20820.1|  Beta-galactosidase 3                                    411   7e-135   
ref|XP_009760187.1|  PREDICTED: beta-galactosidase-like isoform X4      415   1e-134   
emb|CDP21580.1|  unnamed protein product                                399   1e-134   
dbj|BAJ96054.1|  predicted protein                                      416   1e-134   
gb|EMT10014.1|  Beta-galactosidase 5                                    416   2e-134   
ref|XP_003558743.1|  PREDICTED: beta-galactosidase 5                    415   2e-134   
gb|ADD62393.1|  beta-galactosidase 3                                    410   2e-134   
gb|EMS60063.1|  Beta-galactosidase 5                                    415   3e-134   
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                415   4e-134   
ref|XP_002453540.1|  hypothetical protein SORBIDRAFT_04g007660          411   6e-134   
ref|XP_002437187.1|  hypothetical protein SORBIDRAFT_10g022620          410   8e-134   
dbj|BAK07157.1|  predicted protein                                      414   9e-134   
gb|KJB63587.1|  hypothetical protein B456_010G007300                    410   9e-134   
gb|AFW87014.1|  beta-galactosidase                                      402   9e-134   
emb|CDY36028.1|  BnaA08g04330D                                          410   1e-133   
emb|CAA06310.1|  beta-galactosidase                                     395   1e-133   
ref|XP_008679838.1|  PREDICTED: beta-galactosidase 4                    410   2e-133   
ref|XP_009760186.1|  PREDICTED: beta-galactosidase-like isoform X3      412   2e-133   
gb|EYU31167.1|  hypothetical protein MIMGU_mgv1a001956mg                410   2e-133   
ref|XP_007225291.1|  hypothetical protein PRUPE_ppa001334mg             413   2e-133   
ref|NP_001265904.1|  beta-galactosidase 5-like precursor                410   2e-133   
dbj|BAD91085.1|  beta-D-galactosidase                                   412   3e-133   
gb|AFW66041.1|  hypothetical protein ZEAMMB73_706783                    409   1e-132   
gb|KHN20946.1|  Beta-galactosidase 5                                    407   1e-132   
gb|KGN59822.1|  hypothetical protein Csa_3G848310                       407   2e-132   
sp|Q00662.1|BGAL_DIACA  RecName: Full=Putative beta-galactosidase...    407   2e-132   
gb|KDO84691.1|  hypothetical protein CISIN_1g003076mg                   407   2e-132   
ref|XP_003523710.1|  PREDICTED: beta-galactosidase 3-like isoform 1     407   2e-132   
gb|AAF67342.1|  beta galactosidase                                      407   2e-132   
ref|XP_008221339.1|  PREDICTED: beta-galactosidase 5                    410   3e-132   
gb|KHN45883.1|  Beta-galactosidase 5                                    406   5e-132   
gb|EYU42595.1|  hypothetical protein MIMGU_mgv1a001990mg                405   7e-132   
ref|XP_011457728.1|  PREDICTED: beta-galactosidase 3-like               409   8e-132   
ref|XP_010107841.1|  Beta-galactosidase 3                               409   8e-132   



>gb|AGW47883.1| beta-galactosidase precursor [Nicotiana tabacum]
Length=841

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/348 (84%), Positives = 322/348 (93%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEARVFKS+SG ACAAFLAN++QHS+AKV+FGNMHYNLPPWS+SILPDCKNTVFNTA
Sbjct  360   GNYQEARVFKSESG-ACAAFLANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVFNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMT VS+GF+W S+NEET SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  419   RIGAQSAQMKMTSVSRGFSWDSFNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  478

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID REGFL+ GKWPWL + SAGHALHVFVNGQL G+AYGSLE PK+TFSK+VN+RAGVN
Sbjct  479   KIDSREGFLRSGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVN  538

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GLNEGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  539   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLH  598

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GSFV Q+QPLTWYKTTFNAP GN+PLALD+NTMGKGQVWINGQSIGRY
Sbjct  599   SLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNDPLALDLNTMGKGQVWINGQSIGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWFDEKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  659   WPGYKASGNCGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGN  706



>ref|NP_001234465.1| beta-galactosidase precursor [Solanum lycopersicum]
 sp|P48980.1|BGAL_SOLLC RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAF21626.1|AF023847_1 beta-galactosidase precursor [Solanum lycopersicum]
 emb|CAA58734.1| putative beta-galactosidase/galactanase [Solanum lycopersicum]
 emb|CAA10174.1| ss-galactosidase [Solanum lycopersicum]
Length=835

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/348 (80%), Positives = 313/348 (90%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEARVFKS+SG ACAAFLAN++QHS+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  354   GNYQEARVFKSESG-ACAAFLANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMKMTPVS+GF+W+S+NE+  S+ D+TFTVVGLLEQIN TRD SDYLWY TD+
Sbjct  413   RVGAQSAQMKMTPVSRGFSWESFNEDAASHEDDTFTVVGLLEQINITRDVSDYLWYMTDI  472

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL  G WPWL VFSAGHALHVFVNGQL G+ YGSLENPK+TFS  +N+RAGVN
Sbjct  473   EIDPTEGFLNSGNWPWLTVFSAGHALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVN  532

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGPVSL GLNEG RDLTWQKW YK+GLKGEALSLH
Sbjct  533   KISLLSIAVGLPNVGPHFETWNAGVLGPVSLNGLNEGTRDLTWQKWFYKVGLKGEALSLH  592

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GS SVEWV+GS V QKQPL+WYKTTFNAP GNEPLALDMNTMGKGQVWINGQS+GR+
Sbjct  593   SLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPDGNEPLALDMNTMGKGQVWINGQSLGRH  652

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA K+SG+C VCNY GWFDEKKCL  CGE + RWYHVPRS+L PTGN
Sbjct  653   WPAYKSSGSCSVCNYTGWFDEKKCLTNCGEGSQRWYHVPRSWLYPTGN  700



>ref|XP_006366152.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=839

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/348 (80%), Positives = 312/348 (90%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEARVFKS+SG ACAAFLAN++QHS+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  358   GNYQEARVFKSESG-ACAAFLANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  416

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMKMTPVS+GF+W+SYNE+   + D+TFTVVGLLEQIN TRD SDYLWY TD+
Sbjct  417   RVGAQSAQMKMTPVSRGFSWESYNEDAALHEDDTFTVVGLLEQINITRDVSDYLWYMTDI  476

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL  G WPWL VFSAGHALHVFVNGQL G+ YGSLE+PK+TFS  +N+RAGVN
Sbjct  477   QIDPTEGFLNSGNWPWLTVFSAGHALHVFVNGQLAGTVYGSLEDPKLTFSNGINLRAGVN  536

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGPVSL GLNEG RDLTWQKW YK+GLKGEALSLH
Sbjct  537   KISLLSIAVGLPNVGPHFETWNAGVLGPVSLNGLNEGTRDLTWQKWFYKVGLKGEALSLH  596

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GS SVEWV+GS V QKQPL+WYKTTFNAP GNEPLALDMNTMGKGQVWINGQS+GR+
Sbjct  597   SLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPDGNEPLALDMNTMGKGQVWINGQSLGRH  656

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA K+SG+C VCNY GWFDEKKCL  CGE + RWYHVPRS+L PTGN
Sbjct  657   WPAYKSSGSCSVCNYTGWFDEKKCLTNCGEGSQRWYHVPRSWLYPTGN  704



>ref|XP_009627536.1| PREDICTED: beta-galactosidase [Nicotiana tomentosiformis]
Length=845

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/348 (80%), Positives = 310/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEARVFKS+SG ACAAFLAN++QHS+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEARVFKSESG-ACAAFLANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMKM+PV +GF+WQSYNE+   Y DNT+TVVGLLEQINTTRD SDYLWY TDV
Sbjct  423   RVGAQSAQMKMSPVIRGFSWQSYNEDAALYEDNTYTVVGLLEQINTTRDVSDYLWYMTDV  482

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL  G WPWL VFSAGHALHVFVNGQL G+ YGSLENPK+TFS  +N+RAGVN
Sbjct  483   EIDPTEGFLNSGNWPWLTVFSAGHALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVN  542

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGPVSL GLN+G RDLTWQKW YK+GLKGEALSLH
Sbjct  543   KISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNKGTRDLTWQKWCYKVGLKGEALSLH  602

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GS SVEWV+GS V QKQPL+WYK+TFNAP GNEPLALDMNTM KGQVWINGQS+GR+
Sbjct  603   SLSGSPSVEWVEGSLVAQKQPLSWYKSTFNAPAGNEPLALDMNTMSKGQVWINGQSLGRH  662

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA K+SGNC  CNY GWFDEKKCL  CGE + RWYHVPRS+L PTGN
Sbjct  663   WPAYKSSGNCTACNYKGWFDEKKCLSNCGEGSQRWYHVPRSWLHPTGN  710



>ref|XP_009622143.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=840

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/348 (83%), Positives = 319/348 (92%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SKSGG CAAFLAN++QHS+A V+F N HYNLPPWS+SILPDCKNTVFNTA
Sbjct  359   GHQQEAHVFRSKSGG-CAAFLANYNQHSFATVAFANRHYNLPPWSISILPDCKNTVFNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+GF+W S+NEET SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  418   RIGAQSAQMKMTPVSRGFSWHSFNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  477

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID REGFL+ GKWPWL + SAGHALHVFVNGQL G+AYGSLE PK+TFSK+VN+RAGVN
Sbjct  478   KIDSREGFLRSGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVN  537

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GLNEGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  538   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLH  597

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GSFV Q+QPLTWYKTTFNAP GN+PLALD+NTMGKGQVWINGQSIGRY
Sbjct  598   SLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNDPLALDLNTMGKGQVWINGQSIGRY  657

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWFDEKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  658   WPGYKASGNCGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGN  705



>ref|XP_011080179.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/348 (83%), Positives = 322/348 (93%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKS+SG +CAAFLAN++QHS+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  361   GNYQEAHVFKSRSG-SCAAFLANYNQHSFAKVSFWNMHYNLPPWSISILPDCKNTVYNTA  419

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+GFAWQSYNEE  SY DN+FT+VGL EQINTTRD +DYLWYTTDV
Sbjct  420   RIGAQSAQMKMTPVSKGFAWQSYNEELMSYEDNSFTMVGLREQINTTRDNTDYLWYTTDV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDPREGFL+GGKWP L VFSAGHALHVF+NGQL G+AYGSLE+PKVTFSKSVN+RAGVN
Sbjct  480   KIDPREGFLRGGKWPVLTVFSAGHALHVFINGQLSGTAYGSLESPKVTFSKSVNLRAGVN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGPVSL GLNEGKRDLTWQKW+YK+GLKGE+LSLH
Sbjct  540   KISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWTYKVGLKGESLSLH  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS++ Q+QPLTWYKTTFNAP GNEPLALDM+TM KGQVWINGQSIGRY
Sbjct  600   SLSGSSSVEWVEGSYIAQRQPLTWYKTTFNAPSGNEPLALDMDTMSKGQVWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             W   KASGNCG CNYAGWF+EKKCL  CG+A+ RWYHVPRS+LRPTGN
Sbjct  660   WNEYKASGNCGACNYAGWFNEKKCLSNCGKASQRWYHVPRSWLRPTGN  707



>ref|XP_009769408.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=840

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/348 (83%), Positives = 317/348 (91%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SKSG  CAAFLAN++QHS+A V+F N HYNLPPWS+SILPDCKNTVFNTA
Sbjct  359   GHQQEAHVFRSKSG-TCAAFLANYNQHSFATVTFANRHYNLPPWSISILPDCKNTVFNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMT VS+GF+W S+NEET SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  418   RIGAQSAQMKMTSVSRGFSWDSFNEETASYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  477

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID REGFL+ GKWPWL + SAGHALHVFVNGQL G+AYGSLE PK+TFSK+VN+RAGVN
Sbjct  478   KIDSREGFLRSGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVN  537

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GLNEGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  538   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLKGEALSLH  597

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GSFV Q+QPLTWYKTTFNAP GNEPLALD+NTMGKGQVWINGQSIGRY
Sbjct  598   SLSGSSSVEWVEGSFVAQRQPLTWYKTTFNAPAGNEPLALDLNTMGKGQVWINGQSIGRY  657

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWFDEKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  658   WPGYKASGNCGACNYAGWFDEKKCLSNCGEASQRWYHVPRSWLYPTGN  705



>ref|XP_009783993.1| PREDICTED: beta-galactosidase [Nicotiana sylvestris]
Length=844

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/348 (79%), Positives = 308/348 (89%), Gaps = 2/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEAR+FKS+SG ACAAFLAN++QHS+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEARIFKSESG-ACAAFLANYNQHSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMKM+PV +GF+WQSYNE+   + DNT+TV GLLEQINTTRD SDYLWY TDV
Sbjct  423   RVGAQSAQMKMSPVIRGFSWQSYNEDAALHEDNTYTV-GLLEQINTTRDVSDYLWYMTDV  481

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL  G WPWL VFSAGHALHVFVNGQL G+ YGSLENPK+TFS  +N+RAGVN
Sbjct  482   EIDPTEGFLNSGNWPWLTVFSAGHALHVFVNGQLAGTVYGSLENPKLTFSNGINLRAGVN  541

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGPVSL GLNEG RDLTWQKW YK+GLKGEALSLH
Sbjct  542   KISLLSIAVGLPNVGPHFETWNAGVLGPVSLSGLNEGTRDLTWQKWFYKVGLKGEALSLH  601

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GS SVEWV+GS V QKQPL+WYKTTFNAP GNEPLALDMNTMGKGQVWINGQS+GR+
Sbjct  602   SLSGSPSVEWVEGSLVAQKQPLSWYKTTFNAPAGNEPLALDMNTMGKGQVWINGQSLGRH  661

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  K+SGNC  C Y GWFDEKKCL  CGE + RWYHVPRS+L PTGN
Sbjct  662   WPGYKSSGNCTACYYTGWFDEKKCLSNCGEGSQRWYHVPRSWLHPTGN  709



>ref|NP_001234303.1| beta-galactosidase precursor [Solanum lycopersicum]
 gb|AAF70822.1|AF154421_1 beta-galactosidase [Solanum lycopersicum]
 emb|CAA10173.1| ss-galactosidase [Solanum lycopersicum]
Length=838

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/348 (82%), Positives = 318/348 (91%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SK+G +CAAFLAN+DQHS+A VSF N HYNLPPWS+SILPDCKNTVFNTA
Sbjct  357   GHQQEAHVFRSKAG-SCAAFLANYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+G  WQS+NEET+SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  416   RIGAQSAQMKMTPVSRGLPWQSFNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  475

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID RE FL+GGKWPWL + SAGHALHVFVNGQL G+AYGSLE PK+TFSK+VN+RAGVN
Sbjct  476   KIDSREKFLRGGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVN  535

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GL+EGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  536   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLTGLDEGKRDLTWQKWSYKVGLKGEALSLH  595

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTWYK+TFNAP GN+PLALD+NTMGKGQVWINGQS+GRY
Sbjct  596   SLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRY  655

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWF+EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  656   WPGYKASGNCGACNYAGWFNEKKCLSNCGEASQRWYHVPRSWLYPTGN  703



>gb|ADO34788.1| beta-galactosidase STBG3 [Solanum lycopersicum]
Length=838

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/348 (82%), Positives = 318/348 (91%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SK+G +CAAFLAN+DQHS+A VSF N HYNLPPWS+SILPDCKNTVFNTA
Sbjct  357   GHQQEAHVFRSKAG-SCAAFLANYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+G  WQS+NEET+SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  416   RIGAQSAQMKMTPVSRGLPWQSFNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  475

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID RE FL+GGKWPWL + SAGHALHVFVNGQL G+AYGSLE PK+TFSK+VN+RAGVN
Sbjct  476   KIDSREKFLRGGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLTFSKAVNLRAGVN  535

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GL+EGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  536   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLTGLDEGKRDLTWQKWSYKVGLKGEALSLH  595

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTWYK+TFNAP GN+PLALD+NTMGKGQVWINGQS+GRY
Sbjct  596   SLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRY  655

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWF+EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  656   WPGYKASGNCGACNYAGWFNEKKCLSNCGEASQRWYHVPRSWLYPTGN  703



>ref|XP_009789773.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=842

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/348 (79%), Positives = 310/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEARVF+SKSG ACAAFLAN++QHS+A V+F N HYNLPPWS+SILPDC+NTV+NTA
Sbjct  361   GHYQEARVFRSKSG-ACAAFLANYNQHSFATVAFANRHYNLPPWSISILPDCRNTVYNTA  419

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTP ++GF+WQSYN+E  SY DNTFTVVGLLEQINTTRD SDYLWY TDV
Sbjct  420   RVGAQSALMKMTPANRGFSWQSYNDEPASYEDNTFTVVGLLEQINTTRDVSDYLWYMTDV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDPREGFL  GKWPWL V SAG ALHVFVN QL G+ YGSL++ K+TF+K+VN+RAGVN
Sbjct  480   KIDPREGFLSSGKWPWLRVSSAGPALHVFVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWNTG+LGPVSL GL+EGKRDLTWQKWSYK+GLKGEAL+LH
Sbjct  540   KISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALNLH  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTW+KTTFNAP GNEPLALDMN MGKGQVWINGQSIGRY
Sbjct  600   SLSGSSSVEWVEGSLVAQRQPLTWFKTTFNAPAGNEPLALDMNAMGKGQVWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG CNYAG+F+E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  660   WPGYKASGTCGACNYAGYFNEDKCQSNCGEASQRWYHVPRSWLHPTGN  707



>ref|XP_009606115.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=844

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/348 (79%), Positives = 310/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEARVF+SKSG ACAAFLAN++QHS+A V+F N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GHYQEARVFRSKSG-ACAAFLANYNQHSFATVAFANRHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTPV++GF+WQSYN+E  SY DNTFTVVGLLEQINTTRD SDYLWY TDV
Sbjct  422   RVGAQSALMKMTPVNRGFSWQSYNDEPASYEDNTFTVVGLLEQINTTRDVSDYLWYMTDV  481

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDPREGFL  GKWPWL V SAG ALHVFVN QL G+ YGSL++ K+TF+K+VN+RAGVN
Sbjct  482   KIDPREGFLSSGKWPWLRVSSAGPALHVFVNDQLAGTVYGSLKSQKLTFNKAVNLRAGVN  541

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWNTG+LGPVSL GL+EGKRDLTW+KWSYK+GLKGEAL+LH
Sbjct  542   KISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLDEGKRDLTWRKWSYKVGLKGEALNLH  601

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTW+KTTFNAP GNEPLALDMN MGKGQVWINGQS+GRY
Sbjct  602   SLSGSSSVEWVEGSLVAQRQPLTWFKTTFNAPAGNEPLALDMNVMGKGQVWINGQSLGRY  661

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG CNYAG+F E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  662   WPGYKASGTCGACNYAGFFSEDKCQSNCGEASQRWYHVPRSWLHPTGN  709



>ref|XP_006342989.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=838

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/348 (81%), Positives = 317/348 (91%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SKSG +CAAFLAN+DQHS+A VSF N HYNLPPWS+SILPDCKNTVFNTA
Sbjct  357   GHQQEAHVFRSKSG-SCAAFLANYDQHSFATVSFANRHYNLPPWSISILPDCKNTVFNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+G  WQS+NEET+SY D++FTVVGLLEQINTTRD SDYLWY+TDV
Sbjct  416   RIGAQSAQMKMTPVSRGLPWQSFNEETSSYEDSSFTVVGLLEQINTTRDVSDYLWYSTDV  475

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID RE FL+GGKWPWL + SAGHALHVFVNGQL G+AYGSLE PK++FSK+VN+RAGVN
Sbjct  476   KIDSREEFLRGGKWPWLTIMSAGHALHVFVNGQLAGTAYGSLEKPKLSFSKAVNLRAGVN  535

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWN G+LGPVSL GL+EGKRDLTWQKWSYK+GLKGEALSLH
Sbjct  536   KISLLSIAVGLPNIGPHFETWNAGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALSLH  595

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTWYK+TFNAP GN+PLALD+NTMGKGQVWINGQS+GRY
Sbjct  596   SLSGSSSVEWVEGSLVAQRQPLTWYKSTFNAPAGNDPLALDLNTMGKGQVWINGQSLGRY  655

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG CNYAGWF+EKKCL  CGEA+ R YHVPRS+L PTGN
Sbjct  656   WPGYKASGNCGACNYAGWFNEKKCLSNCGEASQRMYHVPRSWLYPTGN  703



>ref|XP_006357461.1| PREDICTED: beta-galactosidase-like, partial [Solanum tuberosum]
Length=866

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/348 (78%), Positives = 309/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF SKSG  CAAFLAN++QHS+A V+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  385   GNFQEAHVFSSKSG-VCAAFLANYNQHSFATVTFGNRHYNLPPWSISILPDCKNTVYNTA  443

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTP  +GF+WQSYN+E +SY D+TFTVVGLLEQINTTRD SDYLWY TDV
Sbjct  444   RVGAQSALMKMTPADKGFSWQSYNDEPSSYEDSTFTVVGLLEQINTTRDVSDYLWYMTDV  503

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL+ G+WPWL V SAG ALHVFVNGQL G+ YGSL++ K+TF+K+VN+RAGVN
Sbjct  504   KIDPSEGFLRSGQWPWLRVSSAGPALHVFVNGQLAGTVYGSLKSQKITFNKAVNLRAGVN  563

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWNTG+LGPVSL GLNEGKRDL WQKWSYK+GLKGEAL+LH
Sbjct  564   KISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLNEGKRDLAWQKWSYKVGLKGEALNLH  623

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTW+KTTFNAP GNEPLALDMNTMGKGQ+WINGQS+GRY
Sbjct  624   SLSGSSSVEWVEGSLVTQRQPLTWFKTTFNAPAGNEPLALDMNTMGKGQMWINGQSLGRY  683

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  K+SG C  CNYAG+F+E KCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  684   WPGYKSSGTCSACNYAGYFNENKCLSNCGEASQRWYHVPRSWLHPTGN  731



>ref|XP_004241849.1| PREDICTED: beta-galactosidase-like [Solanum lycopersicum]
Length=841

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/348 (78%), Positives = 309/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN Q+A VF SKSG  CAAFLAN++QHS+A V+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GNFQQAHVFTSKSG-VCAAFLANYNQHSFATVTFGNRHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTP  +GF+WQSYN+E +SY D+TFTVVGLLEQINTTRD SDYLWY TDV
Sbjct  419   RVGAQSALMKMTPAVRGFSWQSYNDEPSSYEDSTFTVVGLLEQINTTRDVSDYLWYMTDV  478

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL+ G+WPWL V SAG ALHVFVNGQL G+ YGSL++ K+TF+K+VN+RAG+N
Sbjct  479   KIDPSEGFLRSGQWPWLKVSSAGPALHVFVNGQLAGTVYGSLKSQKITFNKAVNLRAGIN  538

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWNTG+LGPVSL GLNEGKRDL WQKWSYK+GLKGEAL+LH
Sbjct  539   KISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLNEGKRDLAWQKWSYKVGLKGEALNLH  598

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTW+KTTFNAP GNEPLALDMNTMGKGQ+WINGQS+GRY
Sbjct  599   SLSGSSSVEWVEGSLVTQRQPLTWFKTTFNAPAGNEPLALDMNTMGKGQMWINGQSLGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  K+SG C  CNYAG+F+E KCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  659   WPGYKSSGTCSACNYAGYFNENKCLSNCGEASQRWYHVPRSWLHPTGN  706



>gb|EYU45851.1| hypothetical protein MIMGU_mgv1a002308mg [Erythranthe guttata]
Length=689

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/349 (79%), Positives = 318/349 (91%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G SQEA VFKS+SG ACAAFLAN+DQHS+A+VSF NMHY+LPPWS+SILPDCKNTV+NTA
Sbjct  207   GKSQEAHVFKSRSG-ACAAFLANYDQHSFARVSFANMHYDLPPWSISILPDCKNTVYNTA  265

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQS++MKMTPVS+GF+WQSYNEET +SY DN+FTVVGL EQINTTRD++DYLWYTTD
Sbjct  266   RIGAQSAKMKMTPVSRGFSWQSYNEETASSYDDNSFTVVGLREQINTTRDSTDYLWYTTD  325

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID REGFL+GGKWP L V SAGHALHVF+NGQL G+AYGSL+ PK+ F++ VN+RAGV
Sbjct  326   VRIDSREGFLRGGKWPVLTVSSAGHALHVFINGQLSGTAYGSLDKPKLFFNQGVNLRAGV  385

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSI+VGLPN+GP FETWN G+LGP+SL GLNEGKRDLTWQKWSYK+GLKGE+LSL
Sbjct  386   NKISLLSISVGLPNVGPHFETWNAGVLGPISLTGLNEGKRDLTWQKWSYKVGLKGESLSL  445

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS++ ++QPLTWYKT FNAP GNEPLALDMNTM KGQVWINGQ+IGR
Sbjct  446   HSLSGSSSVEWVEGSYIAERQPLTWYKTIFNAPSGNEPLALDMNTMSKGQVWINGQNIGR  505

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YW   KASGNCG CNYAGWF+EKKCL  CGEA+ RWYH+PRS+L PTGN
Sbjct  506   YWNQYKASGNCGACNYAGWFNEKKCLTNCGEASQRWYHIPRSWLYPTGN  554



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/348 (78%), Positives = 307/348 (88%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN Q+A VF+S SG ACAAFLAN+D +S+A V+FGN HYNLPPWS+SILPDCK+TV+NTA
Sbjct  361   GNYQKAHVFRSTSG-ACAAFLANNDPNSFATVAFGNKHYNLPPWSISILPDCKHTVYNTA  419

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTP ++G++WQSYN++T  Y DN FTVVGLLEQ+NTTRD SDYLWY TDV
Sbjct  420   RVGAQSALMKMTPANEGYSWQSYNDQTAFYDDNAFTVVGLLEQLNTTRDVSDYLWYMTDV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGFL+ G WPWL V SAG ALHVFVNGQL G+ YGSL+  K+TFSK+VN+RAGVN
Sbjct  480   KIDPSEGFLRSGNWPWLTVSSAGDALHVFVNGQLAGTVYGSLKKQKITFSKAVNLRAGVN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPNIGP FETWNTG+LGPVSL GL+EGKRDLTWQKWSYK+GLKGEAL+LH
Sbjct  540   KISLLSIAVGLPNIGPHFETWNTGVLGPVSLSGLDEGKRDLTWQKWSYKVGLKGEALNLH  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS V Q+QPLTWYKTTFNAP GNEPLALDMN+MGKGQVWINGQSIGRY
Sbjct  600   SLSGSSSVEWVEGSLVAQRQPLTWYKTTFNAPAGNEPLALDMNSMGKGQVWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG C  CNYAG F+EKKCL  CG+A+ RWYHVPRS+L PTGN
Sbjct  660   WPGYKASGTCDACNYAGPFNEKKCLSNCGDASQRWYHVPRSWLHPTGN  707



>ref|XP_011072510.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=842

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/348 (80%), Positives = 320/348 (92%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VFKSKSG ACAAFLAN+DQHS+AKVSFGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  361   GNNQEAHVFKSKSG-ACAAFLANYDQHSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTA  419

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQS+QMKMTPVS+GF+W+SYNEET S+ DN+FT+VGL+EQINTTRD +DYLWYTTDV
Sbjct  420   RIGAQSAQMKMTPVSKGFSWESYNEETASHDDNSFTMVGLVEQINTTRDNTDYLWYTTDV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP EGF++GGKWP L V SAGHALHVF+NGQL G+AYGSLE+P++TFS+ VN++AGVN
Sbjct  480   KIDPSEGFMRGGKWPVLTVLSAGHALHVFINGQLSGTAYGSLEDPRLTFSEGVNLKAGVN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             +IALLSIAVGLPN+GP FETW  G+LGPVSL GLNEGKRDLTWQKWSYK+GL+GE+LSLH
Sbjct  540   QIALLSIAVGLPNVGPHFETWKAGVLGPVSLSGLNEGKRDLTWQKWSYKVGLRGESLSLH  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+G++V ++QPLTWYKTTFNAP G+EPLALDMN+M KGQVWINGQSIGRY
Sbjct  600   SLSGSSSVEWVEGTYVSERQPLTWYKTTFNAPEGDEPLALDMNSMSKGQVWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             W   KASG+C  CNYAGWF+EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  660   WNQYKASGDCVPCNYAGWFNEKKCLGNCGEASQRWYHVPRSWLYPTGN  707



>gb|KDO65276.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=618

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 306/350 (87%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  136   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  193

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  194   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  253

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  254   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  313

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL+GE L+
Sbjct  314   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLN  373

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  374   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  433

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  434   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  483



>ref|XP_010686091.1| PREDICTED: beta-galactosidase 1 [Beta vulgaris subsp. vulgaris]
Length=841

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/348 (76%), Positives = 302/348 (87%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+SQEA VFKS SG ACAAFLAN++  SYAKV++GN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GSSQEAHVFKSGSG-ACAAFLANYNPSSYAKVAYGNNHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMK TPV   F+WQSYNEET S  D+ FTV+GLLEQ+NTTRD +DYLWY TDV
Sbjct  419   RVGAQSAQMKFTPVYNHFSWQSYNEETASTDDSAFTVLGLLEQVNTTRDMTDYLWYMTDV  478

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID  EGFLKGGK P LNV SAGHALHV++NGQLVG+AYGSLENPK++F + VNMRAG N
Sbjct  479   KIDSNEGFLKGGKEPVLNVMSAGHALHVYINGQLVGTAYGSLENPKISFGEGVNMRAGTN  538

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FE WN GILGPVSL GLNEG+RDLTWQKWSYKIG+KGE LSLH
Sbjct  539   KISLLSIAVGLPNVGPNFERWNAGILGPVSLSGLNEGRRDLTWQKWSYKIGMKGETLSLH  598

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+G S+VEWV+G F+ Q+QPLTWYKTTFNAP GNEPLALDM  MGKGQVWINGQ+IGRY
Sbjct  599   SLSGVSNVEWVEGKFLAQRQPLTWYKTTFNAPSGNEPLALDMGAMGKGQVWINGQNIGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA  A G+C  C+YAG+F EKKCL  CG+A+ RWYHVPRS+L+P GN
Sbjct  659   WPAYTAKGSCSDCSYAGYFSEKKCLTYCGDASQRWYHVPRSWLKPRGN  706



>gb|KJB17252.1| hypothetical protein B456_003G0595002 [Gossypium raimondii]
Length=689

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF  KSGG CAAFLAN+D  S+AKV+F +MHYNLPPWS+SILPDCKNTV+NTA
Sbjct  207   GVHQEAHVFNYKSGG-CAAFLANYDPKSFAKVAFRDMHYNLPPWSISILPDCKNTVYNTA  265

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV    GF+WQ+YNEET S  D++FT+VGLLEQINTTRD++DYLWYTT
Sbjct  266   RVGAQIARKKMVPVPLHGGFSWQAYNEETASDADSSFTMVGLLEQINTTRDSTDYLWYTT  325

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP E F + GK P L + SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VNMRAG
Sbjct  326   DIEIDPNEEFFRNGKSPILTILSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAG  385

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  386   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  445

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQSIG
Sbjct  446   LHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPAGNAPLALDMRSMGKGQIWINGQSIG  505

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNC VCNYAG +DE KC   C EA+ RWYHVPRS+L PTGN
Sbjct  506   RHWPAYKASGNCSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGN  555



>gb|KJB17255.1| hypothetical protein B456_003G0595002, partial [Gossypium raimondii]
Length=692

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF  KSGG CAAFLAN+D  S+AKV+F +MHYNLPPWS+SILPDCKNTV+NTA
Sbjct  209   GVHQEAHVFNYKSGG-CAAFLANYDPKSFAKVAFRDMHYNLPPWSISILPDCKNTVYNTA  267

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV    GF+WQ+YNEET S  D++FT+VGLLEQINTTRD++DYLWYTT
Sbjct  268   RVGAQIARKKMVPVPLHGGFSWQAYNEETASDADSSFTMVGLLEQINTTRDSTDYLWYTT  327

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP E F + GK P L + SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VNMRAG
Sbjct  328   DIEIDPNEEFFRNGKSPILTILSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAG  387

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  388   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  447

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQSIG
Sbjct  448   LHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPAGNAPLALDMRSMGKGQIWINGQSIG  507

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNC VCNYAG +DE KC   C EA+ RWYHVPRS+L PTGN
Sbjct  508   RHWPAYKASGNCSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGN  557



>gb|KJB17254.1| hypothetical protein B456_003G0595002 [Gossypium raimondii]
Length=695

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF  KSGG CAAFLAN+D  S+AKV+F +MHYNLPPWS+SILPDCKNTV+NTA
Sbjct  212   GVHQEAHVFNYKSGG-CAAFLANYDPKSFAKVAFRDMHYNLPPWSISILPDCKNTVYNTA  270

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV    GF+WQ+YNEET S  D++FT+VGLLEQINTTRD++DYLWYTT
Sbjct  271   RVGAQIARKKMVPVPLHGGFSWQAYNEETASDADSSFTMVGLLEQINTTRDSTDYLWYTT  330

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP E F + GK P L + SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VNMRAG
Sbjct  331   DIEIDPNEEFFRNGKSPILTILSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAG  390

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  391   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  450

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQSIG
Sbjct  451   LHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPAGNAPLALDMRSMGKGQIWINGQSIG  510

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNC VCNYAG +DE KC   C EA+ RWYHVPRS+L PTGN
Sbjct  511   RHWPAYKASGNCSVCNYAGTYDENKCRTNCEEASQRWYHVPRSWLNPTGN  560



>gb|EYU21377.1| hypothetical protein MIMGU_mgv1a001631mg [Erythranthe guttata]
Length=782

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/348 (77%), Positives = 314/348 (90%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKS++G ACAAFLAN++QHS+AKVSFGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  301   GNYQEAHVFKSRAG-ACAAFLANYNQHSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTA  359

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIG+QS+QMKMTPVS+ F+WQSY+EET S  +N+FT+VGL+EQINTTRD +DYLWYTT+V
Sbjct  360   RIGSQSAQMKMTPVSKEFSWQSYDEETASLEENSFTMVGLVEQINTTRDNTDYLWYTTEV  419

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
             TID  EGF +GG+ P L V SAGHALHVF+NGQ+ G+AYGSLENP++TF+++VN+RAGVN
Sbjct  420   TIDTSEGFFRGGQLPSLTVLSAGHALHVFINGQISGTAYGSLENPRLTFNEAVNLRAGVN  479

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             +I+LLSIAVGLPNIGP FETWN GILGPVS+ GLNEGKRDLTWQKWSYK+GL GE+LSLH
Sbjct  480   QISLLSIAVGLPNIGPHFETWNAGILGPVSVSGLNEGKRDLTWQKWSYKVGLTGESLSLH  539

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+G +V ++QPLTWYKTTFNAP G+EPLALDMNTM KGQ+WING+SIGRY
Sbjct  540   SLSGSSSVEWVEGLYVTERQPLTWYKTTFNAPEGDEPLALDMNTMSKGQIWINGESIGRY  599

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             W   KASG C  CNY GWFDEKKCL KC EA+ RWYHVPRS+LRP+GN
Sbjct  600   WNQYKASGECVPCNYTGWFDEKKCLSKCDEASQRWYHVPRSWLRPSGN  647



>emb|CAC44500.1| beta-galactosidase [Fragaria x ananassa]
Length=843

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 299/350 (85%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS SG ACAAFLAN+++ S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GTYQEAHVFKSNSG-ACAAFLANYNRKSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ+++MKM   P+  GF+WQ+YN+ET +Y D +FT  GLLEQIN TRDA+DYLWY T
Sbjct  419   RIGAQTARMKMPRVPIHGGFSWQAYNDETATYSDTSFTTAGLLEQINITRDATDYLWYMT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ G +P L V SAGHAL VF+NGQL G+AYGSLE PK+TF + VN+RAG
Sbjct  479   DVKIDPSEDFLRSGNYPVLTVLSAGHALRVFINGQLAGTAYGSLETPKLTFKQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN GILGPV L GLNEG+RDL+WQKWSYKIGLKGEALS
Sbjct  539   INQIALLSIAVGLPNVGPHFETWNAGILGPVILNGLNEGRRDLSWQKWSYKIGLKGEALS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSVEW +GSFV Q+QPLTWYKTTFN P GN PLALDM +MGKGQVWIN +SIG
Sbjct  599   LHSLTGSSSVEWTEGSFVAQRQPLTWYKTTFNRPAGNSPLALDMGSMGKGQVWINDRSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG CG CNYAG F EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  659   RYWPAYKASGTCGECNYAGTFSEKKCLSNCGEASQRWYHVPRSWLNPTGN  708



>ref|XP_011463326.1| PREDICTED: beta-galactosidase 1 [Fragaria vesca subsp. vesca]
Length=843

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS SG ACAAFLAN+++ S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GTYQEAHVFKSNSG-ACAAFLANYNRKSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ+++MKM   P+  GF+WQ+YN+ET +Y D +FT  GLLEQINTTRDA+DYLWY T
Sbjct  419   RIGAQTARMKMPRVPIHGGFSWQAYNDETATYSDTSFTTAGLLEQINTTRDATDYLWYMT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ G +P L V SAGHAL VF+NGQL G+AYGSLE PK+TF + VN+RAG
Sbjct  479   DVKIDPSEDFLRSGNYPVLTVLSAGHALRVFINGQLAGTAYGSLETPKLTFKQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN GILGPV L GLNEG+RDL+WQKWSYKIGLKGEALS
Sbjct  539   INQIALLSIAVGLPNVGPHFETWNAGILGPVILNGLNEGRRDLSWQKWSYKIGLKGEALS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSV+W +GSFV Q+QPLTWYKTTFN P GN PLALDM +MGKGQVWING+SIG
Sbjct  599   LHSLTGSSSVDWTEGSFVAQRQPLTWYKTTFNRPAGNSPLALDMGSMGKGQVWINGRSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG CG CNYAG F EKKCL  CGEA+ RWYHVPRS+L P GN
Sbjct  659   RYWPAYKASGTCGECNYAGTFSEKKCLCNCGEASQRWYHVPRSWLNPAGN  708



>gb|KDO65277.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=815

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 306/350 (87%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL+GE L+
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  601   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  661   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  710



>gb|KHF99404.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=808

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/350 (77%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF  K+GG CAAFLAN++ +SYAKV+F NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  325   GNYEEAHVFNYKTGG-CAAFLANYNPNSYAKVAFRNMHYNLPPWSISILPDCKNTVYNTA  383

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ S+ KM PV    GF+W++ NEET S  D+TFT+VGLLEQINTTRDA+DYLWYTT
Sbjct  384   RVGAQISRKKMVPVPMHGGFSWEACNEETASDVDSTFTMVGLLEQINTTRDATDYLWYTT  443

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V IDPREGFLK GK P L +FSAGHALHVFVNGQL GS+YGSLE PK+TF++ VN+RAG
Sbjct  444   TVKIDPREGFLKNGKSPVLTIFSAGHALHVFVNGQLSGSSYGSLEFPKLTFNQGVNLRAG  503

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VN I+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  504   VNTISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  563

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDMN+MGKGQ+WINGQSIG
Sbjct  564   LHSLSGSSSVEWAKGSSVAQRQPLTWYKTTFNAPAGNAPLALDMNSMGKGQIWINGQSIG  623

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCG CNYAG F E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  624   RHWPAYKASGNCGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGN  673



>ref|XP_007024475.1| Beta galactosidase 1 [Theobroma cacao]
 gb|EOY27097.1| Beta galactosidase 1 [Theobroma cacao]
Length=843

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK +SGG CAAFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GNYQEAHVFKYQSGG-CAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV     F+WQ+Y+EET S  D++FT+VGLLEQINTT+DA+DYLWYTT
Sbjct  419   RVGAQIARKKMVPVPMHGAFSWQAYSEETASDVDSSFTMVGLLEQINTTKDATDYLWYTT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP EGFLK G  P L + SAGHALHVFVNGQL GSAYGSLE PK+TFS+ VN+RAG
Sbjct  479   DIKIDPSEGFLKNGNSPVLTILSAGHALHVFVNGQLSGSAYGSLEFPKLTFSQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGL+GEAL+
Sbjct  539   VNKISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLEGEALN  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW QGSFV ++QPL WYKTTFNAP GN PLALDM++MGKGQ+WINGQSIG
Sbjct  599   LHSLSGSSSVEWAQGSFVARRQPLMWYKTTFNAPAGNAPLALDMHSMGKGQIWINGQSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCG CNYAG +DEKKC   CGEA+  WYH+PRS+L PTGN
Sbjct  659   RHWPAYKASGNCGDCNYAGTYDEKKCRTNCGEASQGWYHIPRSWLNPTGN  708



>emb|CDO97918.1| unnamed protein product [Coffea canephora]
Length=835

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/348 (78%), Positives = 309/348 (89%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++  S+A+V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  354   GNYQEAHVFKSKSG-ACAAFLANYNSQSFARVAFGNMHYNLPPWSISILPDCKNTVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+QMKM PV +GF+W+SYNEET S  DN FTV GLLEQIN TRD SDYLWY+T+V
Sbjct  413   RVGAQSAQMKMNPVIKGFSWESYNEETASNEDNAFTVSGLLEQINVTRDNSDYLWYSTEV  472

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   EGFLKGGKWP L V SAGHALHVF+NGQL G+ YGSLENPK+TFS+ VN+RAGVN
Sbjct  473   RIYHTEGFLKGGKWPVLTVMSAGHALHVFINGQLSGTTYGSLENPKITFSQGVNLRAGVN  532

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN GILGPVSL GLNEG+RDLTWQKWSYK+GLKGEALSLH
Sbjct  533   KISLLSIAVGLPNVGPHFETWNAGILGPVSLYGLNEGRRDLTWQKWSYKVGLKGEALSLH  592

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW +GSFV ++QPLTWYKTTF+AP GNEPLALDM+ M KGQVWINGQSIGRY
Sbjct  593   SLSGSSAVEWGEGSFVAERQPLTWYKTTFSAPSGNEPLALDMSAMSKGQVWINGQSIGRY  652

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +PA KASGNCG C+YAG F+EKKCL  CGEA+ +WYHVPRS+L PTGN
Sbjct  653   YPAYKASGNCGACSYAGSFNEKKCLSNCGEASQKWYHVPRSWLYPTGN  700



>gb|KDO65274.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=845

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 306/350 (87%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL+GE L+
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  601   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  661   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  710



>ref|XP_006466038.1| PREDICTED: beta-galactosidase 1-like [Citrus sinensis]
Length=845

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 306/350 (87%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL+GE L+
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  601   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  661   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  710



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/350 (74%), Positives = 306/350 (87%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YK+GL+GE L+
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKVGLEGEKLN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  601   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  661   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  710



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/350 (78%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VFK+KSG ACAAFL NHD  S+AKVSF N+HYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GNNQEAYVFKTKSG-ACAAFLTNHDSKSFAKVSFANLHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQG--FAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+QMKM P   G  F+WQS+NEE  SY DN+FT  GLLEQINTTRD SDYLWY T
Sbjct  419   RVGAQSAQMKMIPAVYGIGFSWQSFNEEPASYNDNSFTTAGLLEQINTTRDMSDYLWYMT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFLK G +P L V SAGHALHVF+NGQL G+AYGSLE+P++TF++ VN+RAG
Sbjct  479   DVKIDPYEGFLKSGNYPVLTVLSAGHALHVFINGQLSGTAYGSLEDPRLTFNQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VN IALLSIAVGLPN+GP FETWN G+LGPVSL GLNEG RDL+WQKW+YKIGLKGEALS
Sbjct  539   VNTIALLSIAVGLPNVGPHFETWNAGVLGPVSLNGLNEGSRDLSWQKWTYKIGLKGEALS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW QGSFV QKQPLTWYKT FNAP GNEPLALDMNTMGKG VWING+SIG
Sbjct  599   LHSLSGSSSVEWAQGSFVAQKQPLTWYKTAFNAPVGNEPLALDMNTMGKGNVWINGKSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWP  KA+G+C  CNYAGWF EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  659   RYWPGYKATGSCSACNYAGWFYEKKCLSNCGEASQRWYHVPRSWLYPTGN  708



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 307/350 (88%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN ++A VFKSKSG ACAAFLAN++ +S+AKVSFGNMHYNLPPWS+SILPDC+NTV+NTA
Sbjct  362   GNYEQAHVFKSKSG-ACAAFLANYNPNSFAKVSFGNMHYNLPPWSISILPDCENTVYNTA  420

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQSS MKMT  P+  G +WQ+YNE+T SY + +FTV GLLEQINTTRDASDYLWY T
Sbjct  421   RVGAQSSTMKMTRVPIHGGLSWQAYNEQTASYEETSFTVSGLLEQINTTRDASDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L V SAGHALHVFVNGQL G++YGSLE PK+T SK VN+RAG
Sbjct  481   DVKIDPSEEFLRSGKYPVLTVSSAGHALHVFVNGQLAGTSYGSLEFPKLTLSKGVNLRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N IALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYK+GL+GEALS
Sbjct  541   INTIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKVGLRGEALS  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSV+W+QGS V +KQPLTW+KT+F+AP G  PLALDM +MGKGQ+WINGQS+G
Sbjct  601   LHSLTGSSSVDWIQGSLVARKQPLTWFKTSFDAPAGYAPLALDMGSMGKGQIWINGQSLG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KA G+CG C+YAG ++EKKCL  CG+A+ RWYHVP+S+L+PTGN
Sbjct  661   RYWPAYKAQGSCGGCDYAGTYNEKKCLSNCGDASQRWYHVPKSWLKPTGN  710



>gb|ABK96254.1| unknown [Populus trichocarpa x Populus deltoides]
Length=846

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  K+GG CAAFLAN+ Q S+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFNYKAGG-CAAFLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+YNEE ++ GD+TFT+VGLLEQINTTRD SDYLWY T
Sbjct  422   RVGAQSARMKMTPVPMHGGFSWQAYNEEPSASGDSTFTMVGLLEQINTTRDVSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK+P L V SAGHALHVF+NGQL G+AYGSL+ PK+TF++ V +RAG
Sbjct  482   DVHIDPSEGFLRSGKYPVLGVLSAGHALHVFINGQLSGTAYGSLDFPKLTFTQGVKLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGL GEAL 
Sbjct  542   VNKISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLHGEALG  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHS++GSSSVEW +GS V Q+QPL+WYKTTFNAP GN PLALDM +MGKGQ+WINGQ +G
Sbjct  602   LHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG C+Y G ++EKKC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  662   RHWPAYKASGTCGDCSYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGN  711



>ref|XP_006385360.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP63157.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=846

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  K+GG CAAFLAN+ Q S+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFNYKAGG-CAAFLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+YNEE ++ GD+TFT+VGLLEQINTTRD SDYLWY T
Sbjct  422   RVGAQSARMKMTPVPMHGGFSWQAYNEEPSASGDSTFTMVGLLEQINTTRDVSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK+P L V SAGHALHVF+NGQL G+AYGSL+ PK+TF++ V +RAG
Sbjct  482   DVHIDPSEGFLRSGKYPVLGVLSAGHALHVFINGQLSGTAYGSLDFPKLTFTQGVKLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGL GEAL 
Sbjct  542   VNKISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLHGEALG  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHS++GSSSVEW +GS V Q+QPL+WYKTTFNAP GN PLALDM +MGKGQ+WINGQ +G
Sbjct  602   LHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG C+Y G ++EKKC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  662   RHWPAYKASGTCGDCSYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGN  711



>ref|XP_002527409.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF34975.1| beta-galactosidase, putative [Ricinus communis]
Length=845

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/350 (78%), Positives = 309/350 (88%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++Q S+AKVSFGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  362   GNYQEAHVFKSKSG-ACAAFLANYNQRSFAKVSFGNMHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQS++MKM+P+    GF+WQ+Y+EE ++ GDNTF +VGLLEQINTTRD SDYLWY+T
Sbjct  421   RIGAQSARMKMSPIPMRGGFSWQAYSEEASTEGDNTFMMVGLLEQINTTRDVSDYLWYST  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ GK+P L V SAGHALHVFVNGQL G+AYGSLE+PK+TFS+ V MRAG
Sbjct  481   DVRIDSNEGFLRSGKYPVLTVLSAGHALHVFVNGQLSGTAYGSLESPKLTFSQGVKMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+I LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL GEALS
Sbjct  541   INRIYLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLHGEALS  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW QGSFV +KQPL WYKTTFNAP GN PLALDM +MGKGQVWINGQS+G
Sbjct  601   LHSLSGSSSVEWAQGSFVSRKQPLMWYKTTFNAPAGNSPLALDMGSMGKGQVWINGQSVG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASGNCGVCNYAG F+EKKCL  CGEA+ RWYHVPRS+L   GN
Sbjct  661   RYWPAYKASGNCGVCNYAGTFNEKKCLTNCGEASQRWYHVPRSWLNTAGN  710



>gb|KHG25378.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=843

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF  KSGG CAAFLAN+D  S+AKV+F +M+YNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GVHQEAHVFNYKSGG-CAAFLANYDPKSFAKVAFRDMNYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV    GF+WQ+Y+EET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  419   RVGAQIARKKMVPVPLHGGFSWQAYSEETASDADSSFTMVGLLEQINTTRDATDYLWYTT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP E F + GK P L + SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VNMRAG
Sbjct  479   DIEIDPDEEFFRNGKSPILTILSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  539   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQSIG
Sbjct  599   LHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPTGNAPLALDMRSMGKGQIWINGQSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNC VCNYAG +DE KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  659   RHWPAYKASGNCSVCNYAGTYDEYKCRTNCGEASQRWYHVPRSWLNPTGN  708



>ref|XP_011000791.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=846

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  K+GG CAAFLAN+ Q S+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFNYKAGG-CAAFLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+YNEE ++ GDNTFT+VGLLEQINTTRD SDYLWY T
Sbjct  422   RVGAQSARMKMTPVPMHGGFSWQAYNEEPSASGDNTFTMVGLLEQINTTRDVSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+P EGFL+ GK+P L+V SAGHALHVF+NGQL G+AYGSL+ PK+TF++ V +RAG
Sbjct  482   DVHINPSEGFLRSGKYPVLSVLSAGHALHVFINGQLSGTAYGSLDFPKLTFTQGVKLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGL GEAL 
Sbjct  542   VNKISLLSVAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLHGEALG  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHS++GSSSVEW +GS V Q+QPL+WYKTTFNAP GN PLALDM +MGKGQ+WINGQ +G
Sbjct  602   LHSISGSSSVEWAEGSLVAQRQPLSWYKTTFNAPAGNSPLALDMGSMGKGQMWINGQHVG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG C+Y G + EKKC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  662   RHWPAYKASGTCGDCSYIGTYSEKKCSTNCGEASQRWYHVPQSWLKPTGN  711



>ref|XP_010262131.1| PREDICTED: beta-galactosidase isoform X1 [Nelumbo nucifera]
Length=847

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/348 (77%), Positives = 303/348 (87%), Gaps = 2/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VFKS+SG ACAAFLAN+D  SYA V+FGNMHYNLPPWS+SILPDCKNTVFNTA
Sbjct  362   GNNQEAHVFKSRSG-ACAAFLANYDSRSYATVAFGNMHYNLPPWSISILPDCKNTVFNTA  420

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSSQMKMTPV +GF+WQSYNEET SY DN+FT VGLLEQIN TRDASDYLWY TDV
Sbjct  421   RVGAQSSQMKMTPVYRGFSWQSYNEETASYDDNSFTTVGLLEQINVTRDASDYLWYMTDV  480

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP E FL+ G++P L V SAGHALHVF+NGQL G+ YGSLENPK+TFS  V + AG+N
Sbjct  481   KIDPNEAFLRNGQYPVLTVLSAGHALHVFINGQLSGTVYGSLENPKLTFSDKVKLIAGIN  540

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGP++L GLNEG+RDL+WQKWSYKIGLKGE + + 
Sbjct  541   KISLLSIAVGLPNVGPHFETWNAGVLGPITLKGLNEGQRDLSWQKWSYKIGLKGETVGIQ  600

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVE  + S V QKQP+TWYKTTFNAP GNEPLALDM +MGKGQ+WING+SIGRY
Sbjct  601   SLSGSSSVE-WEVSSVAQKQPMTWYKTTFNAPGGNEPLALDMGSMGKGQIWINGESIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA G+CG CNYAG +DEKKC   CGEA+ RWYHVPRS+LRPTGN
Sbjct  660   WPAYKAYGSCGGCNYAGTYDEKKCRSNCGEASQRWYHVPRSWLRPTGN  707



>ref|XP_010262132.1| PREDICTED: beta-galactosidase isoform X2 [Nelumbo nucifera]
Length=842

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/348 (77%), Positives = 303/348 (87%), Gaps = 2/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VFKS+SG ACAAFLAN+D  SYA V+FGNMHYNLPPWS+SILPDCKNTVFNTA
Sbjct  362   GNNQEAHVFKSRSG-ACAAFLANYDSRSYATVAFGNMHYNLPPWSISILPDCKNTVFNTA  420

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSSQMKMTPV +GF+WQSYNEET SY DN+FT VGLLEQIN TRDASDYLWY TDV
Sbjct  421   RVGAQSSQMKMTPVYRGFSWQSYNEETASYDDNSFTTVGLLEQINVTRDASDYLWYMTDV  480

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              IDP E FL+ G++P L V SAGHALHVF+NGQL G+ YGSLENPK+TFS  V + AG+N
Sbjct  481   KIDPNEAFLRNGQYPVLTVLSAGHALHVFINGQLSGTVYGSLENPKLTFSDKVKLIAGIN  540

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+LLSIAVGLPN+GP FETWN G+LGP++L GLNEG+RDL+WQKWSYKIGLKGE + + 
Sbjct  541   KISLLSIAVGLPNVGPHFETWNAGVLGPITLKGLNEGQRDLSWQKWSYKIGLKGETVGIQ  600

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVE  + S V QKQP+TWYKTTFNAP GNEPLALDM +MGKGQ+WING+SIGRY
Sbjct  601   SLSGSSSVE-WEVSSVAQKQPMTWYKTTFNAPGGNEPLALDMGSMGKGQIWINGESIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA G+CG CNYAG +DEKKC   CGEA+ RWYHVPRS+LRPTGN
Sbjct  660   WPAYKAYGSCGGCNYAGTYDEKKCRSNCGEASQRWYHVPRSWLRPTGN  707



>ref|XP_010542431.1| PREDICTED: beta-galactosidase 1-like [Tarenaya hassleriana]
Length=847

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF SKSG ACAAFLAN++  SYA VSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GRYQEAHVFNSKSG-ACAAFLANYNTKSYATVSFGNNHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ S+MKM   PV+ G +WQ+YNE+ +SY + +F++VGLLEQINTTRDASDYLWY T
Sbjct  423   RVGAQISRMKMVQVPVNGGLSWQAYNEDPSSYDEESFSMVGLLEQINTTRDASDYLWYMT  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFLK GK+P L V SAGHALHVFVNGQL G+AYGSL+ PK+TFS+SVN+RAG
Sbjct  483   DVKIDANEGFLKTGKYPTLTVLSAGHALHVFVNGQLSGTAYGSLDFPKLTFSESVNLRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIA LSIAVGLPN+GP FE WN G+LGPVSL GLNEG+RDL+WQKW+YK+GLKGEALS
Sbjct  543   INKIAFLSIAVGLPNVGPHFERWNAGVLGPVSLNGLNEGRRDLSWQKWTYKVGLKGEALS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G++SVEW  G+FV QKQPLTW+KTTF+ P GN PLA+DM +MGKGQ+WINGQS+G
Sbjct  603   LHSLSGTTSVEWAAGAFVAQKQPLTWFKTTFSGPTGNSPLAIDMGSMGKGQIWINGQSLG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+C  C+YAG FDE KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  663   RYWPAYKASGSCSECSYAGSFDENKCLRNCGEASQRWYHVPRSWLKPSGN  712



>ref|XP_006426534.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39774.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=846

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/351 (74%), Positives = 306/351 (87%), Gaps = 5/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLV-GSAYGSLENPKVTFSKSVNMRA  531
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL  G+AYGSLE PK+TF++ VNMRA
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAAGTAYGSLEFPKLTFTEGVNMRA  540

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             G+NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YK+GL+GE L
Sbjct  541   GINKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKVGLEGEKL  600

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             +LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSI
Sbjct  601   NLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSI  660

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA KASG+CG C+Y G + EKKCL  CGEA+ RWYHVPRS+L+PTGN
Sbjct  661   GRHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRWYHVPRSWLKPTGN  711



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFL+N+  +++AKVS+GNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  361   GNYEEAHVFRSKSG-ACAAFLSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTA  419

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+YNEE   Y DN+FT+ GLLEQINTTRD SDYLWY T
Sbjct  420   RVGAQSARMKMTPVPIHGGFSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYIT  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+ +EGFL+ GK+P L V SAGHALHVFVNGQ  G+AYGSLE PK+TF++ V +RAG
Sbjct  480   DVYINSKEGFLRSGKYPTLTVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLSIAVGLPN+GP FE WN G+LGPV+L GL+EGKRDL+ QKWSYK+GLKGEAL+
Sbjct  540   SNRIALLSIAVGLPNVGPHFERWNAGVLGPVTLYGLDEGKRDLSRQKWSYKVGLKGEALN  599

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSVEW +GS V +KQPLTW+KTTF+AP GN PLALDMN+MGKGQ+WINGQSIG
Sbjct  600   LHSLTGSSSVEWAEGSLVARKQPLTWFKTTFSAPAGNTPLALDMNSMGKGQIWINGQSIG  659

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG CG CNYAG + EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  660   RYWPAYKASGTCGGCNYAGTYGEKKCLSNCGEASQRWYHVPRSWLNPTGN  709



>ref|XP_010534899.1| PREDICTED: beta-galactosidase 1 [Tarenaya hassleriana]
Length=847

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/350 (73%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKSKSG ACAAFLAN++  SYA VSFG  HYN+PPWS+SILPDC NTV+NTA
Sbjct  364   GRFQEAHVFKSKSG-ACAAFLANYNPRSYATVSFGKNHYNIPPWSISILPDCMNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +F++VGLLEQINTTRDASDYLWY T
Sbjct  423   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSAYDDESFSMVGLLEQINTTRDASDYLWYMT  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFLK GK+P L V SAGHALHVFVNGQL G+AYGSL+ PK++FSK+VN+RAG
Sbjct  483   DVKIDANEGFLKTGKYPTLTVLSAGHALHVFVNGQLSGTAYGSLDFPKLSFSKAVNLRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FE WN G+LGPVSL GLNEG+RDL+WQKW+YK+GLKGEALS
Sbjct  543   INRIALLSIAVGLPNVGPHFERWNAGVLGPVSLNGLNEGRRDLSWQKWTYKVGLKGEALS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G++SVEW  G+FV +KQPLTW+KTTF+AP GN PLALDM +MGKGQ+WINGQS+G
Sbjct  603   LHSLSGTTSVEWAAGAFVARKQPLTWFKTTFSAPAGNSPLALDMESMGKGQIWINGQSLG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+C  C+YAG F+E KCLR CGEA+ RWYHVP S+L+P GN
Sbjct  663   RYWPAYKASGSCSECSYAGSFNENKCLRNCGEASQRWYHVPHSWLKPNGN  712



>gb|KJB70255.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=690

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  207   GNYQEAHVFKYKAGG-CAAFLANYNPRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  265

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  266   RIGAQIARKKMVPVPMHGGLSWQAYNEETASVADSSFTMVGLLEQINTTRDATDYLWYTT  325

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  326   DVKIDPHEGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQRVNLRAG  385

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  386   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  445

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  446   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  505

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCGVC+YAG F+EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  506   RHWPAYKASGNCGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGN  555



>gb|KJB70253.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=788

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKYKAGG-CAAFLANYNPRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  422   RIGAQIARKKMVPVPMHGGLSWQAYNEETASVADSSFTMVGLLEQINTTRDATDYLWYTT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  482   DVKIDPHEGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQRVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  542   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  602   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCGVC+YAG F+EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  662   RHWPAYKASGNCGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGN  711



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/349 (74%), Positives = 299/349 (86%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF+S SG ACAAFLAN+D ++YAKV+F NMHY+LPPWS+SILPDCKNT+FNTA
Sbjct  371   GNYQEAHVFRSNSG-ACAAFLANYDSNAYAKVAFENMHYDLPPWSISILPDCKNTIFNTA  429

Query  181   RIGAQSSQMKMTPVS-QGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQSS MKMT VS +GF WQSY EET SY DN+FT+VGLLEQIN TRDASDYLWY TD
Sbjct  430   RIGAQSSLMKMTAVSSEGFPWQSYTEETASYDDNSFTMVGLLEQINLTRDASDYLWYMTD  489

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP E FLK G++P L V SAGHALHVF+NGQL G+ YGSLENPK+TFS +V + AG+
Sbjct  490   VQIDPNEEFLKSGQYPVLTVSSAGHALHVFINGQLSGTVYGSLENPKLTFSDNVKLIAGI  549

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSIAVGLPN+G  FETWN G+LGPV L GLNEG RDL+WQKWSYKIGL+GEAL L
Sbjct  550   NKISLLSIAVGLPNVGTHFETWNAGVLGPVVLKGLNEGTRDLSWQKWSYKIGLQGEALGL  609

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW +GS + ++QPL+WYK  F+AP GNEPLALDM++MGKGQ+WINGQSIGR
Sbjct  610   HTVSGSSSVEW-EGSSIAKQQPLSWYKAIFDAPTGNEPLALDMSSMGKGQIWINGQSIGR  668

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA KASG CG C+YAG +D+ KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  669   YWPAYKASGTCGNCSYAGEYDDSKCQSNCGEASQRWYHVPRSWLNPTGN  717



>gb|KDO65275.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=872

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/377 (69%), Positives = 306/377 (81%), Gaps = 31/377 (8%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYK---------  687
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YK         
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKVCLQSLKYG  600

Query  688   ------------------IGLKGEALSLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNA  813
                               IGL+GE L+LHSL+G SSVEW +GS V Q+QPLTWY+TTF+A
Sbjct  601   FLVSLTFWILIEVCLLNQIGLEGEKLNLHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSA  660

Query  814   PPGNEPLALDMNTMGKGQVWINGQSIGRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEA  993
             P GN PLALDM +MGKGQVW+NGQSIGR+WPA KASG+CG C+Y G + EKKCL  CGEA
Sbjct  661   PAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEA  720

Query  994   TXRWYHVPRSFLRPTGN  1044
             + RWYHVPRS+L+PTGN
Sbjct  721   SQRWYHVPRSWLKPTGN  737



>gb|ABV32545.1| beta-galactosidase protein 2 [Prunus persica]
Length=841

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKSKSG ACAAFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  358   GTYQEAHVFKSKSG-ACAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  416

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+QMKM   P+   F+WQ+YN+ET +Y D +FT  GLLEQINTTRD+SDYLWY T
Sbjct  417   RVGAQSAQMKMPRVPLHGAFSWQAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L + SAGHAL VF+NGQL G++YGSLE PK+TFS+ VN+RAG
Sbjct  477   DVKIDPNEEFLRSGKYPVLTILSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN G+LGPV L GLNEG+RDL+WQKWSYK+GLKGEALS
Sbjct  537   INQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V ++QPLTWYKTTFNAP GN PLALDM +MGKGQVWING+SIG
Sbjct  597   LHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG + EKKCL  CGEA+ RWYHVPR++L PTGN
Sbjct  657   RYWPAYKASGSCGACNYAGSYHEKKCLSNCGEASQRWYHVPRTWLNPTGN  706



>ref|XP_007217146.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
 gb|EMJ18345.1| hypothetical protein PRUPE_ppa001382mg [Prunus persica]
Length=841

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKSKSG ACAAFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  358   GTYQEAHVFKSKSG-ACAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  416

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+QMKM   P+   F+WQ+YN+ET +Y D +FT  GLLEQINTTRD+SDYLWY T
Sbjct  417   RVGAQSAQMKMPRVPLHGAFSWQAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L + SAGHAL VF+NGQL G++YGSLE PK+TFS+ VN+RAG
Sbjct  477   DVKIDPNEEFLRSGKYPVLTILSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN G+LGPV L GLNEG+RDL+WQKWSYK+GLKGEALS
Sbjct  537   INQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V ++QPLTWYKTTFNAP GN PLALDM +MGKGQVWING+SIG
Sbjct  597   LHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG + EKKCL  CGEA+ RWYHVPR++L PTGN
Sbjct  657   RYWPAYKASGSCGACNYAGTYHEKKCLSNCGEASQRWYHVPRTWLNPTGN  706



>gb|KJB56893.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=806

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/350 (77%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF  K+GG CAAFLAN++ +SYAKV+F NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  323   GNYEEAHVFNYKTGG-CAAFLANYNPNSYAKVAFRNMHYNLPPWSISILPDCKNTVYNTA  381

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ S+ KM PV    GF+WQ+ N+ET S  D+TFT+VGLLEQINTTRDA+DYLWYTT
Sbjct  382   RVGAQISRKKMVPVPMHGGFSWQACNDETASDVDSTFTMVGLLEQINTTRDATDYLWYTT  441

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             +V IDPREGFLK GK P L +FSAGHALHVFVNGQL GS+YGSLE PK+TF++ VN+RAG
Sbjct  442   NVKIDPREGFLKNGKSPVLTIFSAGHALHVFVNGQLSGSSYGSLEFPKLTFNQGVNLRAG  501

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VN I+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGLKGEALS
Sbjct  502   VNTISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALS  561

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDMN+MGKGQ+WINGQSIG
Sbjct  562   LHSLSGSSSVEWAKGSLVAQRQPLTWYKTTFNAPAGNAPLALDMNSMGKGQIWINGQSIG  621

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCG CNYAG F E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  622   RHWPAYKASGNCGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGN  671



>gb|KJB17253.1| hypothetical protein B456_003G0595002 [Gossypium raimondii]
Length=546

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/336 (74%), Positives = 287/336 (85%), Gaps = 3/336 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF  KSGG CAAFLAN+D  S+AKV+F +MHYNLPPWS+SILPDCKNTV+NTA
Sbjct  212   GVHQEAHVFNYKSGG-CAAFLANYDPKSFAKVAFRDMHYNLPPWSISILPDCKNTVYNTA  270

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ ++ KM PV    GF+WQ+YNEET S  D++FT+VGLLEQINTTRD++DYLWYTT
Sbjct  271   RVGAQIARKKMVPVPLHGGFSWQAYNEETASDADSSFTMVGLLEQINTTRDSTDYLWYTT  330

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ IDP E F + GK P L + SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VNMRAG
Sbjct  331   DIEIDPNEEFFRNGKSPILTILSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNMRAG  390

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  391   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  450

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQSIG
Sbjct  451   LHSLSGSSSVEWAEGSLVAQRQPLTWYKTTFNAPAGNAPLALDMRSMGKGQIWINGQSIG  510

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXR  1002
             R+WPA KASGNC VCNYAG +DE KC   C EA+ R
Sbjct  511   RHWPAYKASGNCSVCNYAGTYDENKCRTNCEEASQR  546



>gb|KJB56892.1| hypothetical protein B456_009G140800 [Gossypium raimondii]
Length=845

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/350 (77%), Positives = 305/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF  K+GG CAAFLAN++ +SYAKV+F NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  362   GNYEEAHVFNYKTGG-CAAFLANYNPNSYAKVAFRNMHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ S+ KM PV    GF+WQ+ N+ET S  D+TFT+VGLLEQINTTRDA+DYLWYTT
Sbjct  421   RVGAQISRKKMVPVPMHGGFSWQACNDETASDVDSTFTMVGLLEQINTTRDATDYLWYTT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             +V IDPREGFLK GK P L +FSAGHALHVFVNGQL GS+YGSLE PK+TF++ VN+RAG
Sbjct  481   NVKIDPREGFLKNGKSPVLTIFSAGHALHVFVNGQLSGSSYGSLEFPKLTFNQGVNLRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VN I+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGLKGEALS
Sbjct  541   VNTISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALS  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +GS V Q+QPLTWYKTTFNAP GN PLALDMN+MGKGQ+WINGQSIG
Sbjct  601   LHSLSGSSSVEWAKGSLVAQRQPLTWYKTTFNAPAGNAPLALDMNSMGKGQIWINGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCG CNYAG F E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  661   RHWPAYKASGNCGACNYAGTFRENKCGTNCGEASQRWYHVPRSWLNPTGN  710



>gb|KJB70254.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=784

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  301   GNYQEAHVFKYKAGG-CAAFLANYNPRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  359

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  360   RIGAQIARKKMVPVPMHGGLSWQAYNEETASVADSSFTMVGLLEQINTTRDATDYLWYTT  419

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  420   DVKIDPHEGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQRVNLRAG  479

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  480   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  539

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  540   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  599

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCGVC+YAG F+EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  600   RHWPAYKASGNCGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGN  649



>gb|KJB70252.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=841

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKYKAGG-CAAFLANYNPRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  422   RIGAQIARKKMVPVPMHGGLSWQAYNEETASVADSSFTMVGLLEQINTTRDATDYLWYTT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  482   DVKIDPHEGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQRVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  542   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  602   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCGVC+YAG F+EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  662   RHWPAYKASGNCGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGN  711



>gb|KJB70251.1| hypothetical protein B456_011G065300 [Gossypium raimondii]
Length=846

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKYKAGG-CAAFLANYNPRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+VGLLEQINTTRDA+DYLWYTT
Sbjct  422   RIGAQIARKKMVPVPMHGGLSWQAYNEETASVADSSFTMVGLLEQINTTRDATDYLWYTT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  482   DVKIDPHEGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQRVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  542   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  602   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCGVC+YAG F+EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  662   RHWPAYKASGNCGVCSYAGTFNEKKCGTNCGEASQRWYHVPRSWLNPTGN  711



>emb|CBI35944.3| unnamed protein product [Vitis vinifera]
Length=841

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/348 (76%), Positives = 300/348 (86%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF SKSG ACAAFLAN++  SYAKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GNYEEAHVFHSKSG-ACAAFLANYNPRSYAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTPVS  F WQSYNEET SY D++F  VGLLEQINTTRD SDYLWY+TDV
Sbjct  419   RLGAQSATMKMTPVSGRFGWQSYNEETASYDDSSFAAVGLLEQINTTRDVSDYLWYSTDV  478

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   EGFLK G++P L V SAGHALHVF+NG+L G+AYGSLENPK+TFS+ V +RAGVN
Sbjct  479   KIGYNEGFLKSGRYPVLTVLSAGHALHVFINGRLSGTAYGSLENPKLTFSQGVKLRAGVN  538

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              IALLSIAVGLPN+GP FETWN G+LGPVSL GLNEG+RDL+WQKWSYK+GLKGEALSLH
Sbjct  539   TIALLSIAVGLPNVGPHFETWNAGVLGPVSLNGLNEGRRDLSWQKWSYKVGLKGEALSLH  598

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS + + QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQ++GRY
Sbjct  599   SLSGSSSVEWVEGSLMARGQPLTWYKTTFNAPGGNTPLALDMGSMGKGQIWINGQNVGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA+G CG CNYAG + EKKCL  CGE + RWYHVP S+L PTGN
Sbjct  659   WPAYKATGGCGDCNYAGTYSEKKCLSNCGEPSQRWYHVPHSWLSPTGN  706



>ref|XP_010654522.1| PREDICTED: beta-galactosidase 1 [Vitis vinifera]
Length=850

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/348 (76%), Positives = 300/348 (86%), Gaps = 1/348 (0%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF SKSG ACAAFLAN++  SYAKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  369   GNYEEAHVFHSKSG-ACAAFLANYNPRSYAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  427

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQS+ MKMTPVS  F WQSYNEET SY D++F  VGLLEQINTTRD SDYLWY+TDV
Sbjct  428   RLGAQSATMKMTPVSGRFGWQSYNEETASYDDSSFAAVGLLEQINTTRDVSDYLWYSTDV  487

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   EGFLK G++P L V SAGHALHVF+NG+L G+AYGSLENPK+TFS+ V +RAGVN
Sbjct  488   KIGYNEGFLKSGRYPVLTVLSAGHALHVFINGRLSGTAYGSLENPKLTFSQGVKLRAGVN  547

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              IALLSIAVGLPN+GP FETWN G+LGPVSL GLNEG+RDL+WQKWSYK+GLKGEALSLH
Sbjct  548   TIALLSIAVGLPNVGPHFETWNAGVLGPVSLNGLNEGRRDLSWQKWSYKVGLKGEALSLH  607

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEWV+GS + + QPLTWYKTTFNAP GN PLALDM +MGKGQ+WINGQ++GRY
Sbjct  608   SLSGSSSVEWVEGSLMARGQPLTWYKTTFNAPGGNTPLALDMGSMGKGQIWINGQNVGRY  667

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA+G CG CNYAG + EKKCL  CGE + RWYHVP S+L PTGN
Sbjct  668   WPAYKATGGCGDCNYAGTYSEKKCLSNCGEPSQRWYHVPHSWLSPTGN  715



>gb|KDO65278.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=697

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/337 (74%), Positives = 293/337 (87%), Gaps = 4/337 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKS  ACAAFLAN++Q ++AKV+FGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVFKSKS--ACAAFLANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G QS+QMKMTPV    GF+WQ++NE  ++YGD++FT+ GLLEQINTTRDA+DYLWY T
Sbjct  421   RVGHQSTQMKMTPVPIHGGFSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ G +P L V SAGHALHVFVNGQL G+AYGSLE PK+TF++ VNMRAG
Sbjct  481   DVKIDPSEGFLRSGNYPVLTVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKW+YKIGL+GE L+
Sbjct  541   INKIALLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWTYKIGLEGEKLN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+G SSVEW +GS V Q+QPLTWY+TTF+AP GN PLALDM +MGKGQVW+NGQSIG
Sbjct  601   LHSLSGGSSVEWAEGSLVAQRQPLTWYRTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             R+WPA KASG+CG C+Y G + EKKCL  CGEA+ RW
Sbjct  661   RHWPAYKASGSCGYCSYTGTYTEKKCLSNCGEASQRW  697



>ref|XP_008228300.1| PREDICTED: beta-galactosidase 1 [Prunus mume]
Length=841

 Score =   535 bits (1377),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 260/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G   EA VFKSKSG ACAAFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  358   GTYGEAHVFKSKSG-ACAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  416

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKM   P+   F+WQ+YN+ET +Y D +FT  GLLEQINTTRD+SDYLWY T
Sbjct  417   RVGAQSARMKMPRVPLHGAFSWQAYNDETATYADTSFTTAGLLEQINTTRDSSDYLWYLT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L + SAGHAL VF+NGQL G++YGSLE PK+TFS+ VN+RAG
Sbjct  477   DVKIDPNEEFLRSGKYPVLTILSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN G+LGPV L GLNEG+RDL+WQKWSYK+GLKGEALS
Sbjct  537   INQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V ++QPLTWYKTTFNAP GN PLALDM +MGKGQVWING+SIG
Sbjct  597   LHSLSGSSSVEWIQGSLVTRRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG + EKKCL  CGEA+ RWYHVPR++L PTGN
Sbjct  657   RYWPAYKASGSCGACNYAGTYHEKKCLSNCGEASQRWYHVPRTWLNPTGN  706



>ref|XP_008391326.1| PREDICTED: beta-galactosidase 1 [Malus domestica]
Length=843

 Score =   534 bits (1375),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS SG AC+AFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GRFQEAHVFKSNSG-ACSAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+ MKM   P+  GF+WQSY +E  SY D TFT  GLLEQINTTRD+SDYLWY T
Sbjct  419   RVGAQSALMKMPRVPLHGGFSWQSYPDEAASYSDTTFTTAGLLEQINTTRDSSDYLWYIT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L V SAGHAL VF+NGQL G++YGSLE PK+TFS+ VN+RAG
Sbjct  479   DVNIDPNEEFLRSGKYPELTVLSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN G+LGPV L GLNEG+RDL+WQKWSYK+GLKGEALS
Sbjct  539   INQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS+V +KQPLTW+KTTFNAP GN PLALDM +MGKGQVWING+SIG
Sbjct  599   LHSLSGSSSVEWIQGSYVTRKQPLTWFKTTFNAPAGNSPLALDMGSMGKGQVWINGRSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA  ASGNCG CNYAG ++EKKCL  CG+A+ RWYHVPRS+L PTGN
Sbjct  659   RYWPAYTASGNCGACNYAGTYNEKKCLSNCGQASQRWYHVPRSWLNPTGN  708



>ref|XP_008447606.1| PREDICTED: beta-galactosidase 1 [Cucumis melo]
Length=844

 Score =   534 bits (1375),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFL+N++  SYA V+FGNMHYN+PPWS+SILPDCKNTVFNTA
Sbjct  361   GNYQEAHVFKSKSG-ACAAFLSNYNPRSYATVAFGNMHYNIPPWSISILPDCKNTVFNTA  419

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ++ MKM+PV     F+WQ+YNEE  SY +  FT VGLLEQINTTRDA+DYLWYTT
Sbjct  420   RVGAQTAIMKMSPVPMHGSFSWQAYNEEPASYNEKAFTTVGLLEQINTTRDATDYLWYTT  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ GK+P L V SAGHA+HVFVNGQL G+AYGSL+ PK+TFS+ VN+RAG
Sbjct  480   DVHIDANEGFLRSGKYPVLTVLSAGHAMHVFVNGQLAGTAYGSLDFPKLTFSREVNLRAG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIALLSIAVGLPN+GP FE WN GILGPV+L GL+EG+RDLTWQKW+YKIGL GEA+S
Sbjct  540   NNKIALLSIAVGLPNVGPHFEMWNAGILGPVNLNGLDEGRRDLTWQKWTYKIGLDGEAMS  599

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V QKQPLTW+KTTFNAP GN PLALDM +MGKGQ+W+NGQS+G
Sbjct  600   LHSLSGSSSVEWIQGSLVAQKQPLTWFKTTFNAPAGNSPLALDMGSMGKGQIWLNGQSLG  659

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA K++G+CG C+Y G ++EKKC   CGEA+ RWYHVPRS+L+PTGN
Sbjct  660   RYWPAYKSTGSCGSCDYTGTYNEKKCSSNCGEASQRWYHVPRSWLKPTGN  709



>ref|XP_009367552.1| PREDICTED: beta-galactosidase 1 [Pyrus x bretschneideri]
Length=843

 Score =   533 bits (1374),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS SG AC+AFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  360   GRFQEAHVFKSNSG-ACSAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  418

Query  181   RIGAQSSQMKM--TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+ MKM   P+  GF+WQSY +E  SYGD TFT  GLLEQINTTRD+SDYLWY T
Sbjct  419   RVGAQSALMKMPRVPLHGGFSWQSYPDEAASYGDTTFTTAGLLEQINTTRDSSDYLWYIT  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP E FL+ GK+P L V SAGHAL VF+NGQL G++YGSLE PK+TFS+ VN+RAG
Sbjct  479   DVNIDPNEEFLRSGKYPELTVLSAGHALRVFINGQLAGTSYGSLEFPKLTFSQGVNLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPN+GP FETWN G+LGPV L GLNEG+RDL+WQKWSYK+GLKGEALS
Sbjct  539   INQIALLSIAVGLPNVGPHFETWNAGVLGPVILNGLNEGRRDLSWQKWSYKVGLKGEALS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS+V +KQPLTW+KTTFN P GN PLALDM +MGKGQVWING+SIG
Sbjct  599   LHSLSGSSSVEWIQGSYVTRKQPLTWFKTTFNEPAGNSPLALDMISMGKGQVWINGRSIG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA  ASGNCG CNYAG ++EKKCL  CG+A+ RWYHVPRS+L PTGN
Sbjct  659   RYWPAYTASGNCGACNYAGTYNEKKCLSNCGQASQRWYHVPRSWLNPTGN  708



>ref|XP_006369293.1| beta-galactosidase 1 family protein [Populus trichocarpa]
 gb|ERP65862.1| beta-galactosidase 1 family protein [Populus trichocarpa]
Length=837

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 261/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  K+GG CAAFLAN+ Q S+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  354   GNYQEAHVFNYKAGG-CAAFLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  412

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+ +KMTPV    G +WQ+YNEE +S GDNTFT+VGLLEQINTTRD SDYLWY T
Sbjct  413   RVGAQSATIKMTPVPMHGGLSWQTYNEEPSSSGDNTFTMVGLLEQINTTRDVSDYLWYMT  472

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFLK GK+P L V SAGHALHVF+NGQL G+AYGSL+ PK+TFS+ V++RAG
Sbjct  473   DVHIDPSEGFLKSGKYPVLTVLSAGHALHVFINGQLSGTAYGSLDFPKLTFSQGVSLRAG  532

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+ DL+WQKWSYKIGL GEALS
Sbjct  533   VNKISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRMDLSWQKWSYKIGLHGEALS  592

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHS++GSSSVEW +GS V QKQPL+WYKTTFNAP GN PLALDM +MGKGQ+WINGQ +G
Sbjct  593   LHSISGSSSVEWAEGSLVAQKQPLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVG  652

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG C Y G ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  653   RHWPAYKASGTCGECTYIGTYNENKCSTNCGEASQRWYHVPQSWLKPTGN  702



>ref|XP_004146823.1| PREDICTED: beta-galactosidase 1 [Cucumis sativus]
Length=841

 Score =   533 bits (1373),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFL+N++  SYA V+FGNMHYN+PPWS+SILPDCKNTVFNTA
Sbjct  358   GNYQEAHVFKSKSG-ACAAFLSNYNPRSYATVAFGNMHYNIPPWSISILPDCKNTVFNTA  416

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ++ MKM+PV   + F+WQ+YNEE  SY +  FT VGLLEQINTTRDA+DYLWYTT
Sbjct  417   RVGAQTAIMKMSPVPMHESFSWQAYNEEPASYNEKAFTTVGLLEQINTTRDATDYLWYTT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ GK+P L V SAGHA+HVFVNGQL G+AYGSL+ PK+TFS+ VN+RAG
Sbjct  477   DVHIDANEGFLRSGKYPVLTVLSAGHAMHVFVNGQLAGTAYGSLDFPKLTFSRGVNLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIALLSIAVGLPN+GP FE WN GILGPV+L GL+EG+RDLTWQKW+YKIGL GEA+S
Sbjct  537   NNKIALLSIAVGLPNVGPHFEMWNAGILGPVNLNGLDEGRRDLTWQKWTYKIGLDGEAMS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V QKQPLTW+KTTFNAP GN PLALDM +MGKGQ+W+NGQS+G
Sbjct  597   LHSLSGSSSVEWIQGSLVAQKQPLTWFKTTFNAPAGNSPLALDMGSMGKGQIWLNGQSLG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA K++G+CG C+Y G ++EKKC   CGEA+ RWYHVPRS+L PTGN
Sbjct  657   RYWPAYKSTGSCGSCDYTGTYNEKKCSSNCGEASQRWYHVPRSWLNPTGN  706



>ref|XP_011010891.1| PREDICTED: beta-galactosidase 1-like [Populus euphratica]
Length=845

 Score =   531 bits (1367),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 261/350 (75%), Positives = 299/350 (85%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  K+GG CAAFLAN+ Q S+AKVSF NMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  362   GNYQEAHVFNYKAGG-CAAFLANYHQRSFAKVSFRNMHYNLPPWSISILPDCKNTVYNTA  420

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+ +KMTPV    G +WQ+Y EE +S GDNTFT+VGLLEQINTTRD SDYLWY T
Sbjct  421   RVGAQSATIKMTPVPMHGGLSWQTYTEEPSSSGDNTFTMVGLLEQINTTRDVSDYLWYMT  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFLK GK+P L V SAGHALHVF+NGQL G+AYGSL+ PK+TFS+ V +RAG
Sbjct  481   DVHIDHSEGFLKNGKYPVLTVLSAGHALHVFINGQLSGTAYGSLDFPKLTFSQGVRLRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLSIAVGLPN+GP FETWN GILGPV+L GLNEG+RDL+WQKWSYKIGL GEALS
Sbjct  541   VNKISLLSIAVGLPNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWSYKIGLHGEALS  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHS++GSSSVEW +GS V QKQPL+WYKTTFNAP GN PLALDM +MGKGQ+WINGQ +G
Sbjct  601   LHSISGSSSVEWAEGSLVAQKQPLSWYKTTFNAPAGNSPLALDMGSMGKGQIWINGQHVG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG C Y G ++EKKC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  661   RHWPAYKASGTCGECTYIGTYNEKKCSTNCGEASQRWYHVPQSWLKPTGN  710



>gb|ACP18875.1| beta-galactosidase pBG(a) [Carica papaya]
Length=836

 Score =   528 bits (1360),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 260/351 (74%), Positives = 305/351 (87%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKSK G  CAAFLAN++  S+AKV+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  351   GRFQEAHVFKSKYG-HCAAFLANYNPRSFAKVAFGNMHYNLPPWSISILPDCKNTVYNTA  409

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYT  351
             R+GAQS++MKM PV     F+WQ+YNEE  +S G+ +FT VGL+EQINTTRD SDYLWY+
Sbjct  410   RVGAQSARMKMVPVPIHGAFSWQAYNEEAPSSNGERSFTTVGLVEQINTTRDVSDYLWYS  469

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TDV IDP EGFLK GK+P L V SAGHALHVFVN QL G+AYGSLE PK+TFSK VN+RA
Sbjct  470   TDVKIDPDEGFLKTGKYPTLTVLSAGHALHVFVNDQLSGTAYGSLEFPKITFSKGVNLRA  529

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             G+NKI++LSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYK+G++GEA+
Sbjct  530   GINKISILSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKVGVEGEAM  589

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             SLHSL+GSSSVEW  GSFV ++QPLTW+KTTFNAP GN PLALDMN+MGKGQ+WING+SI
Sbjct  590   SLHSLSGSSSVEWTAGSFVARRQPLTWFKTTFNAPAGNSPLALDMNSMGKGQIWINGKSI  649

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA KASG+CG C+YAG F+EKKCL  CGEA+ RWYHVPRS+  PTGN
Sbjct  650   GRHWPAYKASGSCGWCDYAGTFNEKKCLSNCGEASQRWYHVPRSWPNPTGN  700



>gb|KEH18344.1| beta-galactosidase [Medicago truncatula]
Length=838

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 254/350 (73%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++  SYA VSFGN HYNLPPWS+SILP+CK+TV+NTA
Sbjct  355   GNYQEAHVFKSKSG-ACAAFLANYNPRSYATVSFGNQHYNLPPWSISILPNCKHTVYNTA  413

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKM+  P+  G +WQ++NEETT+  D++FTV GLLEQ+N TRD SDYLWY+T
Sbjct  414   RVGSQSAQMKMSRVPIHGGLSWQAFNEETTTTDDSSFTVTGLLEQVNATRDLSDYLWYST  473

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGF + GK P L V SAGHALHVF+NGQL G+AYGS++ PK+TFS+SV +RAG
Sbjct  474   DVVINSNEGFFRNGKNPVLTVLSAGHALHVFINGQLSGTAYGSVDFPKLTFSESVKLRAG  533

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPNIGP FETWN G+LGP+SL GLNEG+RDLTWQKWSYK+GLKGEALS
Sbjct  534   VNKISLLSVAVGLPNIGPHFETWNAGVLGPISLNGLNEGRRDLTWQKWSYKVGLKGEALS  593

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSV+W+QG  V +KQPLTWYKTTF+AP G  PLALDMN+MGKGQ+W+NGQ++G
Sbjct  594   LHSLTGSSSVDWLQGYLVSRKQPLTWYKTTFDAPAGVAPLALDMNSMGKGQMWLNGQNLG  653

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+C  CNYAG ++EKKC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  654   RYWPAYKASGSCDYCNYAGTYNEKKCGSNCGEASQRWYHVPKSWLKPTGN  703



>dbj|BAF02242.1| putative galactosidase [Arabidopsis thaliana]
Length=592

 Score =   518 bits (1335),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  109   GNYQEAHVYKSKSG-ACSAFLANYNPKSYAKVSFGNNHYNLPPWSISILPDCKNTVYNTA  167

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  168   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  227

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +D  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  228   DVKVDANEGFLRNGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  287

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  288   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  347

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  348   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  407

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  408   RHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGN  457



>gb|KHF98342.1| Beta-galactosidase 1 -like protein [Gossypium arboreum]
Length=846

 Score =   526 bits (1356),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/350 (75%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA +FK K+GG CAAFLAN++   YA VSF N HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHLFKYKAGG-CAAFLANYNSRDYATVSFRNNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             RIGAQ ++ KM PV    G +WQ+YNEET S  D++FT+ GLLEQINTTRDA+DYLWYTT
Sbjct  422   RIGAQIARKKMVPVPMHGGLSWQAYNEETASDADSSFTMAGLLEQINTTRDATDYLWYTT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             +V ID REGFL+ GK P L V SAGHALHVFVNGQL GS+YGSLE PK+TFS+ VN+RAG
Sbjct  482   EVKIDSREGFLRNGKSPVLTVLSAGHALHVFVNGQLSGSSYGSLEFPKLTFSQGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG+RDL+WQKWSYKIGLKGEAL+
Sbjct  542   INKISLLSIAVGLPNVGPHFETWNAGVLGPVTLNGLNEGRRDLSWQKWSYKIGLKGEALN  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L SL+GSSSVEW Q SFV Q+QPLTWYKTTFNAP GN PLALDM +MGKGQ+WING+SIG
Sbjct  602   LLSLSGSSSVEWAQRSFVSQRQPLTWYKTTFNAPAGNSPLALDMGSMGKGQIWINGKSIG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASGNCG+C+YAG F+EKKC   CG A+ RWYHVPRS+L PTGN
Sbjct  662   RHWPAYKASGNCGICSYAGTFNEKKCGTNCGGASQRWYHVPRSWLNPTGN  711



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =   521 bits (1341),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/337 (74%), Positives = 291/337 (86%), Gaps = 3/337 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFL+N+  +++AKVS+GNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  361   GNYEEAHVFRSKSG-ACAAFLSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTA  419

Query  181   RIGAQSSQMKMTPV--SQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+YNEE   Y DN+FT+ GLLEQINTTRD SDYLWY T
Sbjct  420   RVGAQSARMKMTPVPIHGGFSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYIT  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+ +EGFL+ GK+P L V SAGHALHVFVNGQ  G+AYGSLE PK+TF++ V +RAG
Sbjct  480   DVYINSKEGFLRSGKYPTLTVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLSIAVGLPN+GP FE WN G+LGPV+L GL+EGKRDL+ QKWSYK+GLKGEAL+
Sbjct  540   SNRIALLSIAVGLPNVGPHFERWNAGVLGPVTLYGLDEGKRDLSRQKWSYKVGLKGEALN  599

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSLTGSSSVEW +GS V +KQPLTW+KTTF+AP GN PLALDMN+MGKGQ+WINGQSIG
Sbjct  600   LHSLTGSSSVEWAEGSLVARKQPLTWFKTTFSAPAGNTPLALDMNSMGKGQIWINGQSIG  659

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             RYWPA KASG CG CNYAG + EKKCL  CGEA+ RW
Sbjct  660   RYWPAYKASGTCGGCNYAGTYGEKKCLSNCGEASQRW  696



>dbj|BAH20412.1| AT3G13750 [Arabidopsis thaliana]
Length=625

 Score =   518 bits (1335),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  142   GNYQEAHVYKSKSG-ACSAFLANYNPKSYAKVSFGNNHYNLPPWSISILPDCKNTVYNTA  200

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  201   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  260

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +D  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  261   DVKVDANEGFLRNGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  320

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  321   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  380

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  381   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  440

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  441   RHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGN  490



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   525 bits (1352),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 250/349 (72%), Positives = 293/349 (84%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+SQE+ VFKS+SG  CAAFLAN+D+ S+AKV+F  MHYNLPPWS+SILPDC NTVFNTA
Sbjct  369   GSSQESHVFKSESGD-CAAFLANYDEKSFAKVAFQGMHYNLPPWSISILPDCVNTVFNTA  427

Query  181   RIGAQSSQMKMTPVS-QGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQ+S M MT V+  GF+W++YNEET SY D + T+ GLLEQIN TRD +DYLWYTTD
Sbjct  428   RVGAQTSSMTMTSVNPDGFSWETYNEETASYDDASITMEGLLEQINVTRDVTDYLWYTTD  487

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TIDP EGFLK G++P L V SAGHALH+F+NG+L G+ YGS++NPK+T++ SV + AG 
Sbjct  488   ITIDPNEGFLKNGEYPVLTVMSAGHALHIFINGELSGTVYGSVDNPKLTYTGSVKLLAGN  547

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI++LSIAVGLPNIG  FETWNTG+LGPV L GLNEG+RDL+WQ WSYKIGLKGEAL L
Sbjct  548   NKISVLSIAVGLPNIGAHFETWNTGVLGPVVLNGLNEGRRDLSWQNWSYKIGLKGEALQL  607

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSLTGSSSVEW   S + QKQPLTWYKTTFNAP GN P ALDM+ MGKGQ+WINGQSIGR
Sbjct  608   HSLTGSSSVEW--SSLIAQKQPLTWYKTTFNAPEGNGPFALDMSMMGKGQIWINGQSIGR  665

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA KA GNCG C+Y G ++EKKCL  CGEA+ RWYHVP S+L PT N
Sbjct  666   YWPAYKAYGNCGECSYTGRYNEKKCLANCGEASQRWYHVPSSWLYPTAN  714



>gb|EPS65481.1| beta-galactosidase [Genlisea aurea]
Length=460

 Score =   511 bits (1316),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 283/344 (82%), Gaps = 2/344 (1%)
 Frame = +1

Query  13    EARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARIGA  192
             +ARV+KS    +CAAFLAN+D  SYA +SF N  YNLPPWS+SILP+CKN ++NTA +G+
Sbjct  2     QARVYKSSD--SCAAFLANYDTKSYATLSFWNSKYNLPPWSISILPNCKNVLYNTATVGS  59

Query  193   QSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDVTIDP  372
             Q+S+MKMT V  GF W+SY EET  +  N FTVVGL+EQIN TRD +DYLWY+T+V IDP
Sbjct  60    QTSKMKMTTVGSGFDWKSYYEETAFHHGNLFTVVGLVEQINMTRDKTDYLWYSTEVVIDP  119

Query  373   REGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNKIAL  552
              EGFL+  +WP L V SAGHALHVFVNG+L G+AYG LE P++TFS SVN+R GVN+I L
Sbjct  120   SEGFLRSEQWPVLTVLSAGHALHVFVNGELSGTAYGRLEEPRLTFSTSVNLRGGVNQIEL  179

Query  553   LSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLTG  732
             LSIAVGLPN+G  FETWN G+LGPV+L GLNEG+RDLTWQ W+Y+IGLKGE  SLH++ G
Sbjct  180   LSIAVGLPNVGTHFETWNAGVLGPVTLAGLNEGRRDLTWQNWTYQIGLKGEFSSLHTVNG  239

Query  733   SSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPAN  912
               SVEW+QGS+V Q+QPLTWYKT+F+ P G+EPLALDMN+M KGQ+WING+SIGRYW   
Sbjct  240   DDSVEWMQGSYVAQRQPLTWYKTSFDEPSGDEPLALDMNSMSKGQIWINGESIGRYWNQY  299

Query  913   KASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             KA G+C  C+YAGWFDEKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  300   KAGGDCSPCDYAGWFDEKKCLANCGEASQRWYHVPRSWLYPTGN  343



>gb|ADV41669.1| beta-D-galactosidase [Actinidia deliciosa var. deliciosa]
Length=728

 Score =   518 bits (1335),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 254/350 (73%), Positives = 291/350 (83%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + E  VFKSKS  +CAAFLAN+D  S AKV+F NM Y+LPPWS+SILPDCKN VFNTA
Sbjct  359   GKNLEVHVFKSKS--SCAAFLANYDPSSPAKVTFQNMQYDLPPWSISILPDCKNAVFNTA  416

Query  181   RIGAQSSQMKMTPVSQG-FAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTT  354
             R+ ++SSQMKMTPVS G F+WQSY EET S  D +T    GL EQI+ TRD SDYLWY T
Sbjct  417   RVSSKSSQMKMTPVSGGAFSWQSYIEETVSADDSDTIAKNGLWEQISITRDGSDYLWYLT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I P EGFLK G+ P L V SAGHALHVF+NGQL G+ YGSLENPK+TFS +V +RAG
Sbjct  477   DVNIHPNEGFLKNGQSPVLTVMSAGHALHVFINGQLAGTVYGSLENPKLTFSNNVKLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKI+LLS AVGLPN+G  FETWNTG+LGPV+L GLNEG RDLT QKWSYK+GLKGE LS
Sbjct  537   INKISLLSAAVGLPNVGLHFETWNTGVLGPVTLKGLNEGTRDLTKQKWSYKVGLKGEDLS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LH+L+GSSSVEWVQGS + QKQPLTWYK TFNAP GN+PLALDMNTMGKGQ+WING+SIG
Sbjct  597   LHTLSGSSSVEWVQGSLLAQKQPLTWYKATFNAPEGNDPLALDMNTMGKGQIWINGESIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WP  KASGNCG C+YAG + EKKCL  CGEA+ RWYHVPRS+L+P+GN
Sbjct  657   RHWPEYKASGNCGGCSYAGIYTEKKCLSNCGEASQRWYHVPRSWLKPSGN  706



>ref|XP_007135555.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
 gb|ESW07549.1| hypothetical protein PHAVU_010G139300g [Phaseolus vulgaris]
Length=844

 Score =   521 bits (1342),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFLAN++  SYA V+FGN HYNLPPWS+SILP+CK+TV+NTA
Sbjct  361   GNYEEAHVFRSKSG-ACAAFLANYNPQSYATVAFGNQHYNLPPWSISILPNCKHTVYNTA  419

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+ MKM+  P+  G +W+++NEETT+  D++FTV GLLEQIN TRD SDYLWY+T
Sbjct  420   RVGSQSTTMKMSRVPIHGGLSWKAFNEETTTTDDSSFTVSGLLEQINATRDLSDYLWYST  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+P E FL+ GK P+L V SAGHALHVF+N QL G+AYGSLE+PK+TFS+SV +RAG
Sbjct  480   DVVINPNEEFLRNGKNPFLTVLSAGHALHVFINNQLSGTAYGSLESPKLTFSESVRLRAG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FE WN G+LGP++L GLNEG+RDLTWQKWSYK+GLKGEAL+
Sbjct  540   VNKISLLSVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALN  599

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QG  V ++QPLTWYKTTF+AP G  PLALDM +MGKGQVWINGQS+G
Sbjct  600   LHSLSGSSSVEWLQGYLVSKRQPLTWYKTTFDAPVGVAPLALDMASMGKGQVWINGQSLG  659

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG ++EKKC   CGEA+ RWYHVP S+L+PTGN
Sbjct  660   RYWPAYKASGSCGYCNYAGTYNEKKCASNCGEASQRWYHVPHSWLKPTGN  709



>ref|XP_012068994.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 1-like [Jatropha 
curcas]
Length=841

 Score =   521 bits (1341),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 260/350 (74%), Positives = 300/350 (86%), Gaps = 9/350 (3%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++Q S+AKV+FGNMHYNLPPWSVSILPDCKNTV+NTA
Sbjct  364   GNYQEAHVFKSKSG-ACAAFLANYNQRSFAKVAFGNMHYNLPPWSVSILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMTPVSQ--GFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS++MKMTPV    GF+WQ+Y+EET++ GD+TFT+VGLLEQINTTRD +DYLWY+T
Sbjct  423   RLGAQSARMKMTPVPMHGGFSWQAYSEETSAEGDHTFTMVGLLEQINTTRDVTDYLWYST  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+P EGFLK GK+P L V SA HALH+FVNG+L G+AYGSLE+PK TFS+ V MRAG
Sbjct  483   DVHINPNEGFLKSGKYPVLTVLSAVHALHIFVNGELSGTAYGSLESPKXTFSQGVKMRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N   LL      PN+GP FETWN GILGPV+L GLNEG+RDL+WQKW+YKIGL GEALS
Sbjct  543   INTKFLL------PNVGPHFETWNAGILGPVTLNGLNEGRRDLSWQKWTYKIGLNGEALS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW QGSFV  +QPL WYKT FNA  GN PLALDM +MGKGQVWINGQS+G
Sbjct  597   LHSLSGSSSVEWTQGSFVSHRQPLMWYKTMFNALAGNTPLALDMGSMGKGQVWINGQSVG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA K+SG+CG CNYAG ++EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  657   RYWPAYKSSGDCGFCNYAGTYNEKKCLSNCGEASQRWYHVPRSWLNPTGN  706



>ref|XP_006300095.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
 gb|EOA32993.1| hypothetical protein CARUB_v10016323mg [Capsella rubella]
Length=846

 Score =   519 bits (1337),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 253/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVYKSKSG-ACSAFLANYNPRSYAKVSFGNNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  422   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NG L GSAYGSL++PK+TF K VN+RAG
Sbjct  482   DVKIDNNEGFLRNGDLPTLTVLSAGHAMHVFINGHLSGSAYGSLDSPKLTFRKGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  542   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  602   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+YAG F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  662   RHWPAYKAVGSCSECSYAGTFKEDKCLRNCGEASQRWYHVPRSWLKPSGN  711



>ref|XP_003531618.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
 gb|KHN11289.1| Beta-galactosidase 1 [Glycine soja]
Length=843

 Score =   518 bits (1335),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFLAN++  SYA V+FGN HYNLPPWS+SILP+CK+TV+NTA
Sbjct  360   GNYEEAHVFRSKSG-ACAAFLANYNPQSYATVAFGNQHYNLPPWSISILPNCKHTVYNTA  418

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+ MKMT  P+  G +W+++NEETT+  D++FTV GLLEQIN TRD SDYLWY+T
Sbjct  419   RVGSQSTTMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYST  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+ GK P L V SAGHALHVF+N QL G+AYGSLE PK+TFS+SV +RAG
Sbjct  479   DVVINSNEGFLRNGKNPVLTVLSAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FE WN G+LGP++L GLNEG+RDLTWQKWSYK+GLKGEAL+
Sbjct  539   VNKISLLSVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALN  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QG  V ++QPLTWYKTTF+AP G  PLALDM +MGKGQVWINGQS+G
Sbjct  599   LHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG ++EKKC   CGEA+ RWYHVP S+L+P+GN
Sbjct  659   RYWPAYKASGSCGYCNYAGTYNEKKCGSNCGEASQRWYHVPHSWLKPSGN  708



>ref|NP_187988.1| beta galactosidase 1 [Arabidopsis thaliana]
 sp|Q9SCW1.1|BGAL1_ARATH RecName: Full=Beta-galactosidase 1; Short=Lactase 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB64737.1| putative beta-galactosidase [Arabidopsis thaliana]
 dbj|BAB01923.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AEE75407.1| beta galactosidase 1 [Arabidopsis thaliana]
Length=847

 Score =   518 bits (1335),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEAHVYKSKSG-ACSAFLANYNPKSYAKVSFGNNHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  423   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +D  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  483   DVKVDANEGFLRNGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  543   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  603   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  663   RHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGN  712



>emb|CDY51738.1| BnaA01g37210D [Brassica napus]
Length=839

 Score =   518 bits (1334),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA  +KSKSG AC+AFLAN++Q SYAKV+FG  HYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GNYQEAHQYKSKSG-ACSAFLANYNQRSYAKVTFGKNHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ +SY D +FT+VGLLEQINTTRD SDYLWY T
Sbjct  415   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSSYVDESFTMVGLLEQINTTRDTSDYLWYMT  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+GG  P L + SAGHA+HVF+NGQL GSAYGSL++PK+TF + VN+RAG
Sbjct  475   DVKINSNEGFLRGGNLPTLTILSAGHAMHVFINGQLSGSAYGSLDSPKLTFRRGVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  535   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  595   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G C  C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  655   RHWPAYKAVGTCRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  704



>ref|XP_009146456.1| PREDICTED: beta-galactosidase 1 [Brassica rapa]
Length=839

 Score =   518 bits (1333),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GNYQEAHVYKSKSG-ACSAFLANYNPRSYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  415   RVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  475   DVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPV+L GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  535   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVNLNGLNGGRRDLSWQKWTYKVGLRGESLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL GSSSVEW +G++V QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  595   LHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+CG C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  655   RHWPAYKAVGSCGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  704



>ref|XP_009117469.1| PREDICTED: beta-galactosidase 1-like [Brassica rapa]
Length=839

 Score =   518 bits (1333),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA  +KSKSG AC+AFLAN++Q SYAKV+FG  HYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GNYQEAHQYKSKSG-ACSAFLANYNQRSYAKVTFGKNHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ +SY D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  415   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSSYVDESFTMVGLVEQINTTRDTSDYLWYMT  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+GG  P L + SAGHA+HVF+NGQL GSAYGSL++PK+TF + VN+RAG
Sbjct  475   DVKINSNEGFLRGGNLPTLTILSAGHAMHVFINGQLTGSAYGSLDSPKLTFRRGVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  535   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  595   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G C  C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  655   RHWPAYKAVGTCRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  704



>emb|CDY37486.1| BnaC01g37460D [Brassica napus]
Length=839

 Score =   518 bits (1333),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA  +KSKSG AC+AFLAN++Q SYAKVSFG  HYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GNYQEAHQYKSKSG-ACSAFLANYNQRSYAKVSFGKNHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ +SY D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  415   RVGAQTSRMKMVRVPVHAGLSWQAYNEDPSSYVDESFTMVGLVEQINTTRDTSDYLWYMT  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+GG  P L V SAGHA+HVF+NG L GSAYGSL++PK+TF + VN+RAG
Sbjct  475   DVKINSNEGFLRGGNLPTLTVLSAGHAMHVFINGHLTGSAYGSLDSPKLTFRRGVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  535   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  595   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G C  C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  655   RHWPAYKAVGTCRECSYIGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  704



>gb|AAM13196.1| galactosidase, putative [Arabidopsis thaliana]
Length=847

 Score =   518 bits (1333),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFGN HYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEAHVYKSKSG-ACSAFLANYNPKSYAKVSFGNNHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  423   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +D  EGFL+ G  P L V SAGHA+H+F+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  483   DVKVDANEGFLRNGDLPTLTVLSAGHAMHLFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  543   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  603   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  663   RHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGN  712



>emb|CDX97513.1| BnaA05g25660D [Brassica napus]
Length=840

 Score =   517 bits (1332),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  357   GNYQEAHVYKSKSG-ACSAFLANYNPRSYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  415

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  416   RVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  475

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  476   DVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  535

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPV+L GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  536   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVNLNGLNGGRRDLSWQKWTYKVGLRGESLS  595

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL GSSSVEW +G++V QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  596   LHSLGGSSSVEWAEGAYVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  655

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+CG C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  656   RHWPAYKAVGSCGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  705



>ref|XP_010465236.1| PREDICTED: beta-galactosidase 1 [Camelina sativa]
Length=846

 Score =   516 bits (1330),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+K+KSG AC+AFLAN++  +YAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVYKAKSG-ACSAFLANYNPKAYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  422   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF + VN+RAG
Sbjct  482   DVKIDNNEGFLRNGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRRGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  542   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  602   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+YAG F+E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  662   RHWPAYKAVGSCSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGN  711



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   516 bits (1329),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 248/349 (71%), Positives = 291/349 (83%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFK+KSG ACAAFLAN+D     KV+FGN+ Y+LP WS+SILPDCK  VFNTA
Sbjct  368   GSNQEAHVFKAKSG-ACAAFLANYDTKYSVKVTFGNVQYDLPAWSISILPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             R+GAQSSQ KM PV+  F+WQSYNEE+ S  D   TV  GLLEQI  TRDASDYLWY TD
Sbjct  427   RLGAQSSQKKMVPVNSAFSWQSYNEESPSADDQDATVKDGLLEQIYVTRDASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP EGFL  G+ P L ++SAGHALHVF+NGQL G+AYG L+NPK+TFSK+V +RAG+
Sbjct  487   VQIDPNEGFLTSGQDPSLTIWSAGHALHVFINGQLSGTAYGELDNPKLTFSKNVKLRAGI  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSIAVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEALSL
Sbjct  547   NKISLLSIAVGLPNVGVHFETWNAGVLGPVTLKGLNEGSRDLSKQKWSYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+GS +V+KQP+TWYKTTFNAP GNEPLALDM++MGKGQ+WINGQSIGR
Sbjct  607   HTVTGSSSVEWVKGSLLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKGQIWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G CG C+YAG + +KKC   CGE + RWYHVPRS+L P+GN
Sbjct  667   HWPGYIARGACGACDYAGTYSDKKCRTNCGEPSQRWYHVPRSWLNPSGN  715



>ref|XP_003546676.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=840

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 306/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++  SYA V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  359   GNYQEAHVFKSKSG-ACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTA  417

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  GF+W S+NEETT+  D++FT+ GLLEQ+NTTRD SDYLWY+T
Sbjct  418   RVGSQSAQMKMTRVPIHGGFSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYST  477

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +DP EGFL+ GK P L VFSAGHALHVF+NGQL G+AYGSLE PK+TF++ V +RAG
Sbjct  478   DVVLDPNEGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAG  537

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP+SL GLNEG+RDL+WQKWSYK+GLKGE LS
Sbjct  538   VNKISLLSVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGEILS  597

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V Q+QPLTWYKTTF+AP G  PLALDM++MGKGQVW+NGQ++G
Sbjct  598   LHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLG  657

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  658   RYWPAYKASGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGN  707



>ref|XP_006407174.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
 gb|ESQ48627.1| hypothetical protein EUTSA_v10020056mg [Eutrema salsugineum]
Length=846

 Score =   516 bits (1329),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFLAN++  SYAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVYKSKSG-ACSAFLANYNPRSYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+Q+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  422   RVGSQTSRMKMVRVPVHGGLSWQAYNEDPSTYVDESFTMVGLVEQINTTRDTSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+ ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  482   DLKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  542   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLRGESLS  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GS+SVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  602   LHSLSGSTSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  662   RHWPAYKAVGSCSECSYKGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  711



>gb|KHN32687.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   515 bits (1327),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 257/350 (73%), Positives = 306/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++  SYA V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  350   GNYQEAHVFKSKSG-ACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTA  408

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  GF+W S+NEETT+  D++FT+ GLLEQ+NTTRD SDYLWY+T
Sbjct  409   RVGSQSAQMKMTRVPIHGGFSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYST  468

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +DP EGFL+ GK P L VFSAGHALHVF+NGQL G+AYGSLE PK+TF++ V +RAG
Sbjct  469   DVVLDPNEGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRAG  528

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP+SL GLNEG+RDL+WQKWSYK+GLKGE LS
Sbjct  529   VNKISLLSVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGEILS  588

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V Q+QPLTWYKTTF+AP G  PLALDM++MGKGQVW+NGQ++G
Sbjct  589   LHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLG  648

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  649   RYWPAYKASGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGN  698



>emb|CDY23637.1| BnaC05g39570D [Brassica napus]
Length=839

 Score =   515 bits (1326),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+KSKSG AC+AFL+N++  SYAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GNYQEAHVYKSKSG-ACSAFLSNYNPRSYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  415   RVGAQTSRMKMVEVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  475   DVKIDSNEGFLRTGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPV+L GLN G+RDL+WQKW+YK+GL+GE+LS
Sbjct  535   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVNLNGLNGGRRDLSWQKWTYKVGLRGESLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL GSSSVEW +G++V +KQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  595   LHSLGGSSSVEWAEGAYVAEKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSVG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+CG C+Y G F+E KCLR CGEA+ RWYHVPRS+L+PTGN
Sbjct  655   RHWPAYKAVGSCGECSYTGTFNENKCLRNCGEASQRWYHVPRSWLKPTGN  704



>ref|XP_003529875.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=845

 Score =   515 bits (1326),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFLAN++  SYA V+FGN  YNLPPWS+SILP+CK+TV+NTA
Sbjct  362   GNYEEAHVFRSKSG-ACAAFLANYNPQSYATVAFGNQRYNLPPWSISILPNCKHTVYNTA  420

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+ MKMT  P+  G +W+++NEETT+  D++FTV GLLEQIN TRD SDYLWY+T
Sbjct  421   RVGSQSTTMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYST  480

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+ GK P L V SAGHALHVF+N QL G+AYGSLE PK+TFS+SV +RAG
Sbjct  481   DVVINSNEGFLRNGKNPVLTVLSAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAG  540

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FE WN G+LGP++L GLNEG+RDLTWQKWSYK+GLKGEAL+
Sbjct  541   VNKISLLSVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALN  600

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QG  V ++QPLTWYKTTF+AP G  PLALDM +MGKGQVWINGQS+G
Sbjct  601   LHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLG  660

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG ++EKKC   CG+A+ RWYHVP S+L+PTGN
Sbjct  661   RYWPAYKASGSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGN  710



>gb|KHN39301.1| Beta-galactosidase 1 [Glycine soja]
Length=838

 Score =   515 bits (1326),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 300/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN +EA VF+SKSG ACAAFLAN++  SYA V+FGN  YNLPPWS+SILP+CK+TV+NTA
Sbjct  355   GNYEEAHVFRSKSG-ACAAFLANYNPQSYATVAFGNQRYNLPPWSISILPNCKHTVYNTA  413

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+ MKMT  P+  G +W+++NEETT+  D++FTV GLLEQIN TRD SDYLWY+T
Sbjct  414   RVGSQSTTMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYST  473

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+  EGFL+ GK P L V SAGHALHVF+N QL G+AYGSLE PK+TFS+SV +RAG
Sbjct  474   DVVINSNEGFLRNGKNPVLTVLSAGHALHVFINNQLSGTAYGSLEAPKLTFSESVRLRAG  533

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FE WN G+LGP++L GLNEG+RDLTWQKWSYK+GLKGEAL+
Sbjct  534   VNKISLLSVAVGLPNVGPHFERWNAGVLGPITLSGLNEGRRDLTWQKWSYKVGLKGEALN  593

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QG  V ++QPLTWYKTTF+AP G  PLALDM +MGKGQVWINGQS+G
Sbjct  594   LHSLSGSSSVEWLQGFLVSRRQPLTWYKTTFDAPAGVAPLALDMGSMGKGQVWINGQSLG  653

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG+CG CNYAG ++EKKC   CG+A+ RWYHVP S+L+PTGN
Sbjct  654   RYWPAYKASGSCGYCNYAGTYNEKKCGSNCGQASQRWYHVPHSWLKPTGN  703



>ref|XP_010487145.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   515 bits (1326),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+K+KSG AC+AFLAN++  +YAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVYKAKSG-ACSAFLANYNPKAYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  422   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NG L GSAYGSL++PK+TF + VN+RAG
Sbjct  482   DVKIDNNEGFLRNGDLPTLTVLSAGHAMHVFINGHLSGSAYGSLDSPKLTFRRGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  542   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  602   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+YAG F+E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  662   RHWPAYKAVGSCSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGN  711



>ref|XP_010501131.1| PREDICTED: beta-galactosidase 1-like [Camelina sativa]
Length=846

 Score =   514 bits (1325),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+K+KSG AC+AFLAN++  +YAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  363   GNYQEAHVYKAKSG-ACSAFLANYNPKAYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  421

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  422   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  481

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NG L GSAYGSL++PK+TF + VN+RAG
Sbjct  482   DVKIDNNEGFLRNGDLPTLTVLSAGHAMHVFINGHLSGSAYGSLDSPKLTFRRGVNLRAG  541

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GLN G+RDL+WQKW+YK+GLKGE+LS
Sbjct  542   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLNGGRRDLSWQKWTYKVGLKGESLS  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  602   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+YAG F+E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  662   RHWPAYKAVGSCSECSYAGTFNEDKCLRNCGEASQRWYHVPRSWLKPSGN  711



>ref|XP_002882842.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59101.1| hypothetical protein ARALYDRAFT_897617 [Arabidopsis lyrata subsp. 
lyrata]
Length=847

 Score =   514 bits (1325),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 301/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V+K+KSG AC+AFLAN++  SYAKVSFG+ HYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEAHVYKAKSG-ACSAFLANYNPKSYAKVSFGSNHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQ+S+MKM   PV  G +WQ+YNE+ ++Y D +FT+VGL+EQINTTRD SDYLWY T
Sbjct  423   RVGAQTSRMKMVRVPVHGGLSWQAYNEDPSTYIDESFTMVGLVEQINTTRDTSDYLWYMT  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL+ G  P L V SAGHA+HVF+NGQL GSAYGSL++PK+TF K VN+RAG
Sbjct  483   DVKIDANEGFLRNGDLPTLTVLSAGHAMHVFINGQLSGSAYGSLDSPKLTFRKGVNLRAG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LSIAVGLPN+GP FETWN G+LGPVSL GL+ G+RDL+WQKW+YK+GLKGE+LS
Sbjct  543   FNKIAILSIAVGLPNVGPHFETWNAGVLGPVSLNGLSGGRRDLSWQKWTYKVGLKGESLS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW +G+FV QKQPLTWYKTTF+AP G+ PLA+DM +MGKGQ+WINGQS+G
Sbjct  603   LHSLSGSSSVEWAEGAFVAQKQPLTWYKTTFSAPAGDSPLAVDMGSMGKGQIWINGQSLG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA G+C  C+Y G F E KCLR CGEA+ RWYHVPRS+L+P+GN
Sbjct  663   RHWPAYKAVGSCSECSYTGTFREDKCLRNCGEASQRWYHVPRSWLKPSGN  712



>gb|KHN30042.1| Beta-galactosidase 1 [Glycine soja]
Length=831

 Score =   513 bits (1320),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 255/350 (73%), Positives = 303/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKS SG ACAAFLAN++  SYA V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  350   GNYQEAHVFKSMSG-ACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTA  408

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +W S+NEETT+  D++FT+ GLLEQ+NTTRD SDYLWY+T
Sbjct  409   RVGSQSAQMKMTRVPIHGGLSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYST  468

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +DP EGFL+ GK P L VFSAGHALHVF+NGQL G+AYGSLE PK+TF++ V +R G
Sbjct  469   DVVLDPNEGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTG  528

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP+SL GLNEG+RDL+WQKWSYK+GLKGE LS
Sbjct  529   VNKISLLSVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLS  588

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V Q+QPLTWYKTTF+AP G  PLALDMN+MGKGQVW+NGQ++G
Sbjct  589   LHSLSGSSSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKGQVWLNGQNLG  648

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  649   RYWPAYKASGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGN  698



>ref|XP_012076927.1| PREDICTED: beta-galactosidase-like [Jatropha curcas]
 gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   511 bits (1315),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 242/349 (69%), Positives = 291/349 (83%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF+SKS  ACAAFLAN+D     KV+FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  358   GDNQEAHVFQSKS--ACAAFLANYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQS+QMKMTPV  GF+WQSY EE  S Y D+T T+ GL EQIN TRDA+DYLWY T+
Sbjct  416   RLGAQSTQMKMTPVGSGFSWQSYIEEAASGYTDDTTTLDGLWEQINVTRDATDYLWYMTN  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP EGFLK G+ P L + SAGH+LHVF+N QL G+ YGSL+NPKVTFSK+V + +G+
Sbjct  476   VKIDPDEGFLKNGQDPLLTILSAGHSLHVFINDQLAGTVYGSLDNPKVTFSKNVKLTSGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FE WN+G+LGPV+L GLNEG +DL+  KWSYKIGLKGEAL+L
Sbjct  536   NKISLLSVAVGLPNVGVHFERWNSGVLGPVTLKGLNEGTKDLSGWKWSYKIGLKGEALNL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEW +GS +  KQPLTWYKTTF+AP GN+PLALDM++MGKGQ+W+NGQSIGR
Sbjct  596   HTVTGSSSVEWAEGSLLATKQPLTWYKTTFDAPEGNDPLALDMSSMGKGQIWVNGQSIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG CNYAG FD+KKC R CGE + RWYHVPRS+L P+GN
Sbjct  656   HWPAYTARGSCGDCNYAGTFDDKKCRRNCGEPSQRWYHVPRSWLNPSGN  704



>ref|XP_003543598.1| PREDICTED: beta-galactosidase 1-like [Glycine max]
Length=841

 Score =   511 bits (1315),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 254/350 (73%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKS SG ACAAFLAN++  SYA V+FGNMHYNLPPWS+SILP+CKNTV+NTA
Sbjct  360   GNYQEAHVFKSMSG-ACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPNCKNTVYNTA  418

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +W S+NEETT+  D++FT+ GLLEQ+NTTRD SDYLWY+T
Sbjct  419   RVGSQSAQMKMTRVPIHGGLSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYST  478

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +DP EGFL+ GK P L VFSAGHALHVF+NGQL G+AYGSLE PK+TF++ V +R G
Sbjct  479   DVVLDPNEGFLRNGKDPVLTVFSAGHALHVFINGQLSGTAYGSLEFPKLTFNEGVKLRTG  538

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP+SL GLNEG+RDL+WQKWSYK+GLKGE LS
Sbjct  539   VNKISLLSVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLS  598

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL GSSSVEW+QGS V Q+QPLTWYKTTF+AP G  PLALDMN+MGKGQVW+NGQ++G
Sbjct  599   LHSLGGSSSVEWIQGSLVSQRQPLTWYKTTFDAPDGTAPLALDMNSMGKGQVWLNGQNLG  658

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  659   RYWPAYKASGTCDYCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGN  708



>emb|CAJ09952.1| beta-galactosidase [Mangifera indica]
Length=362

 Score =   493 bits (1270),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QE  VF  KSG +CAAFLAN+D  S AKV+F NM Y LPPWS+SILPDCK  VFNTA
Sbjct  6     GNNQEVHVFNPKSG-SCAAFLANYDTTSSAKVNFQNMQYELPPWSISILPDCKTAVFNTA  64

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS  +MTPVS  F+WQSY EE+ S  D+ TFT  GL EQ+N TRDASDYLWY T+
Sbjct  65    RLGAQSSLKQMTPVST-FSWQSYIEESASSSDDKTFTTDGLWEQLNVTRDASDYLWYMTN  123

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + ID  EGFLK G+ P L ++SAGHALHVF+NGQL G+ YG ++NPK+TFS++V MR GV
Sbjct  124   INIDSNEGFLKNGQDPLLTIWSAGHALHVFINGQLSGTVYGGVDNPKLTFSQNVKMRVGV  183

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+++LLSI+VGL N+G  FE WNTG+LGPV+L GLNEG RDL+ Q+WSYKIGLKGE LSL
Sbjct  184   NQLSLLSISVGLQNVGTHFEQWNTGVLGPVTLRGLNEGTRDLSKQQWSYKIGLKGEDLSL  243

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEWV+GS + QKQPLTWYKTTFNAP GNEPLALDM+TMGKG +WIN QSIGR
Sbjct  244   HTVSGSSSVEWVEGSSLAQKQPLTWYKTTFNAPAGNEPLALDMSTMGKGLIWINSQSIGR  303

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG + +KKC   CG+ + RWYHVPRS+L PTGN
Sbjct  304   HWPGYIAHGSCGECNYAGTYTDKKCHTNCGQPSQRWYHVPRSWLNPTGN  352



>ref|XP_011659980.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=725

 Score =   503 bits (1296),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 240/349 (69%), Positives = 293/349 (84%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFK++SG +CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK+ +FNTA
Sbjct  356   GSNQEAHVFKTRSG-SCAAFLANYDASSSATVTFGNNQYDLPPWSVSILPDCKSVIFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++GA +SQ KMTPVS  F+W SYNEET S Y ++T T+ GL+EQI+ TRD++DYLWY TD
Sbjct  415   KVGAPTSQPKMTPVSS-FSWLSYNEETASAYTEDTTTMAGLVEQISVTRDSTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + IDP EGFLK G+WP L VFSAGHALHVF+NGQL G+ YG  EN K+TFSK VN+RAG+
Sbjct  474   IRIDPNEGFLKSGQWPLLTVFSAGHALHVFINGQLSGTTYGGSENYKLTFSKYVNLRAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN G  +ETWNTG+LGPV+L GLNE  RD++  KWSYKIGLKGEAL+L
Sbjct  534   NKLSILSVAVGLPNGGLHYETWNTGVLGPVTLKGLNEDTRDMSGYKWSYKIGLKGEALNL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HS++GSSSVEWV GS V QKQPLTWYKTTF++P GNEPLALDM++MGKGQ+WINGQSIGR
Sbjct  594   HSVSGSSSVEWVTGSLVAQKQPLTWYKTTFDSPKGNEPLALDMSSMGKGQIWINGQSIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG CNY G F+EKKC   CGE + RWYHVPR++L+ +GN
Sbjct  654   HWPAYTAKGSCGKCNYGGIFNEKKCHSNCGEPSQRWYHVPRAWLKSSGN  702



>ref|XP_008450853.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=721

 Score =   503 bits (1295),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 240/349 (69%), Positives = 292/349 (84%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFK++SG +CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK+ VFNTA
Sbjct  352   GSNQEAHVFKTRSG-SCAAFLANYDASSSATVTFGNNQYDLPPWSVSILPDCKSAVFNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++GA +SQ KMTPVS  F+W SYNEET S Y ++T T+ GL+EQI+ TRD++DYLWY TD
Sbjct  411   KVGAPTSQPKMTPVSS-FSWLSYNEETASAYTEDTTTMAGLVEQISVTRDSTDYLWYMTD  469

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + IDP EGFLK G+WP L VFSAGHALHVF+NGQL G+ YG  EN K+TFSK VN+RAG+
Sbjct  470   IRIDPNEGFLKSGQWPLLTVFSAGHALHVFINGQLSGTTYGGAENYKLTFSKYVNLRAGI  529

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN G  +ETWNTGILGPV+L GLNE  RD++  KWSYKIGLKGEAL+L
Sbjct  530   NKLSILSVAVGLPNGGLHYETWNTGILGPVTLKGLNEDTRDMSGYKWSYKIGLKGEALNL  589

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEWV GS V QKQPLTWYKTTF++P GNEPLALDM++MGKGQ+WINGQSIGR
Sbjct  590   HTASGSSSVEWVAGSLVAQKQPLTWYKTTFDSPEGNEPLALDMSSMGKGQIWINGQSIGR  649

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG CNY G F+EKKC   CGE + RWYH+PR++L+ +GN
Sbjct  650   HWPAYTARGSCGKCNYGGIFNEKKCHSNCGEPSQRWYHIPRAWLKSSGN  698



>ref|XP_004486826.1| PREDICTED: beta-galactosidase 1-like [Cicer arietinum]
Length=847

 Score =   505 bits (1301),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 249/350 (71%), Positives = 294/350 (84%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++  SYA V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  364   GNYQEAHVFKSKSG-ACAAFLANYNPKSYATVAFGNMHYNLPPWSISILPDCKNTVYNTA  422

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +WQ + E+T S  D++FT+ GLLEQ+NTTRD +DYLWY+T
Sbjct  423   RVGSQSAQMKMTRVPIHGGLSWQVFTEQTASTDDSSFTMTGLLEQLNTTRDLTDYLWYST  482

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV ID  EGFL  GK P L V SAGHALHVFVN QL G+ YGSLE PK+TFS++V +R G
Sbjct  483   DVVIDTDEGFLSSGKDPVLTVLSAGHALHVFVNDQLSGTIYGSLEFPKLTFSQNVKLRPG  542

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP++L GLNEG+RDLTWQKWSYK+GL GE+LS
Sbjct  543   VNKISLLSVAVGLPNVGPHFETWNAGVLGPITLNGLNEGRRDLTWQKWSYKVGLNGESLS  602

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSV+W+QGS V Q+QPLTWYKTTF+AP G  P ALDM +MGKGQVW+NGQ+IG
Sbjct  603   LHSLSGSSSVDWIQGSLVSQRQPLTWYKTTFDAPDGIAPFALDMGSMGKGQVWLNGQNIG  662

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+  WYHVPRS+L PTGN
Sbjct  663   RYWPAYKASGTCDDCDYAGTYNENKCRSNCGEASQTWYHVPRSWLIPTGN  712



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   505 bits (1300),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 241/349 (69%), Positives = 286/349 (82%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF+SKS  +CAAFLAN+D     KV+FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  360   GSNQEAHVFQSKS--SCAAFLANYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSSQMKMTPV    +WQSY EE  T Y D+T T+ GL EQIN TRDASDYLWY T+
Sbjct  418   RLGAQSSQMKMTPVGGALSWQSYIEEAATGYTDDTTTLEGLWEQINVTRDASDYLWYMTN  477

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G  P L +FSAGH+LHVF+NGQL G+ YGSLENPK+TFS++V + AG+
Sbjct  478   VNIDSDEGFLKNGDSPVLTIFSAGHSLHVFINGQLAGTVYGSLENPKLTFSQNVKLTAGI  537

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FE WN GILGPV+L GLNEG RDL+  KWSYKIGLKGEALSL
Sbjct  538   NKISLLSVAVGLPNVGVHFEKWNAGILGPVTLKGLNEGTRDLSGWKWSYKIGLKGEALSL  597

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+GS   +KQPLTWYK TF+AP GN+P+ALDM++MGKGQ+W+NGQSIGR
Sbjct  598   HTVTGSSSVEWVEGSLSAKKQPLTWYKATFDAPEGNDPVALDMSSMGKGQIWVNGQSIGR  657

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+C  CNYAG +D+KKC   CGE + RWYHVPRS+L P+GN
Sbjct  658   HWPAYTARGSCSACNYAGTYDDKKCRSNCGEPSQRWYHVPRSWLNPSGN  706



>ref|NP_001266102.1| beta-galactosidase 1-like precursor [Cicer arietinum]
 emb|CAA07236.2| beta-galactosidase precursor [Cicer arietinum]
Length=839

 Score =   504 bits (1298),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 304/350 (87%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFLAN++ HSY+ V+FGN HYNLPPWS+SILP+CK+TV+NTA
Sbjct  356   GNYQEAHVFKSKSG-ACAAFLANYNPHSYSTVAFGNQHYNLPPWSISILPNCKHTVYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +W+++NEETT+  D++FTV GLLEQIN TRD SDYLWY+T
Sbjct  415   RLGSQSAQMKMTRVPIHGGLSWKAFNEETTTTDDSSFTVTGLLEQINATRDLSDYLWYST  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I+P EG+ + GK P L V SAGHALHVF+NGQL G+ YGSL+ PK+TFS+SVN+RAG
Sbjct  475   DVVINPDEGYFRNGKNPVLTVLSAGHALHVFINGQLSGTVYGSLDFPKLTFSESVNLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP++L GLNEG+RDLTWQKWSYK+GLKGE LS
Sbjct  535   VNKISLLSVAVGLPNVGPHFETWNAGVLGPITLNGLNEGRRDLTWQKWSYKVGLKGEDLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSV+W+QG  V ++QPLTWYKTTF+AP G  PLALDMN+MGKGQVW+NGQS+G
Sbjct  595   LHSLSGSSSVDWLQGYLVSRRQPLTWYKTTFDAPAGVAPLALDMNSMGKGQVWLNGQSLG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KA+G+C  CNYAG ++EKKC   CGEA+ RWYHVP S+L+PTGN
Sbjct  655   RYWPAYKATGSCDYCNYAGTYNEKKCGTNCGEASQRWYHVPHSWLKPTGN  704



>gb|KHG11296.1| Beta-galactosidase [Gossypium arboreum]
Length=706

 Score =   499 bits (1286),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 240/349 (69%), Positives = 286/349 (82%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKSG ACAAFLAN+D     KV FGN  Y+LP WS+SILPDCK  VFNTA
Sbjct  335   GSKQEAHVFKSKSG-ACAAFLANYDTRYSVKVKFGNGQYDLPRWSISILPDCKTAVFNTA  393

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             RIGA SS+  M P+++ F+WQSYNE++ +  D   TV  GL EQI  TRDASDYLWY TD
Sbjct  394   RIGAHSSKKAMVPLNRAFSWQSYNEQSPTADDREATVHNGLWEQIYLTRDASDYLWYMTD  453

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP EGFLKGG+ P L V+SAGHALHVF+NGQL G+ YG L+NPK+TFS +V +RAG+
Sbjct  454   VKIDPNEGFLKGGQGPILTVWSAGHALHVFINGQLSGTVYGGLDNPKLTFSNNVKLRAGI  513

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+I+LLS+AVGLPN+G  FETWN GILGPV+L GLNEG RD++ Q WSYKIGLKGEAL+L
Sbjct  514   NRISLLSVAVGLPNVGTHFETWNAGILGPVTLKGLNEGTRDISKQNWSYKIGLKGEALNL  573

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWVQGS +V+KQP+TWYKTTFNAP GNEPLALDM++MGKGQVWINGQSIGR
Sbjct  574   HTVTGSSSVEWVQGSQLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKGQVWINGQSIGR  633

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG + +KKC   CGE + RWYHVP S+++P+GN
Sbjct  634   HWPGYIARGSCGACDYAGTYTDKKCRTNCGEPSQRWYHVPHSWVKPSGN  682



>ref|XP_006451462.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64702.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=581

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  212   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  270

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  271   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  330

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  331   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  390

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  391   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  450

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  451   HTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  510

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  511   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSWLKPSGN  559



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   504 bits (1297),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QE  VFKSKS   CAAFLAN+D     KV+FGN  Y LPPWS+SILPDCK  V+NTA
Sbjct  358   GSNQEVHVFKSKS--VCAAFLANYDTKYSVKVTFGNGQYELPPWSISILPDCKTVVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKM P S  F+WQSYNEET S  D+ T T+ GL EQIN TRDA+DYLWY TD
Sbjct  416   RLGSQSSQMKMVPASSSFSWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L +FSAGHALHVF+NGQL G+AYG L NPK+TFS+++ +  G+
Sbjct  476   VKIDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGE+L L
Sbjct  536   NKISLLSVAVGLPNVGLHFETWNAGVLGPVTLKGLNEGTRDLSGQKWSYKIGLKGESLGL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GS SVEWV+GS + QKQ LTWYKT F+APPGN+PLALDM++MGKGQ+WINGQ+IGR
Sbjct  596   HTASGSESVEWVEGSLLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKGQMWINGQNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG FD+KKC   CGE + RWYHVPRS+L+P+GN
Sbjct  656   HWPGYIAHGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGN  704



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   503 bits (1296),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 285/349 (82%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKS   CAAFLAN+D     KV+FGN  Y LPPWSVSILPDCK  V+NTA
Sbjct  357   GSNQEAHVFKSKS--VCAAFLANYDTKYSVKVTFGNGQYELPPWSVSILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKM P S  F+WQSYNEET S  D+ T T+ GL EQIN TRDA+DYLWY TD
Sbjct  415   RLGSQSSQMKMVPASSSFSWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L +FSAGHALHVF+NGQL G+AYG L NPK+TFS+++ +  G+
Sbjct  475   VKIDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FETWN G+LGP++L GLNEG RDL+ QKWSYKIGLKGE+LSL
Sbjct  535   NKISLLSVAVGLPNVGLHFETWNAGVLGPITLKGLNEGTRDLSGQKWSYKIGLKGESLSL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GS SVEWV+GS + QKQ LTWYKT F+AP GN+PLALDM++MGKGQ+WINGQ+IGR
Sbjct  595   HTASGSESVEWVEGSLLAQKQALTWYKTAFDAPQGNDPLALDMSSMGKGQMWINGQNIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG FD+KKC   CGE + RWYHVPRS+L+P+GN
Sbjct  655   HWPGYIAHGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGN  703



>gb|ERM94020.1| hypothetical protein AMTR_s00136p00108810 [Amborella trichopoda]
Length=755

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  KSGG CAAFLAN+D  S A V F  MHYNLPPWS+SILPDCKNTVFNTA
Sbjct  273   GNYQEAHVFSPKSGG-CAAFLANYDSKSIATVQFNGMHYNLPPWSISILPDCKNTVFNTA  331

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
              +G Q S MKMT       W+SYNEE ++SY ++  TVVGLLEQIN TRD +DYLWY TD
Sbjct  332   EVGVQISDMKMTGTGTELYWESYNEEVSSSYTEDPMTVVGLLEQINVTRDTTDYLWYMTD  391

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   E FL GG+ P L+  SAGHALH F+NGQL G+AYGSLE+P++T + +  +++G 
Sbjct  392   VDISSSESFLNGGELPVLSAQSAGHALHAFINGQLAGTAYGSLEDPRLTLTTNAKLKSGS  451

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+IALLSIAVGLPN+G RFETWN G+LGPV L GLNEG+RDLTWQKWSYK+GL GE L+L
Sbjct  452   NRIALLSIAVGLPNVGKRFETWNAGVLGPVMLKGLNEGRRDLTWQKWSYKVGLTGETLNL  511

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEWV+GS + QKQPLTWYK TFNAP G+EPLALDM +MGKGQVWINGQSIGR
Sbjct  512   HTLSGSSSVEWVKGSLIAQKQPLTWYKATFNAPGGDEPLALDMGSMGKGQVWINGQSIGR  571

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA  A G+CG C+Y+G ++EK C   CGE + RWYHVPR +L PTGN
Sbjct  572   YWPAYTAKGSCGDCSYSGTYNEKNCQSNCGEPSQRWYHVPRPWLNPTGN  620



>ref|XP_006826783.2| PREDICTED: beta-galactosidase [Amborella trichopoda]
Length=815

 Score =   502 bits (1292),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF  KSGG CAAFLAN+D  S A V F  MHYNLPPWS+SILPDCKNTVFNTA
Sbjct  333   GNYQEAHVFSPKSGG-CAAFLANYDSKSIATVQFNGMHYNLPPWSISILPDCKNTVFNTA  391

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
              +G Q S MKMT       W+SYNEE ++SY ++  TVVGLLEQIN TRD +DYLWY TD
Sbjct  392   EVGVQISDMKMTGTGTELYWESYNEEVSSSYTEDPMTVVGLLEQINVTRDTTDYLWYMTD  451

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   E FL GG+ P L+  SAGHALH F+NGQL G+AYGSLE+P++T + +  +++G 
Sbjct  452   VDISSSESFLNGGELPVLSAQSAGHALHAFINGQLAGTAYGSLEDPRLTLTTNAKLKSGS  511

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+IALLSIAVGLPN+G RFETWN G+LGPV L GLNEG+RDLTWQKWSYK+GL GE L+L
Sbjct  512   NRIALLSIAVGLPNVGKRFETWNAGVLGPVMLKGLNEGRRDLTWQKWSYKVGLTGETLNL  571

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEWV+GS + QKQPLTWYK TFNAP G+EPLALDM +MGKGQVWINGQSIGR
Sbjct  572   HTLSGSSSVEWVKGSLIAQKQPLTWYKATFNAPGGDEPLALDMGSMGKGQVWINGQSIGR  631

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA  A G+CG C+Y+G ++EK C   CGE + RWYHVPR +L PTGN
Sbjct  632   YWPAYTAKGSCGDCSYSGTYNEKNCQSNCGEPSQRWYHVPRPWLNPTGN  680



>gb|AAQ21370.1| beta-galactosidase [Sandersonia aurantiaca]
Length=568

 Score =   493 bits (1269),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 235/348 (68%), Positives = 290/348 (83%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q++ VF+SK+G ACAAFL+N+D  SYA+V F  +HY++PPWS+SILPDCK TVFNTA
Sbjct  92    GHYQQSHVFRSKAG-ACAAFLSNYDSGSYARVVFNGIHYDIPPWSISILPDCKTTVFNTA  150

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             RIGAQ+SQ+KM    + F+W+SYNE+T S+ D +FT VGL+EQI+ TRD +DYLWYTT V
Sbjct  151   RIGAQTSQLKMEWAGK-FSWESYNEDTNSFDDRSFTKVGLVEQISMTRDNTDYLWYTTYV  209

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   EGFLK G +P L V SAGH++H+++NGQL G+ YG+LENPK+T++ SV + AG N
Sbjct  210   NIGENEGFLKNGHYPVLTVNSAGHSMHIYINGQLTGTIYGALENPKLTYTGSVKLWAGSN  269

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS+AVGLPNIG  FETWNTG+LGPV+L GLNEGKRDL+WQKW Y+IGLKGEAL+LH
Sbjct  270   KISILSVAVGLPNIGGHFETWNTGVLGPVTLSGLNEGKRDLSWQKWIYQIGLKGEALNLH  329

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             +L+GSSSVEW   S   QKQ LTWYKT+FNAP GN+PLALDM +MGKGQVWINGQS+GRY
Sbjct  330   TLSGSSSVEWGGPS---QKQSLTWYKTSFNAPAGNDPLALDMGSMGKGQVWINGQSVGRY  386

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KASG+CG C+Y G ++EKKC   CGE+T RWYHVPRS+L PTGN
Sbjct  387   WPAYKASGSCGGCDYRGTYNEKKCQSNCGESTQRWYHVPRSWLNPTGN  434



>emb|CBI27912.3| unnamed protein product [Vitis vinifera]
Length=833

 Score =   502 bits (1292),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 244/349 (70%), Positives = 287/349 (82%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA V+K+KSG ACAAFLAN+D  S AKV+FGN  Y+LPPWSVSILPDCKN VFNTA
Sbjct  353   GTNLEAHVYKAKSG-ACAAFLANYDPKSSAKVTFGNTQYDLPPWSVSILPDCKNVVFNTA  411

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQSSQMKM PVS  F+WQSYNEET S Y ++T T+ GLLEQIN TRD +DYLWY T+
Sbjct  412   RIGAQSSQMKMNPVST-FSWQSYNEETASAYTEDTTTMDGLLEQINITRDTTDYLWYMTE  470

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P EGFLK G++P L V SAGHALHVF+NGQL G+ YG L NPKVTFS +V +  G 
Sbjct  471   VHIKPDEGFLKTGQYPVLTVMSAGHALHVFINGQLSGTVYGELSNPKVTFSDNVKLTVGT  530

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+A+GLPN+G  FETWN G+LGPV+L GLNEG  D++  KWSYKIGLKGEAL+L
Sbjct  531   NKISLLSVAMGLPNVGLHFETWNAGVLGPVTLKGLNEGTVDMSSWKWSYKIGLKGEALNL  590

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
              ++TGSSS EWV+GS + QKQPLTWYKTTFNAP GN+PLALDM++MGKGQ+WING+SIGR
Sbjct  591   QAITGSSSDEWVEGSLLAQKQPLTWYKTTFNAPGGNDPLALDMSSMGKGQIWINGESIGR  650

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNC  CNYAG F++KKC   CG  + RWYHVPRS+L+P+GN
Sbjct  651   HWPAYTAHGNCNGCNYAGIFNDKKCQTGCGGPSQRWYHVPRSWLKPSGN  699



>ref|XP_002282132.1| PREDICTED: beta-galactosidase [Vitis vinifera]
Length=836

 Score =   501 bits (1291),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 244/349 (70%), Positives = 287/349 (82%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA V+K+KSG ACAAFLAN+D  S AKV+FGN  Y+LPPWSVSILPDCKN VFNTA
Sbjct  356   GTNLEAHVYKAKSG-ACAAFLANYDPKSSAKVTFGNTQYDLPPWSVSILPDCKNVVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQSSQMKM PVS  F+WQSYNEET S Y ++T T+ GLLEQIN TRD +DYLWY T+
Sbjct  415   RIGAQSSQMKMNPVST-FSWQSYNEETASAYTEDTTTMDGLLEQINITRDTTDYLWYMTE  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P EGFLK G++P L V SAGHALHVF+NGQL G+ YG L NPKVTFS +V +  G 
Sbjct  474   VHIKPDEGFLKTGQYPVLTVMSAGHALHVFINGQLSGTVYGELSNPKVTFSDNVKLTVGT  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+A+GLPN+G  FETWN G+LGPV+L GLNEG  D++  KWSYKIGLKGEAL+L
Sbjct  534   NKISLLSVAMGLPNVGLHFETWNAGVLGPVTLKGLNEGTVDMSSWKWSYKIGLKGEALNL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
              ++TGSSS EWV+GS + QKQPLTWYKTTFNAP GN+PLALDM++MGKGQ+WING+SIGR
Sbjct  594   QAITGSSSDEWVEGSLLAQKQPLTWYKTTFNAPGGNDPLALDMSSMGKGQIWINGESIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNC  CNYAG F++KKC   CG  + RWYHVPRS+L+P+GN
Sbjct  654   HWPAYTAHGNCNGCNYAGIFNDKKCQTGCGGPSQRWYHVPRSWLKPSGN  702



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =   503 bits (1294),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QE  VFKSKS   CAAFLAN+D     KV+FGN  Y LPPWS+SILPDCK  V+NTA
Sbjct  400   GSNQEVHVFKSKS--VCAAFLANYDTKYSVKVTFGNGQYELPPWSISILPDCKTVVYNTA  457

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKM P S  F+WQSYNEET S  D+ T T+ GL EQIN TRDA+DYLWY TD
Sbjct  458   RLGSQSSQMKMVPASSSFSWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTD  517

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L +FSAGHALHVF+NGQL G+AYG L NPK+TFS+++ +  G+
Sbjct  518   VKIDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGI  577

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGE+L L
Sbjct  578   NKISLLSVAVGLPNVGLHFETWNAGVLGPVTLKGLNEGTRDLSGQKWSYKIGLKGESLGL  637

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GS SVEWV+GS + QKQ LTWYKT F+APPGN+PLALDM++MGKGQ+WINGQ+IGR
Sbjct  638   HTASGSESVEWVEGSLLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKGQMWINGQNIGR  697

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG FD+KKC   CGE + RWYHVPRS+L+P+GN
Sbjct  698   HWPGYIAHGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGN  746



>gb|KDO57771.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=608

 Score =   493 bits (1270),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  239   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  297

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  298   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  357

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  358   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  417

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  418   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  477

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  478   HTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  537

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  538   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSWLKPSGN  586



>ref|XP_004135712.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=723

 Score =   497 bits (1279),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/349 (68%), Positives = 285/349 (82%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA V+ ++SG  CAAFLAN+D  +  +V+FGN  Y+LPPWSVSILPDCK  VFNTA
Sbjct  356   GSKQEAHVYNTRSG-ECAAFLANYDPSTSVRVTFGNHPYDLPPWSVSILPDCKTVVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A S   KMTP+S  F+W SYNEET S Y D+T T+ GL+EQI+ TRDA+DYLWY TD
Sbjct  415   KVNAPSYWPKMTPISS-FSWHSYNEETASAYADDTTTMAGLVEQISITRDATDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + ID  EGFLK G+WP L +FSAGHALHVF+NGQL G+ YG L+NPK+TFSK VN+R GV
Sbjct  474   IRIDSNEGFLKSGQWPLLTIFSAGHALHVFINGQLSGTVYGGLDNPKLTFSKYVNLRPGV  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWN GILGPV+L GLNEG RD++  KWSYK+GLKGEAL+L
Sbjct  534   NKLSMLSVAVGLPNVGVHFETWNAGILGPVTLKGLNEGTRDMSGYKWSYKVGLKGEALNL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW+ GS V QKQPLTWYKTTFNAP GNEPLALDM +MGKGQVWING+SIGR
Sbjct  594   HTVSGSSSVEWMTGSLVSQKQPLTWYKTTFNAPGGNEPLALDMGSMGKGQVWINGESIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C Y G F EKKC   CGE + RWYHVPR++L+P+GN
Sbjct  654   HWPAYTARGSCGKCYYGGIFTEKKCHFSCGEPSQRWYHVPRAWLKPSGN  702



>ref|XP_003597608.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08398.1| D-galactoside/L-rhamnose binding SUEL lectin; Galactose-binding 
like [Medicago truncatula]
 gb|AES67859.1| beta-galactosidase [Medicago truncatula]
Length=841

 Score =   499 bits (1285),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 244/350 (70%), Positives = 292/350 (83%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG ACAAFL N++  ++A V+FGNMHYNLPPWS+SILPDCKNTV+NTA
Sbjct  358   GNYQEAHVFKSKSG-ACAAFLGNYNPKAFATVAFGNMHYNLPPWSISILPDCKNTVYNTA  416

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +WQ + E+T S  D++FT+ GLLEQ+NTTRD +DYLWY+T
Sbjct  417   RVGSQSAQMKMTRVPIHGGLSWQVFTEQTASTDDSSFTMTGLLEQLNTTRDLTDYLWYST  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV IDP EGFL+ GK P L V SAGHALHVF+N QL G+ YGSLE PK+TFS++V +  G
Sbjct  477   DVVIDPNEGFLRSGKDPVLTVLSAGHALHVFINSQLSGTIYGSLEFPKLTFSQNVKLIPG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP++L GL+EG+RDL+WQKWSYK+GL GEALS
Sbjct  537   VNKISLLSVAVGLPNVGPHFETWNAGVLGPITLNGLDEGRRDLSWQKWSYKVGLHGEALS  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL GSSSVEWVQGS V + QPLTWYKTTF+AP G  P ALDM +MGKGQVW+NGQ++G
Sbjct  597   LHSLGGSSSVEWVQGSLVSRMQPLTWYKTTFDAPDGIAPFALDMGSMGKGQVWLNGQNLG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYWPA KASG C  C+YAG ++E KC   CGEA+ RWYHVP S+L PTGN
Sbjct  657   RYWPAYKASGTCDNCDYAGTYNENKCRSNCGEASQRWYHVPHSWLIPTGN  706



>ref|XP_007150529.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
 gb|ESW22523.1| hypothetical protein PHAVU_005G160000g [Phaseolus vulgaris]
Length=837

 Score =   499 bits (1284),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 248/350 (71%), Positives = 302/350 (86%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSK G ACAAFLAN++  SYA V+FG+MHYNLPPWS+SILPDCK+T++NTA
Sbjct  356   GNYQEAHVFKSKLG-ACAAFLANYNPKSYATVAFGSMHYNLPPWSISILPDCKHTIYNTA  414

Query  181   RIGAQSSQMKMT--PVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+G+QS+QMKMT  P+  G +W S+NEETT+  D++FT+ GLLEQ+NTTRD SDYLWY+T
Sbjct  415   RVGSQSAQMKMTAVPIHGGLSWLSFNEETTTTDDSSFTMTGLLEQLNTTRDLSDYLWYST  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV +DP EGFL  GK P L VFSAGHALHVF+NGQL G++YGSL  PK+TFS+ V +RAG
Sbjct  475   DVVLDPNEGFLINGKEPVLTVFSAGHALHVFINGQLSGTSYGSLNFPKLTFSEGVKLRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNKI+LLS+AVGLPN+GP FETWN G+LGP+SL GLNEG+RDL+WQKWSYK+GLKGE LS
Sbjct  535   VNKISLLSVAVGLPNVGPHFETWNAGVLGPISLSGLNEGRRDLSWQKWSYKVGLKGETLS  594

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LHSL+GSSSVEW+QGS V ++QPLTWYKTTF+AP G  PLALDM++MGKGQVW+NGQ++G
Sbjct  595   LHSLSGSSSVEWIQGSLVSRRQPLTWYKTTFDAPAGTAPLALDMDSMGKGQVWLNGQNLG  654

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KA+G C  C+YAG ++E KC   CGEA+ RWYHVP+S+L+PTGN
Sbjct  655   RFWPAYKAAGACDHCDYAGTYNENKCRSNCGEASQRWYHVPQSWLKPTGN  704



>ref|XP_007204656.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
 gb|EMJ05855.1| hypothetical protein PRUPE_ppa001412mg [Prunus persica]
Length=836

 Score =   499 bits (1284),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG  CAAFLAN+D  S AKVSFGN  Y LPPWS+SILPDCK  V+NTA
Sbjct  358   GNGQEAHVFKSKSG--CAAFLANYDTKSSAKVSFGNGQYELPPWSISILPDCKTAVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKMTPV     WQS+ EE+ S  + +T T+ GL EQIN TRD +DYLWY TD
Sbjct  416   RLGSQSSQMKMTPVKSALPWQSFVEESASSDESDTTTLDGLWEQINVTRDTTDYLWYMTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P EGF+K G+ P L ++SAGHALHVF+NGQL G+ YG+LENPK+TFS++V +R+G+
Sbjct  476   ITISPDEGFIKRGESPLLTIYSAGHALHVFINGQLSGTVYGALENPKLTFSQNVKLRSGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGPV+L GLN G  D++  KW+YKIGLKGEAL L
Sbjct  536   NKLALLSISVGLPNVGLHFETWNAGVLGPVTLKGLNSGTWDMSRWKWTYKIGLKGEALGL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW +G  + QKQPLTWYK TFNAPPGN PLALDM++MGKGQ+WINGQSIGR
Sbjct  596   HTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKGQIWINGQSIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG C YAG +D+KKC   CGE + RWYHVPRS+L P+GN
Sbjct  656   HWPAYTARGNCGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSGN  704



>gb|KDO57770.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=683

 Score =   493 bits (1270),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  314   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  372

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  373   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  432

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  433   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  492

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  493   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  552

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  553   HTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  612

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  613   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSWLKPSGN  661



>ref|XP_006451461.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64701.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=737

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  547   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  607   HTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  667   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSWLKPSGN  715



>gb|AHG94613.1| beta-galactosidase [Camellia sinensis]
Length=725

 Score =   494 bits (1272),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+ E  VFK++S  ACAAFLAN+D +S A V+F N  Y LPPWSVSILPDCKN +FNTA
Sbjct  357   GNNLEVHVFKTRS--ACAAFLANYDTNSPATVTFQNAQYYLPPWSVSILPDCKNAIFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I A S Q KMTP S GF+WQS  E+T S  D +T    GLLEQI+ TRD SDYLWY T+
Sbjct  415   KITASSYQPKMTPASGGFSWQSSTEQTVSADDSDTIAKAGLLEQISVTRDTSDYLWYLTN  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P EGFLK G++P L + SAGHALHVF+NGQL G+ +GSLENPK+T+S +V +RAG+
Sbjct  475   VNIQPGEGFLKNGQYPTLTIMSAGHALHVFINGQLSGTVFGSLENPKLTYSSTVKLRAGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  ++TWNTG+LGPV+L GLNEG RDLT Q+WSYK+GLKGE L L
Sbjct  535   NKISLLSVAVGLPNVGVHYDTWNTGVLGPVTLKGLNEGTRDLTKQQWSYKVGLKGEGLKL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L GSSSVEW +GS +  KQPLTWYKTTFNAP GN+PLALDMNTMGKG+VW+NGQSIGR
Sbjct  595   HTLDGSSSVEWAEGSLLATKQPLTWYKTTFNAPAGNDPLALDMNTMGKGEVWVNGQSIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP  KA+GNCG C+YAG F EKKC   CG+++ RWYHVPRS+L+ +GN
Sbjct  655   HWPGYKANGNCGACSYAGTFTEKKCRFNCGQSSQRWYHVPRSWLKSSGN  703



>gb|KDO57763.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=737

 Score =   494 bits (1272),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  547   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  607   HTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  667   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSWLKPSGN  715



>ref|XP_008242341.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase [Prunus mume]
Length=836

 Score =   497 bits (1280),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 236/349 (68%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GNSQEA VFKSKSG  CAAFLAN+D  S AKVSFGN  Y LPPWS+SILPDCK  V+NTA
Sbjct  358   GNSQEAHVFKSKSG--CAAFLANYDTKSSAKVSFGNGQYELPPWSISILPDCKTAVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKMTPV     WQS+ EE+ S  + +T T+ GL EQIN TRD +DYLWY TD
Sbjct  416   RLGSQSSQMKMTPVKSALPWQSFIEESASXDESDTTTLDGLWEQINVTRDTTDYLWYMTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P EGF+K G+ P L ++SAGHALHVF+NGQL G+ YG+LENPK+TFS++V +R+G+
Sbjct  476   ITISPDEGFIKRGESPLLTIYSAGHALHVFINGQLSGTVYGALENPKLTFSQNVKLRSGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGPV+L GLN G  D++  KW+YK+GLKGEAL L
Sbjct  536   NKLALLSISVGLPNVGLHFETWNAGVLGPVTLKGLNSGTWDMSRWKWTYKVGLKGEALGL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW +G  + QKQPLTWYK TFNAPPGN PLALDM++MGKGQ+WINGQSIGR
Sbjct  596   HTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKGQIWINGQSIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG C YAG +D+KKC   CGE + RWYHVPRS+L P+ N
Sbjct  656   HWPAYTARGNCGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSEN  704



>sp|P45582.1|BGAL_ASPOF RecName: Full=Beta-galactosidase; Short=Lactase; Flags: Precursor 
[Asparagus officinalis]
 emb|CAA54525.1| beta-galactosidase [Asparagus officinalis]
Length=832

 Score =   496 bits (1278),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 241/348 (69%), Positives = 288/348 (83%), Gaps = 6/348 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QE+ V++SKS  +CAAFLAN +   YA V+F  MHYNLPPWSVSILPDCK TVFNTA
Sbjct  357   GQNQESYVYRSKS--SCAAFLANFNSRYYATVTFNGMHYNLPPWSVSILPDCKTTVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQ++ MKM  +  GF+W++Y E+T +  DNTFT  GL+EQ++TT D SDYLWYTT V
Sbjct  415   RVGAQTTTMKMQYLG-GFSWKAYTEDTDALNDNTFTKDGLVEQLSTTWDRSDYLWYTTYV  473

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK GK+P+L V SAGHA+HVF+NGQL G+AYGSL+NPK+T+S S  + AG N
Sbjct  474   DIAKNEEFLKTGKYPYLTVMSAGHAVHVFINGQLSGTAYGSLDNPKLTYSGSAKLWAGSN  533

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS++VGLPN+G  FETWNTG+LGPV+L GLNEGKRDL+ QKW+Y+IGL GE LSLH
Sbjct  534   KISILSVSVGLPNVGNHFETWNTGVLGPVTLTGLNEGKRDLSLQKWTYQIGLHGETLSLH  593

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SLTGSS+VEW + S   QKQPLTWYKT FNAPPGNEPLALDMNTMGKGQ+WINGQSIGRY
Sbjct  594   SLTGSSNVEWGEAS---QKQPLTWYKTFFNAPPGNEPLALDMNTMGKGQIWINGQSIGRY  650

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KASG+CG C+Y G ++EKKCL  CGEA+ RWYHVPRS+L PTGN
Sbjct  651   WPAYKASGSCGSCDYRGTYNEKKCLSNCGEASQRWYHVPRSWLIPTGN  698



>gb|KJB07252.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=738

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKSG ACAAFLAN+D     KV FGN  Y+LP WS+SILPDCK  VFNTA
Sbjct  367   GSKQEAHVFKSKSG-ACAAFLANYDTRYSVKVKFGNGQYDLPRWSISILPDCKTAVFNTA  425

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             +IGA SS+  M PV+  F+WQSY E++ +  D   TV  GL EQI  TRDASDYLWY TD
Sbjct  426   KIGAHSSKKAMVPVNSAFSWQSYTEQSPTADDREATVHNGLWEQIYLTRDASDYLWYMTD  485

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP EGFLKG + P L V+SAGHALHVF NGQL G+ YG L+NPK+TFS +V +RAG+
Sbjct  486   VKIDPNEGFLKGRQGPILTVWSAGHALHVFTNGQLSGTVYGGLDNPKLTFSNNVKLRAGI  545

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+I+LLS+AVGLPN G  FETWN G+LGPV+L GLNEG RD++ Q WSYKIGLKGEAL+L
Sbjct  546   NRISLLSVAVGLPNFGTHFETWNAGVLGPVTLKGLNEGTRDISKQNWSYKIGLKGEALNL  605

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWVQGS +V+KQP+TWYKTTFNAP GNEPLALDM++MGKGQVWINGQSIGR
Sbjct  606   HTVTGSSSVEWVQGSQLVKKQPMTWYKTTFNAPRGNEPLALDMSSMGKGQVWINGQSIGR  665

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG + +KKC   CGE + RWYHVPRS+++P+GN
Sbjct  666   HWPGYIARGSCGACDYAGTYTDKKCRTNCGEPSQRWYHVPRSWVKPSGN  714



>ref|XP_008450854.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=723

 Score =   493 bits (1268),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF ++SG  CAAFLAN+D  +  +V FGN  Y+LPPWSVSILPDCK  VFNTA
Sbjct  356   GSKQEAHVFDTRSG-QCAAFLANYDPSTSVRVIFGNHPYDLPPWSVSILPDCKTVVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A S   KMTP+S  F+W SYNEET S Y D+T T+ GL+EQI+ TRD +DYLWY TD
Sbjct  415   KVNAPSYWPKMTPISS-FSWHSYNEETASAYADDTTTMAGLVEQISVTRDGTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + ID  EGFLK G+WP L +FSAGHALHVF+NGQL G+ YG L+NPK+TFSK VN+R GV
Sbjct  474   IRIDSNEGFLKSGQWPLLTIFSAGHALHVFINGQLSGTVYGGLDNPKLTFSKYVNLRPGV  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWN GILGPV+L GLNEG RD++  KWSYK+GLKGE+++L
Sbjct  534   NKLSMLSVAVGLPNVGLHFETWNAGILGPVTLKGLNEGTRDMSGYKWSYKVGLKGESMNL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW+ GS V QKQPLTWYKTTFNAP GNEPLALDM +MGKGQVWING+SIGR
Sbjct  594   HTISGSSSVEWMTGSLVSQKQPLTWYKTTFNAPGGNEPLALDMGSMGKGQVWINGRSIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C Y G F EKKC   CGE + +WYHVPR++L+P+GN
Sbjct  654   HWPAYTARGSCGKCYYGGIFTEKKCHYSCGEPSQKWYHVPRAWLKPSGN  702



>gb|ABV32546.1| beta-galactosidase protein 1 [Prunus persica]
Length=836

 Score =   495 bits (1275),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/349 (68%), Positives = 282/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSKSG  CAAFLAN+D  S AKVSFGN  Y LPPW +SILPDCK  V+NTA
Sbjct  358   GNGQEAHVFKSKSG--CAAFLANYDTKSSAKVSFGNGQYELPPWPISILPDCKTAVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKMTPV     WQS+ EE+ S  + +T T+ GL EQIN TRD +DYLWY TD
Sbjct  416   RLGSQSSQMKMTPVKSALPWQSFVEESASSDESDTTTLDGLWEQINVTRDTTDYLWYMTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P EGF+K G+ P L ++SAGHALHVF+NGQL G+ YG+LENPK+TFS++V  R+G+
Sbjct  476   ITISPDEGFIKRGESPLLTIYSAGHALHVFINGQLSGTVYGALENPKLTFSQNVKPRSGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGPV+L GLN G  D++  KW+YKIGLKGEAL L
Sbjct  536   NKLALLSISVGLPNVGLHFETWNAGVLGPVTLKGLNSGTWDMSRWKWTYKIGLKGEALGL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW +G  + QKQPLTWYK TFNAPPGN PLALDM++MGKGQ+WINGQSIGR
Sbjct  596   HTVSGSSSVEWAEGPSMAQKQPLTWYKATFNAPPGNGPLALDMSSMGKGQIWINGQSIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG C YAG +D+KKC   CGE + RWYHVPRS+L P+GN
Sbjct  656   HWPAYTARGNCGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTPSGN  704



>ref|XP_010090040.1| hypothetical protein L484_027271 [Morus notabilis]
 gb|EXB38837.1| hypothetical protein L484_027271 [Morus notabilis]
Length=838

 Score =   495 bits (1274),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 287/350 (82%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VF+S +G ACAAFLAN+D +   KVSFGN  YNLPPWS+SILPDCK  V+NTA
Sbjct  359   GNNQEAHVFRSNTG-ACAAFLANYDTNYDVKVSFGNGRYNLPPWSISILPDCKTAVYNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSY--GDNTFTVVGLLEQINTTRDASDYLWYTT  354
             R+GAQS+ M MTPV +GF+W+SYNEET S   GD T  + GL EQ+  TRD +DYLWY T
Sbjct  418   RLGAQSTVMWMTPVYKGFSWESYNEETASANSGDTT-ALDGLWEQVYVTRDNTDYLWYLT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             D+TI   EGFLK G +P LN+FSAGHALHVFVNGQL GSAYGSL+ PK+TF++++ +RAG
Sbjct  477   DITIGSDEGFLKTGNYPLLNIFSAGHALHVFVNGQLTGSAYGSLDKPKLTFTQNIKLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             VNK+ALLS+AVGLPN+G  FETWN G+LGPV+L GLN G  D++  KWSYKIGLKGE L 
Sbjct  537   VNKLALLSVAVGLPNVGLHFETWNAGVLGPVTLNGLNTGTWDMSKWKWSYKIGLKGEKLG  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LH+++GSSSVEW QGSF+ + QPLTWYKTTFNAP GN PLALDMN+MGKGQ+WING+SIG
Sbjct  597   LHTVSGSSSVEWGQGSFLAKHQPLTWYKTTFNAPGGNGPLALDMNSMGKGQIWINGRSIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA KASG CG CNYAG F +KKC   CG+ + RWYHVPRS+L PTGN
Sbjct  657   RHWPAYKASGGCGPCNYAGTFTDKKCRTDCGQPSQRWYHVPRSWLNPTGN  706



>ref|NP_001275845.1| beta-galactosidase [Citrus sinensis]
 gb|AAK31801.1| beta-galactosidase [Citrus sinensis]
Length=737

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 277/349 (79%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF S SG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GENQEAHVFNSISG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +RAGV
Sbjct  487   VNIGSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRAGV  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  547   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  607   HTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP    +GNCG CNYAG + EKKC   CG+ + RWYHVPRS L+P+GN
Sbjct  667   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRWYHVPRSRLKPSGN  715



>gb|ABY71826.1| beta-galactosidase [Prunus salicina]
Length=836

 Score =   492 bits (1266),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GNSQEA VFKSKSG  CAAFLAN+D  S AKVSFGN  Y LPPWS+SILPDC+  V+NTA
Sbjct  358   GNSQEAHVFKSKSG--CAAFLANYDTKSSAKVSFGNGQYELPPWSISILPDCRTAVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+QSSQMKMTPV     WQS+ EE+ S  + +T T+ GL EQIN TRD +DY WY TD
Sbjct  416   RLGSQSSQMKMTPVKSALPWQSFIEESASSDESDTTTLDGLWEQINVTRDTTDYSWYMTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P EGF+K G+ P L ++SAGHALHVF+NGQL G+ YG+LENPK+TFS++V +R+G+
Sbjct  476   ITISPDEGFIKRGESPLLTIYSAGHALHVFINGQLSGTVYGALENPKLTFSQNVKLRSGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGPV+L GLN G  D++  KW+YK+GLKGEAL L
Sbjct  536   NKLALLSISVGLPNVGLHFETWNAGVLGPVTLKGLNSGTWDMSRWKWTYKVGLKGEALGL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW +G  + QKQPLTWY+ TFNAPPGN PLALDM++MGKGQ+WINGQSIGR
Sbjct  596   HTVSGSSSVEWAEGPSMAQKQPLTWYRATFNAPPGNGPLALDMSSMGKGQIWINGQSIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG C YAG +D+KKC   CGE + RWYHVPRS+L  +GN
Sbjct  656   HWPAYTARGNCGNCYYAGTYDDKKCRTHCGEPSQRWYHVPRSWLTTSGN  704



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   488 bits (1257),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 289/349 (83%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFK+ SG  CAAFLAN+D     +V+FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  353   GSNQEAHVFKAGSG--CAAFLANYDTKYSVRVNFGNGKYDLPPWSISILPDCKTAVYNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+ A SSQ+KM PV  GF+WQSY EET S +G +T+T  GLLEQI+ TRD SDYLWYTTD
Sbjct  411   RVNAPSSQIKMVPVG-GFSWQSYIEETVSAFGSDTYTKDGLLEQISFTRDFSDYLWYTTD  469

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+ G++P L ++SAGHA+HVF+NG+L GSAYGSLENPK+++S +V +RAG+
Sbjct  470   ITISPNEAFLRSGQYPVLTIWSAGHAMHVFINGELTGSAYGSLENPKLSYSNNVKLRAGI  529

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWNTG+LGPV+L GLN G  D++  KWSYK+GLKGE L L
Sbjct  530   NKLSILSVAVGLPNVGLHFETWNTGVLGPVTLKGLNSGTWDMSKWKWSYKVGLKGENLGL  589

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEW++GS + QKQPLTWYK TFNAPPG+ PLALDMN+MGKG++WINGQSIGR
Sbjct  590   NTVSGSSSVEWLEGSMLAQKQPLTWYKATFNAPPGHSPLALDMNSMGKGEIWINGQSIGR  649

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C+YAG FDE KC   CG+A+ RWYHVPRS+L PTGN
Sbjct  650   HWPAYTARGSCGSCSYAGTFDENKCRSGCGQASQRWYHVPRSWLNPTGN  698



>gb|AAQ21369.1| beta-galactosidase [Sandersonia aurantiaca]
Length=826

 Score =   489 bits (1258),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 235/348 (68%), Positives = 286/348 (82%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QE+ VF+S SG ACAAFLAN+D   YA V+F  M YNLPPWS+SILPDCK TVFNTA
Sbjct  356   GNNQESNVFRSNSG-ACAAFLANYDTKYYATVTFNGMRYNLPPWSISILPDCKTTVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQ++QM+MT V  GF+W SYNE+  S  D +FT +GL+EQI+ TRD++DYLWYTT V
Sbjct  415   RVGAQTTQMQMTTVG-GFSWVSYNEDPNSIDDGSFTKLGLVEQISMTRDSTDYLWYTTYV  473

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID  E FLK G++P L   SAGH+LHVF+NGQL+G+AYGS+E+P++T++ +V + AG N
Sbjct  474   NIDQNEQFLKNGQYPVLTAQSAGHSLHVFINGQLIGTAYGSVEDPRLTYTGNVKLFAGSN  533

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI+ LSIAVGLPN+G  FETWNTG+LGPV+L GLNEGKRDLTWQKW+YKIGLKGEALSLH
Sbjct  534   KISFLSIAVGLPNVGEHFETWNTGLLGPVTLNGLNEGKRDLTWQKWTYKIGLKGEALSLH  593

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             +L+GSS+VEW   S   +KQPL WYK  FNAP G+EPLALDM+TMGKGQVWINGQSIGRY
Sbjct  594   TLSGSSNVEWGDAS---RKQPLAWYKGFFNAPGGSEPLALDMSTMGKGQVWINGQSIGRY  650

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA G+C  C+Y G ++E KC   CG+++ RWYHVPRS+L PTGN
Sbjct  651   WPAYKARGSCPKCDYEGTYEETKCQSNCGDSSQRWYHVPRSWLNPTGN  698



>gb|KCW82506.1| hypothetical protein EUGRSUZ_C03898, partial [Eucalyptus grandis]
Length=700

 Score =   484 bits (1247),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 281/349 (81%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VFK+ SG  CAAFLAN+D     KV+FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  338   GRNQEAHVFKAGSG--CAAFLANYDTKYPVKVNFGNGQYDLPPWSISILPDCKTAVYNTA  395

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+   +SQ+KM PV  GF+WQSY EE  S +G +TFT  GLLEQI+ TRD SDYLWYTTD
Sbjct  396   RVSVPTSQIKMVPVG-GFSWQSYVEEIVSAFGGDTFTKDGLLEQISLTRDVSDYLWYTTD  454

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+  + P L + SAGHA+HVFVNG+L GSAYGSLENPK+TFS+ V +RAG+
Sbjct  455   ITISPNEAFLRSSQSPVLTISSAGHAMHVFVNGELAGSAYGSLENPKLTFSEKVKLRAGI  514

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWNTG+LGPV+L GLN G  D++  KWSYK+GLKGEA SL
Sbjct  515   NKLSILSVAVGLPNVGLHFETWNTGVLGPVTLRGLNSGTWDMSKWKWSYKVGLKGEAQSL  574

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW++GS + QKQPLTWYK TFNAP G+ PLALDMN+MGKGQ+WINGQSIGR
Sbjct  575   HTQSGSSSVEWLEGSTLAQKQPLTWYKATFNAPLGHAPLALDMNSMGKGQMWINGQSIGR  634

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C YAG FDE KC   CGE + RWYH+PRS+L+PTGN
Sbjct  635   HWPAYTARGSCGSCIYAGTFDENKCRSNCGEPSQRWYHIPRSWLKPTGN  683



>ref|XP_010536861.1| PREDICTED: beta-galactosidase 12 [Tarenaya hassleriana]
Length=726

 Score =   485 bits (1248),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF+SKS  +CAAFL+N+D  S  KV+FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  357   GDNQEAHVFRSKS--SCAAFLSNYDPSSAVKVTFGGFPYDLPPWSVSILPDCKTVYYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A S  MKM P    F+W+SYNEE+ S+ D+ TF + G +EQIN TRD++DYLWY TD
Sbjct  415   QVRAPSVTMKMVPTGGPFSWESYNEESPSWNDDGTFALDGFVEQINMTRDSTDYLWYLTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FLK G  P L ++SAGHALHVFVNGQL G+AYGSL NPK+TFS+ + + AGV
Sbjct  475   ITISPDEKFLKTGDDPLLTIWSAGHALHVFVNGQLAGTAYGSLNNPKLTFSQKIKLHAGV  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSIAVGLPN+G  +ETWN G+LGPVSL G+N G  D++  KWSYK+GLKGEALSL
Sbjct  535   NKLALLSIAVGLPNVGLHYETWNAGVLGPVSLKGVNSGTWDMSKWKWSYKVGLKGEALSL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+GS V +KQPLTWYK +F+ P GNEPLALDM+TMGKGQ+WING++IGR
Sbjct  595   HTVTGSSSVEWVEGSLVAKKQPLTWYKASFDTPAGNEPLALDMDTMGKGQIWINGRNIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP N A GNCG C+YAG + +KKCL  CGEA+ RWYHVPRS+L+P+GN
Sbjct  655   HWPGNTAHGNCGRCSYAGTYTDKKCLSNCGEASQRWYHVPRSWLKPSGN  703



>ref|XP_010049744.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
Length=703

 Score =   484 bits (1245),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 281/349 (81%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VFK+ SG  CAAFLAN+D     KV+FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  335   GRNQEAHVFKAGSG--CAAFLANYDTKYPVKVNFGNGQYDLPPWSISILPDCKTAVYNTA  392

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+   +SQ+KM PV  GF+WQSY EE  S +G +TFT  GLLEQI+ TRD SDYLWYTTD
Sbjct  393   RVSVPTSQIKMVPVG-GFSWQSYVEEIVSAFGGDTFTKDGLLEQISLTRDVSDYLWYTTD  451

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+  + P L + SAGHA+HVFVNG+L GSAYGSLENPK+TFS+ V +RAG+
Sbjct  452   ITISPNEAFLRSSQSPVLTISSAGHAMHVFVNGELAGSAYGSLENPKLTFSEKVKLRAGI  511

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWNTG+LGPV+L GLN G  D++  KWSYK+GLKGEA SL
Sbjct  512   NKLSILSVAVGLPNVGLHFETWNTGVLGPVTLRGLNSGTWDMSKWKWSYKVGLKGEAQSL  571

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW++GS + QKQPLTWYK TFNAP G+ PLALDMN+MGKGQ+WINGQSIGR
Sbjct  572   HTQSGSSSVEWLEGSTLAQKQPLTWYKATFNAPLGHAPLALDMNSMGKGQMWINGQSIGR  631

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C YAG FDE KC   CGE + RWYH+PRS+L+PTGN
Sbjct  632   HWPAYTARGSCGSCIYAGTFDENKCRSNCGEPSQRWYHIPRSWLKPTGN  680



>gb|KJB65169.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=811

 Score =   487 bits (1253),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKSG ACAAFLAN+D     KV+FG+ HY LP WS++ILPDCK  VFNTA
Sbjct  363   GSNQEAHVFKSKSG-ACAAFLANYDTKYSVKVTFGSAHYELPRWSITILPDCKTAVFNTA  421

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTV-VGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS+ KM   +  F+WQSYNEE+ S  D   TV  GL EQI  TRDA+DYLWY TD
Sbjct  422   RLGAQSSEKKMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTD  481

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFL+ G+ P L ++SAGHALHVF+NGQL G+ YG LENPK+TFS +V +RAG+
Sbjct  482   VQIDSDEGFLRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGI  541

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ LLS+AVGL N+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL L
Sbjct  542   NKVTLLSVAVGLSNVGTHFETWNVGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALKL  601

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++ GSSSVEWV+GS +V+KQP+TWYKTTF+AP GNEPL LDM++MGKGQ+WINGQSIGR
Sbjct  602   HTVAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQLWINGQSIGR  661

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNC  C+YAG + ++KC   CGE + RWYHVPRS+L+P+GN
Sbjct  662   HWPGYIAHGNCYACDYAGTYSDQKCRTNCGEPSQRWYHVPRSWLKPSGN  710



>gb|KJB65170.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
 gb|KJB65171.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=842

 Score =   487 bits (1253),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKSG ACAAFLAN+D     KV+FG+ HY LP WS++ILPDCK  VFNTA
Sbjct  363   GSNQEAHVFKSKSG-ACAAFLANYDTKYSVKVTFGSAHYELPRWSITILPDCKTAVFNTA  421

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTV-VGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS+ KM   +  F+WQSYNEE+ S  D   TV  GL EQI  TRDA+DYLWY TD
Sbjct  422   RLGAQSSEKKMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTD  481

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFL+ G+ P L ++SAGHALHVF+NGQL G+ YG LENPK+TFS +V +RAG+
Sbjct  482   VQIDSDEGFLRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGI  541

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ LLS+AVGL N+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL L
Sbjct  542   NKVTLLSVAVGLSNVGTHFETWNVGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALKL  601

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++ GSSSVEWV+GS +V+KQP+TWYKTTF+AP GNEPL LDM++MGKGQ+WINGQSIGR
Sbjct  602   HTVAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQLWINGQSIGR  661

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNC  C+YAG + ++KC   CGE + RWYHVPRS+L+P+GN
Sbjct  662   HWPGYIAHGNCYACDYAGTYSDQKCRTNCGEPSQRWYHVPRSWLKPSGN  710



>ref|XP_009768469.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=837

 Score =   486 bits (1250),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA V+ SKSG  CAAFL+N+D     +V+F NM Y+LPPWSVSILPDCK  V+NTA
Sbjct  356   GKNQEAHVYNSKSG-LCAAFLSNYDPTFSVRVTFQNMLYDLPPWSVSILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI ++SSQMKMT V  G +W+SY+EET S  D +T +  GL EQIN TRD++DYLWY T+
Sbjct  415   RISSRSSQMKMTSVGGGLSWESYSEETPSADDSDTISATGLWEQINVTRDSTDYLWYMTN  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGHALHVF+NGQL G+ YG L+NPK+T+S +V +RAG+
Sbjct  475   VNIASDEGFLKNGKEPFLTVMSAGHALHVFINGQLSGTVYGGLDNPKLTYSSNVKLRAGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI++LS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDLT Q+W+YK+G+KGE+L+L
Sbjct  535   NKISMLSVAVGLPNVGLHFETWNAGVLGPVTLSGLNEGTRDLTKQRWAYKVGMKGESLNL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEW + SF+ QKQPLTWYK TF+AP GN+PLALDM +MGKGQ+WING+ IGR
Sbjct  595   HTLSGSSSVEWAKDSFLAQKQPLTWYKATFDAPEGNDPLALDMRSMGKGQIWINGEGIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNCG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  655   HWPGYIAQGNCGECNYAGLYSEKKCHTNCGQPSQRWYHVPRSWLKPSGN  703



>gb|AAC77377.1| beta-galactosidase precursor [Carica papaya]
Length=721

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 278/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF +K+  +CAAFLAN+D     +V+F N+ Y+LPPWSVSILPDCK  VFNTA
Sbjct  353   GSNQEAHVFWTKT--SCAAFLANYDLKYSVRVTFQNLPYDLPPWSVSILPDCKTVVFNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYG-DNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +Q S  KM  V+  F+WQSYNEET S   D  FT  GL EQI+ TRDA+DYLWY TD
Sbjct  411   KVVSQGSLAKMIAVNSAFSWQSYNEETPSANYDAVFTKDGLWEQISVTRDATDYLWYMTD  470

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             VTI P E FLK G+ P L V SAGHALHVFVNGQL G+ YG LENPK+ FS  V +RAGV
Sbjct  471   VTIGPDEAFLKNGQDPILTVMSAGHALHVFVNGQLSGTVYGQLENPKLAFSGKVKLRAGV  530

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLSIAVGLPN+G  FETWN G+LGPV+L G+N G  D++  KWSYKIGLKGEALSL
Sbjct  531   NKVSLLSIAVGLPNVGLHFETWNAGVLGPVTLKGVNSGTWDMSKWKWSYKIGLKGEALSL  590

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEWV+GS + Q+QPL WYKTTFNAP GN+PLALDMN+MGKGQ+WINGQSIGR
Sbjct  591   HTVSGSSSVEWVEGSLLAQRQPLIWYKTTFNAPVGNDPLALDMNSMGKGQIWINGQSIGR  650

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP  KA G+CG CNYAG +DEKKC   CG+A+ RWYHVPRS+L PT N
Sbjct  651   HWPGYKARGSCGACNYAGIYDEKKCHSNCGKASQRWYHVPRSWLNPTAN  699



>gb|ACC78255.1| beta-galactosidase [Carica papaya]
Length=721

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 278/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF +K+  +CAAFLAN+D     +V+F N+ Y+LPPWSVSILPDCK  VFNTA
Sbjct  353   GSNQEAHVFWTKT--SCAAFLANYDLKYSVRVTFQNLPYDLPPWSVSILPDCKTVVFNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYG-DNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +Q S  KM  V+  F+WQSYNEET S   D  FT  GL EQI+ TRDA+DYLWY TD
Sbjct  411   KVVSQGSLAKMIAVNSAFSWQSYNEETPSANYDAVFTKDGLWEQISVTRDATDYLWYMTD  470

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             VTI P E FLK G+ P L V SAGHALHVFVNGQL G+ YG LENPK+ FS  V +RAGV
Sbjct  471   VTIGPDEAFLKNGQDPILTVMSAGHALHVFVNGQLSGTVYGQLENPKLAFSGKVKLRAGV  530

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLSIAVGLPN+G  FETWN G+LGPV+L G+N G  D++  KWSYKIGLKGEALSL
Sbjct  531   NKVSLLSIAVGLPNVGLHFETWNAGVLGPVTLKGVNSGTWDMSKWKWSYKIGLKGEALSL  590

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEWV+GS + Q+QPL WYKTTFNAP GN+PLALDMN+MGKGQ+WINGQSIGR
Sbjct  591   HTVSGSSSVEWVEGSLLAQRQPLIWYKTTFNAPVGNDPLALDMNSMGKGQIWINGQSIGR  650

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP  KA G+CG CNYAG +DEKKC   CG+A+ RWYHVPRS+L PT N
Sbjct  651   HWPGYKARGSCGACNYAGIYDEKKCHSNCGKASQRWYHVPRSWLNPTAN  699



>ref|XP_009762312.1| PREDICTED: beta-galactosidase-like [Nicotiana sylvestris]
Length=725

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA V++SKSG  CAAFL+N+D     KV+F N  Y+LPPWS+SILPDCK  V+NTA
Sbjct  356   GNNQEAHVYRSKSGN-CAAFLSNYDSKYSVKVTFQNKPYDLPPWSISILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ ++SS +KMT    G +WQSYNEET +  D +T +  GL EQ N TRD+SDYLWY TD
Sbjct  415   KVSSRSSSIKMTSTGSGLSWQSYNEETPTADDSDTLSANGLWEQKNVTRDSSDYLWYMTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVF+NG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  475   VNIASGEGFLKNGKDPYLTVMSAGHVLHVFINGKLSGTVYGTLDNPKLTYSGNVKLRAGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  F+TWN G+LGP++L GLNEGKRDLT Q+WSYK+GLKGE+L L
Sbjct  535   NKISLLSVSVGLPNVGVHFDTWNAGVLGPITLSGLNEGKRDLTKQRWSYKVGLKGESLRL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEW++GS V QKQPLTWYK TFNAP GN+PLALDM +MGKG++WING+ +GR
Sbjct  595   HTLSGSSSVEWIKGSLVAQKQPLTWYKATFNAPGGNDPLALDMASMGKGEIWINGEGVGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  655   HWPGYIAQGDCGKCNYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  703



>ref|XP_011077976.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=729

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QE  VF+SKSG ACAAFL+N+D     K++F N  Y LPPWS+SILPDCK  V+NTA
Sbjct  360   GKNQEVHVFRSKSG-ACAAFLSNYDPTYSTKLTFQNRQYELPPWSISILPDCKTEVYNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI ++ S  KM PVS G +WQSY+EET S  D +T  + GL EQ+N TRD+SDYLWY T 
Sbjct  419   RISSKGSTAKMVPVSGGLSWQSYSEETPSADDRDTLAMQGLWEQVNVTRDSSDYLWYLTQ  478

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P EGFLK G+WP L   SAGHALHVFVNG+L G+ YG L+NPK+T++  VN+RAGV
Sbjct  479   VNIAPNEGFLKSGQWPVLTAMSAGHALHVFVNGKLSGTVYGGLDNPKLTYTGYVNLRAGV  538

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  +E WN G+LGPV+L GLNEG RDLT Q WSYK+GLKGEAL+L
Sbjct  539   NKISLLSVAVGLPNVGLHYERWNAGVLGPVTLKGLNEGTRDLTKQSWSYKVGLKGEALTL  598

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
              ++TGSSSVEWV+GS + QKQPLTWYKTTFNAP GN+P+ALDM +MGKG++W+NG+SIGR
Sbjct  599   DNVTGSSSVEWVEGSLLAQKQPLTWYKTTFNAPQGNDPVALDMISMGKGEIWVNGESIGR  658

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG F EKKC   CG+ + RWYH+PRS+L+P+GN
Sbjct  659   HWPGYTAKGSCGGCNYAGTFTEKKCQSGCGQPSQRWYHIPRSWLKPSGN  707



>ref|XP_009407297.1| PREDICTED: beta-galactosidase 2 [Musa acuminata subsp. malaccensis]
Length=836

 Score =   484 bits (1245),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 279/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+SQE+RVF+S SG  CAAFLAN+D  SYA+V+F  MHY+LPPWS+SILPDC+ TV+NTA
Sbjct  365   GSSQESRVFRSNSGD-CAAFLANYDTSSYARVAFNGMHYDLPPWSISILPDCRTTVYNTA  423

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G Q+SQ++M  V  GF+W SYNE+T +  +  FT  GLLEQ+N TRD +DYLWY T V
Sbjct  424   RVGVQTSQIRMDSVG-GFSWASYNEDTNAIDEEAFTTDGLLEQVNVTRDTTDYLWYMTYV  482

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID  E FL  G++P L V SAGH+LHVF+NGQ  G+ YGSL+NPK+T++ +V +RAG N
Sbjct  483   NIDQDEQFLLTGQYPVLTVMSAGHSLHVFINGQPTGTVYGSLDNPKLTYAGNVKLRAGSN  542

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I++LS++VGLPN+G  FETWN G+LGPV L GLNEG+RDLTWQKWSY+IGL+GE L+LH
Sbjct  543   TISILSVSVGLPNVGEHFETWNAGVLGPVMLKGLNEGRRDLTWQKWSYQIGLRGETLNLH  602

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW + S   + QPLTWYK  FNAP GNEPLALDM++MGKGQVWINGQSIGRY
Sbjct  603   SLSGSSSVEWQEAS---RNQPLTWYKAFFNAPDGNEPLALDMSSMGKGQVWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP   A G+CG C+Y G +DEKKC   CGE + +WYHVPRS+L PTGN
Sbjct  660   WPGYMAYGSCGDCDYRGTYDEKKCQTNCGEPSQKWYHVPRSWLNPTGN  707



>gb|KHN06610.1| Beta-galactosidase [Glycine soja]
Length=831

 Score =   483 bits (1243),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 276/349 (79%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+ E  VFK+   GACAAFLAN+D  S A V FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  353   GNNLEVHVFKTS--GACAAFLANYDTKSSAAVKFGNGQYDLPPWSISILPDCKTAVFNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYG-DNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS MKMT V+  F WQSYNEE  S   D++ T   L EQIN TRD++DYLWY TD
Sbjct  411   RLGAQSSLMKMTAVNSAFDWQSYNEEAASSNEDDSLTAYALWEQINVTRDSTDYLWYMTD  470

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGF+K G+ P L V SAGHALHVF+NGQL G+ YG L++ K+TFS SV +R G 
Sbjct  471   VNIDANEGFIKNGQSPVLTVMSAGHALHVFINGQLSGTVYGGLDSHKLTFSDSVKLRVGN  530

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSI VGLPN+GP FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL+L
Sbjct  531   NKISLLSITVGLPNVGPHFETWNAGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNL  590

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEWVQGS + +KQPLTWYKTTF+ P GN+PLALDM +MGKGQVWING+SIGR
Sbjct  591   NTVSGSSSVEWVQGSLLTKKQPLTWYKTTFSTPAGNDPLALDMISMGKGQVWINGRSIGR  650

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C YAG + +KKC   CGE + RWYH+PRS+L P+GN
Sbjct  651   HWPGYIARGSCGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGN  699



>gb|KJB65167.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=843

 Score =   483 bits (1242),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 233/350 (67%), Positives = 281/350 (80%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKSG ACAAFLAN+D     KV+FG+ HY LP WS++ILPDCK  VFNTA
Sbjct  363   GSNQEAHVFKSKSG-ACAAFLANYDTKYSVKVTFGSAHYELPRWSITILPDCKTAVFNTA  421

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTV-VGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS+ KM   +  F+WQSYNEE+ S  D   TV  GL EQI  TRDA+DYLWY TD
Sbjct  422   RLGAQSSEKKMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTD  481

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFL+ G+ P L ++SAGHALHVF+NGQL G+ YG LENPK+TFS +V +RAG+
Sbjct  482   VQIDSDEGFLRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGI  541

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYK-IGLKGEALS  714
             NK+ LLS+AVGL N+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK IGLKGEAL 
Sbjct  542   NKVTLLSVAVGLSNVGTHFETWNVGVLGPVTLKGLNEGTRDLSKQKWSYKQIGLKGEALK  601

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LH++ GSSSVEWV+GS +V+KQP+TWYKTTF+AP GNEPL LDM++MGKGQ+WINGQSIG
Sbjct  602   LHTVAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQLWINGQSIG  661

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WP   A GNC  C+YAG + ++KC   CGE + RWYHVPRS+L+P+GN
Sbjct  662   RHWPGYIAHGNCYACDYAGTYSDQKCRTNCGEPSQRWYHVPRSWLKPSGN  711



>ref|XP_006451460.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64700.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=767

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 279/379 (74%), Gaps = 32/379 (8%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQL-------------------------  462
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL                         
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGKRSIMTDMIMFLGANIACQQLTF  546

Query  463   -----VGSAYGSLENPKVTFSKSVNMRAGVNKIALLSIAVGLPNIGPRFETWNTGILGPV  627
                   G+ YGSLENPK+TFSK+V +R GVNKI+LLS +VGLPN+G  FE WN G+LGPV
Sbjct  547   SFYPYAGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLGPV  606

Query  628   SLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTF  807
             +L GLNEG RD++ QKW+YKIGLKGEALSLH+++GSSSVEW QG+ + QKQP+TWYKTTF
Sbjct  607   TLKGLNEGTRDISKQKWTYKIGLKGEALSLHTISGSSSVEWAQGASLAQKQPMTWYKTTF  666

Query  808   NAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPANKASGNCGVCNYAGWFDEKKCLRKCG  987
             N PPGN+PLALDM  MGKG VWINGQSIGR+WP    +GNCG CNYAG + EKKC   CG
Sbjct  667   NVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCRTYCG  726

Query  988   EATXRWYHVPRSFLRPTGN  1044
             + + RWYHVPRS+L+P+GN
Sbjct  727   KPSQRWYHVPRSWLKPSGN  745



>ref|NP_001043405.1| Os01g0580200 [Oryza sativa Japonica Group]
 sp|Q8W0A1.1|BGAL2_ORYSJ RecName: Full=Beta-galactosidase 2; Short=Lactase 2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB84455.1| putative beta-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF05319.1| Os01g0580200 [Oryza sativa Japonica Group]
 dbj|BAG95853.1| unnamed protein product [Oryza sativa Japonica Group]
Length=827

 Score =   481 bits (1239),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 231/348 (66%), Positives = 282/348 (81%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q++ VF+S S GACAAFL N D+ SYA+V+F  MHY+LPPWS+SILPDCK TVFNTA
Sbjct  356   GNAQKSSVFRS-STGACAAFLENKDKVSYARVAFNGMHYDLPPWSISILPDCKTTVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G+Q SQMKM   + GFAWQSYNEE  S+G++  T VGLLEQIN TRD +DYLWYTT V
Sbjct  415   RVGSQISQMKME-WAGGFAWQSYNEEINSFGEDPLTTVGLLEQINVTRDNTDYLWYTTYV  473

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              +   E FL  G+   L V SAGHALH+F+NGQL G+ YGS+++PK+T++ +V + AG N
Sbjct  474   DVAQDEQFLSNGENLKLTVMSAGHALHIFINGQLKGTVYGSVDDPKLTYTGNVKLWAGSN  533

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+Y++GLKGE++SLH
Sbjct  534   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYQVGLKGESMSLH  593

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW +    VQKQPLTWYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  594   SLSGSSTVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  650

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG C+Y G +DE KC   CG+++ RWYHVPRS+L PTGN
Sbjct  651   WPGYKASGNCGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGN  698



>ref|XP_009757671.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   482 bits (1240),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 280/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF+SKSG  CAAFL+N+D     KV+F    Y+LPPWS+SILPDCK  V+NTA
Sbjct  358   GKNQEAHVFRSKSGD-CAAFLSNYDTKYSVKVTFQTTQYDLPPWSISILPDCKTAVYNTA  416

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI +QSSQM M PV    +WQSY+EET S  + +T +  GLLEQIN TRD+SDYLWY TD
Sbjct  417   RISSQSSQMMMAPVVGSLSWQSYSEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTD  476

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V + P EGFLK GK P+L V SAGHA+HVF+NGQL G+ YG L+NPK+T+S +V +RAG+
Sbjct  477   VNVGPDEGFLKNGKDPFLTVMSAGHAMHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGI  536

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FE+WNTG+LGPV+L GLN+G RDLT Q+WSYK+GLKGE+LS 
Sbjct  537   NKISLLSVAVGLPNVGLHFESWNTGVLGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSF  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR
Sbjct  597   HTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGR  656

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  657   HWPGYIAKGHCGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  705



>gb|KDO57762.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=767

 Score =   479 bits (1234),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 279/379 (74%), Gaps = 32/379 (8%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQL-------------------------  462
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL                         
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGKRSIMTDMIMFLGANIACQQLTF  546

Query  463   -----VGSAYGSLENPKVTFSKSVNMRAGVNKIALLSIAVGLPNIGPRFETWNTGILGPV  627
                   G+ YGSLENPK+TFSK+V +R GVNKI+LLS +VGLPN+G  FE WN G+LGPV
Sbjct  547   SFYPYAGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFEKWNAGVLGPV  606

Query  628   SLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTF  807
             +L GLNEG RD++ QKW+YKIGLKGEALSLH+++GSSSVEW QG+ + QKQP+TWYKTTF
Sbjct  607   TLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLAQKQPMTWYKTTF  666

Query  808   NAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPANKASGNCGVCNYAGWFDEKKCLRKCG  987
             N PPGN+PLALDM  MGKG VWINGQSIGR+WP    +GNCG CNYAG + EKKC   CG
Sbjct  667   NVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCRTYCG  726

Query  988   EATXRWYHVPRSFLRPTGN  1044
             + + RWYHVPRS+L+P+GN
Sbjct  727   KPSQRWYHVPRSWLKPSGN  745



>gb|EEE54862.1| hypothetical protein OsJ_02342 [Oryza sativa Japonica Group]
Length=839

 Score =   481 bits (1239),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 231/348 (66%), Positives = 282/348 (81%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q++ VF+S S GACAAFL N D+ SYA+V+F  MHY+LPPWS+SILPDCK TVFNTA
Sbjct  368   GNAQKSSVFRS-STGACAAFLENKDKVSYARVAFNGMHYDLPPWSISILPDCKTTVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G+Q SQMKM   + GFAWQSYNEE  S+G++  T VGLLEQIN TRD +DYLWYTT V
Sbjct  427   RVGSQISQMKME-WAGGFAWQSYNEEINSFGEDPLTTVGLLEQINVTRDNTDYLWYTTYV  485

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              +   E FL  G+   L V SAGHALH+F+NGQL G+ YGS+++PK+T++ +V + AG N
Sbjct  486   DVAQDEQFLSNGENLKLTVMSAGHALHIFINGQLKGTVYGSVDDPKLTYTGNVKLWAGSN  545

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+Y++GLKGE++SLH
Sbjct  546   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYQVGLKGESMSLH  605

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW +    VQKQPLTWYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  606   SLSGSSTVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  662

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASGNCG C+Y G +DE KC   CG+++ RWYHVPRS+L PTGN
Sbjct  663   WPGYKASGNCGTCDYRGEYDETKCQTNCGDSSQRWYHVPRSWLSPTGN  710



>ref|XP_009611028.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana tomentosiformis]
Length=837

 Score =   481 bits (1238),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF+SKSG  C+AFL+N+D     KV+F N+ Y+LPPWS+SILPDCK  V+NTA
Sbjct  356   GKNQEAHVFRSKSGD-CSAFLSNYDTKYSVKVTFQNIQYDLPPWSISILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI +QSSQM M PV    +WQSYNEET S  + +T +  GLLEQIN TRD+SDYLWY TD
Sbjct  415   RISSQSSQMMMAPVVGSLSWQSYNEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V +   EGFLK GK P+L V SAGHA+HVF+NGQ  G+ YG L+NPK+T+S +V +RAG 
Sbjct  475   VNVGSDEGFLKNGKDPFLTVMSAGHAMHVFINGQQSGTVYGGLDNPKLTYSGNVKLRAGT  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FETWNTG+LGPV+L GLNEG RDLT Q+WSYK+GLKGE+LS 
Sbjct  535   NKISLLSVAVGLPNVGLHFETWNTGVLGPVTLSGLNEGTRDLTIQRWSYKVGLKGESLSF  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR
Sbjct  595   HTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  655   HWPGYIAKGHCGECNYAGDYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  703



>ref|XP_009599425.1| PREDICTED: beta-galactosidase-like [Nicotiana tomentosiformis]
Length=725

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF+SKSG  CAAFL+N+D     KV+F N  Y+LPPWS+SILPDCK  V+NTA
Sbjct  356   GSNQEAHVFRSKSGN-CAAFLSNYDSKYAVKVTFQNKPYDLPPWSISILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ ++SS +KMT    G +WQSYNEET +  D +T +  GL EQ N TRD+SDYLWY TD
Sbjct  415   KVSSRSSSIKMTSTGGGLSWQSYNEETPTADDSDTLSANGLWEQKNVTRDSSDYLWYMTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVF+NG+L G+ YG+L++PK+T+S +V +RAG+
Sbjct  475   VNIASDEGFLKNGKDPYLTVMSAGHVLHVFINGKLSGTVYGTLDSPKLTYSGNVKLRAGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  F+TWN G+LGPV+L GLNEGKRDL  Q+WSYK+GLKGE+LSL
Sbjct  535   NKISLLSVSVGLPNVGVHFDTWNAGVLGPVTLSGLNEGKRDLAKQRWSYKVGLKGESLSL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEW++GS V QKQPLTWYK TFNAP G++PLALDM +MGKG++WING+ +GR
Sbjct  595   HTLSGSSSVEWIKGSLVAQKQPLTWYKATFNAPGGSDPLALDMASMGKGEIWINGEGVGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G CG CNYAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  655   HWPGYIAQGECGKCNYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  703



>ref|XP_010047575.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW79521.1| hypothetical protein EUGRSUZ_C00898 [Eucalyptus grandis]
Length=874

 Score =   480 bits (1236),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VF ++SG ACAAFLAN+D +   KV+F    Y+LPPWSVSILPDCK  VFNTA
Sbjct  374   GNKQEAHVFTAESG-ACAAFLANYDPNYSVKVTFRGRQYDLPPWSVSILPDCKTAVFNTA  432

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQSS MKMTP+ + F+WQSYNEET S  D +T  + GLLEQIN TRDASDYLWY TD
Sbjct  433   RIGAQSSLMKMTPLGKTFSWQSYNEETPSADDSDTTEMEGLLEQINITRDASDYLWYMTD  492

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + I+P E FLK G++P L V+SAGHALHVF+N QL G+ YG LENPK+TF+ ++ + AG+
Sbjct  493   IVIEPDEAFLKNGQYPVLTVWSAGHALHVFINSQLSGTVYGGLENPKLTFNDNLKLNAGI  552

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLSIAVGLPN+G  FETWN G+LGPV+L GLN G  +LT  KWSYK+GLKGE L L
Sbjct  553   NKLSLLSIAVGLPNVGLHFETWNAGVLGPVTLKGLNSGTWNLTNWKWSYKLGLKGETLGL  612

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEW++GS VV K PLTWYKTTF+AP G++PLALDM++MGKGQ+WINGQSIGR
Sbjct  613   NTISGSSSVEWMKGSSVVLKLPLTWYKTTFDAPEGDDPLALDMSSMGKGQIWINGQSIGR  672

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP+  A G+CG CNYAG F E KC   CG+ + RWYH+PRS+L PT N
Sbjct  673   HWPSYVAGGSCGECNYAGIFVENKCRTNCGQPSQRWYHIPRSWLNPTAN  721



>ref|XP_009757670.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=839

 Score =   479 bits (1232),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 279/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF+SKSG  CAAFL+N+D     KV+F    Y+LPPWS+SILPDCK  V+NTA
Sbjct  358   GKNQEAHVFRSKSGD-CAAFLSNYDTKYSVKVTFQTTQYDLPPWSISILPDCKTAVYNTA  416

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI +QSSQM M PV    +WQSY+EET S  + +T +  GLLEQIN TRD+SDYLWY TD
Sbjct  417   RISSQSSQMMMAPVVGSLSWQSYSEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTD  476

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V +   EGFLK GK P+L V SAGHA+HVF+NGQL G+ YG L+NPK+T+S +V +RAG+
Sbjct  477   VNVGSDEGFLKNGKDPFLTVMSAGHAMHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGI  536

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FE+WNTG+LGPV+L GLN+G RDLT Q+WSYK+GLKGE+LS 
Sbjct  537   NKISLLSVAVGLPNVGLHFESWNTGVLGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSF  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR
Sbjct  597   HTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGR  656

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  657   HWPGYIAKGHCGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  705



>ref|XP_006838689.1| PREDICTED: beta-galactosidase 5 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   478 bits (1231),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 225/351 (64%), Positives = 275/351 (78%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q++ VF S SGG CAAFLAN D  S A+V F N+HYNLPPWS+SILPDC+N VFNTA
Sbjct  354   GSLQQSSVFSSDSGG-CAAFLANFDSRSTARVMFNNVHYNLPPWSISILPDCRNVVFNTA  412

Query  181   RIGAQSSQMKM-TPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             +IG Q+SQM+M    S+ F+W  Y+E+  ++ D+T T VGLLEQ+N TRD +DYLWY T 
Sbjct  413   KIGVQTSQMEMKVSDSETFSWDMYDEDVAAFSDDTITAVGLLEQLNVTRDTTDYLWYMTS  472

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P E FL+ G++P L+V SAGHALHVF+NGQL GSAYGS EN K T+S  +N+RAG 
Sbjct  473   VEISPSESFLQNGQFPVLSVQSAGHALHVFINGQLSGSAYGSRENQKFTYSGGINLRAGT  532

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN GP FETWNTG+LGPV++ GL+EG+RD+TWQKWSY++GLKGE++ L
Sbjct  533   NKISLLSMAVGLPNNGPHFETWNTGVLGPVTIKGLDEGRRDITWQKWSYQVGLKGESMGL  592

Query  718   HSLTGSSSVEWVQGSFVVQK--QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             HS+ G SSVEW++ S V QK  Q LTWYK  F+AP G++PLALDM TM KGQVW+NGQSI
Sbjct  593   HSINGISSVEWIKASLVAQKQQQTLTWYKAYFDAPAGDDPLALDMGTMHKGQVWVNGQSI  652

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYWPA  A G CG C+Y G +   KC   CG  T RWYHVPRS+L+PTGN
Sbjct  653   GRYWPAYLAQGQCGACDYTGTYRPNKCQTGCGHPTQRWYHVPRSWLQPTGN  703



>gb|AFD54987.1| beta-galactosidase [Momordica charantia]
Length=719

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 279/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EARVFKS SG ACAAFLAN+D  + +KVSF N  Y+LPPWS+SIL DCK+ +FNTA
Sbjct  351   GKNLEARVFKSSSG-ACAAFLANYDISTSSKVSFWNTQYDLPPWSISILSDCKSAIFNTA  409

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             RIGAQS+ MKM  VS  F W SY EE  S Y  +T T  GL+EQ+N T D++DYLWY TD
Sbjct  410   RIGAQSAPMKMMLVSS-FWWLSYKEEVASGYATDTTTKDGLVEQVNFTWDSTDYLWYMTD  468

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + IDP E F+K G+WP LN+ SAGH LHVFVNGQL G+ YGSLENPKV FSK VN++AGV
Sbjct  469   IQIDPNEAFIKSGQWPLLNISSAGHVLHVFVNGQLSGTVYGSLENPKVAFSKYVNLKAGV  528

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+ VGLPN+G  FE+WN G+LGPV+L GLNEG RD++  KWS+K+GLKGE ++L
Sbjct  529   NKLSMLSVTVGLPNVGLHFESWNAGVLGPVTLKGLNEGIRDMSGYKWSHKVGLKGENMNL  588

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++ GS+SV+W +GS +VQKQPLTWYKT FN P GNEPLALDM++MGKGQ+WING+SIGR
Sbjct  589   HTIGGSNSVQWAKGSGLVQKQPLTWYKTNFNTPAGNEPLALDMSSMGKGQIWINGRSIGR  648

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA  ASG+CG C+YAG F EKKCL  CG+ + +WYHVPR +L   GN
Sbjct  649   YWPAYAASGSCGKCSYAGIFTEKKCLSNCGQPSQKWYHVPREWLESKGN  697



>ref|XP_009611026.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana tomentosiformis]
Length=839

 Score =   478 bits (1230),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 277/347 (80%), Gaps = 2/347 (1%)
 Frame = +1

Query  7     SQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARI  186
              Q+A VF+SKSG  C+AFL+N+D     KV+F N+ Y+LPPWS+SILPDCK  V+NTARI
Sbjct  360   EQQAHVFRSKSGD-CSAFLSNYDTKYSVKVTFQNIQYDLPPWSISILPDCKTAVYNTARI  418

Query  187   GAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTDVT  363
              +QSSQM M PV    +WQSYNEET S  + +T +  GLLEQIN TRD+SDYLWY TDV 
Sbjct  419   SSQSSQMMMAPVVGSLSWQSYNEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVN  478

Query  364   IDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNK  543
             +   EGFLK GK P+L V SAGHA+HVF+NGQ  G+ YG L+NPK+T+S +V +RAG NK
Sbjct  479   VGSDEGFLKNGKDPFLTVMSAGHAMHVFINGQQSGTVYGGLDNPKLTYSGNVKLRAGTNK  538

Query  544   IALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHS  723
             I+LLS+AVGLPN+G  FETWNTG+LGPV+L GLNEG RDLT Q+WSYK+GLKGE+LS H+
Sbjct  539   ISLLSVAVGLPNVGLHFETWNTGVLGPVTLSGLNEGTRDLTIQRWSYKVGLKGESLSFHT  598

Query  724   LTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYW  903
              +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR+W
Sbjct  599   SSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRHW  658

Query  904   PANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             P   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  659   PGYIAKGHCGECNYAGDYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  705



>ref|XP_007154660.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
 gb|ESW26654.1| hypothetical protein PHAVU_003G137000g [Phaseolus vulgaris]
Length=833

 Score =   478 bits (1229),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 232/349 (66%), Positives = 275/349 (79%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + E  VFK+   GACAAFLAN+D  S A V+F N  Y+LPPWS+SILPDCK  VFNTA
Sbjct  355   GKNLEVHVFKTS--GACAAFLANYDTKSSATVTFENGQYDLPPWSISILPDCKTEVFNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS MKMT V+  F WQSYNEE  +S  D+  T   L EQIN TRD++DYLWY TD
Sbjct  413   RVGAQSSLMKMTAVNTAFDWQSYNEEPASSSEDDPLTAYALWEQINITRDSTDYLWYMTD  472

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGF+K G+ P L V SAGHALHVF+NGQL G+ YG LE PK+TFS  V +R G 
Sbjct  473   VNIDANEGFIKSGQSPVLTVMSAGHALHVFINGQLSGTVYGGLEFPKLTFSDGVKLRVGN  532

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSIAVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL+L
Sbjct  533   NKISLLSIAVGLPNVGTHFETWNAGVLGPVTLNGLNEGTRDLSKQKWSYKIGLKGEALNL  592

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEWVQGS + +KQPLTWYKTTF+ P GN+PLALDM +MGKGQVWING+SIGR
Sbjct  593   NTVSGSSSVEWVQGSLLAKKQPLTWYKTTFSTPVGNDPLALDMISMGKGQVWINGRSIGR  652

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C YAG +++KKC   CGE + RWYH+PRS+L P+GN
Sbjct  653   HWPGYIARGHCGECYYAGTYNDKKCRTNCGEPSQRWYHIPRSWLNPSGN  701



>gb|AAK40304.1| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     +VSF N+ Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GSNQEAHVYRSKSG-ACAAFLSNYDAKYSVRVSFQNLPYDLPPWSISILPDCKTVVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +Q S +KMTP   G +WQSYNE+T +  D +T    GL EQ N TRD+SDYLWY TD
Sbjct  414   KVSSQGSSIKMTPAGGGLSWQSYNEDTPTADDSDTLRANGLWEQRNVTRDSSDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V + AG+
Sbjct  474   VNIASNEGFLKSGKDPYLTVMSAGHVLHVFVNGKLAGTVYGALDNPKLTYSGNVKLNAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG RDL  QKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRDLAKQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEWVQGS V + QPLTWYK TF+AP GNEPLALDM +MGKGQ+WING+ +GR
Sbjct  594   HTLSGSSSVEWVQGSLVARTQPLTWYKATFSAPGGNEPLALDMASMGKGQIWINGEGVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+ +GN
Sbjct  654   HWPGYAAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKTSGN  702



>dbj|BAC10578.2| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     +VSF N+ Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GSNQEAHVYRSKSG-ACAAFLSNYDAKYSVRVSFQNLPYDLPPWSISILPDCKTVVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +Q S +KMTP   G +WQSYNE+T +  D +T    GL EQ N TRD+SDYLWY TD
Sbjct  414   KVSSQGSSIKMTPAGGGLSWQSYNEDTPTADDSDTLRANGLWEQRNVTRDSSDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             + I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V + AG+
Sbjct  474   INIASNEGFLKSGKDPYLTVMSAGHVLHVFVNGKLAGTVYGALDNPKLTYSGNVKLNAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG RDL  QKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRDLAKQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+L+GSSSVEWVQGS V + QPLTWYK TF+AP GNEPLALDM +MGKGQ+WING+ +GR
Sbjct  594   HTLSGSSSVEWVQGSLVARTQPLTWYKATFSAPGGNEPLALDMASMGKGQIWINGEGVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+ +GN
Sbjct  654   HWPGYAAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKTSGN  702



>ref|XP_010049745.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82505.1| hypothetical protein EUGRSUZ_C03897 [Eucalyptus grandis]
Length=722

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 279/349 (80%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFK+  G  CAAFLAN+D     +V+FGN  Y+L PWS+SILPDCK  V+NTA
Sbjct  353   GSNQEAHVFKA--GSRCAAFLANYDTKYSVRVNFGNGQYDLLPWSISILPDCKTAVYNTA  410

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+ A SSQ KM PV  GF+WQSY EET S +G +TFT  GLLEQI+ TRDASDYLWYTTD
Sbjct  411   RVNASSSQNKMVPVG-GFSWQSYVEETVSAFGSDTFTKDGLLEQISLTRDASDYLWYTTD  469

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+ G+ P L + SAGHA+HVF+N +L GS YGSLENPK+++  +V +RAG+
Sbjct  470   ITISPNEAFLRSGQSPVLTILSAGHAMHVFINDELTGSVYGSLENPKLSYGNNVKLRAGI  529

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+++LS+AVGLPN+G  FETWNTG+LGPV+L GL+ G  D++  KW YK+GLKGE LS+
Sbjct  530   NKLSILSVAVGLPNVGLHFETWNTGVLGPVTLKGLDSGTWDMSKWKWCYKVGLKGENLSI  589

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++L+GSSSVEW++ S + Q+QPLTWYK TFNAPPG  PL LDMN+MGKG++WINGQSIGR
Sbjct  590   NTLSGSSSVEWLEDSMLAQRQPLTWYKATFNAPPGRSPLVLDMNSMGKGEIWINGQSIGR  649

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G+CG C+YAG F+E KC   CGEA+ RWYHVPRS+L PTGN
Sbjct  650   HWPAYTARGSCGGCSYAGTFNENKCRSGCGEASQRWYHVPRSWLNPTGN  698



>ref|XP_006451459.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64699.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=702

 Score =   472 bits (1214),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 229/336 (68%), Positives = 266/336 (79%), Gaps = 2/336 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  547   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  607   HTISGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             +WP    +GNCG CNYAG + EKKC   CG+ + RW
Sbjct  667   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRW  702



>gb|KHN17668.1| Beta-galactosidase [Glycine soja]
Length=771

 Score =   474 bits (1220),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 273/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+ E  VFK+   GACAAFLAN+D  S A V FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  293   GNNLEVHVFKTS--GACAAFLANYDTKSSASVKFGNGQYDLPPWSISILPDCKTAVFNTA  350

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS MKMT V+  F WQSYNEE  +S  D++ T   L EQIN TRD++DYLWY TD
Sbjct  351   RLGAQSSLMKMTAVNSAFDWQSYNEEPASSNEDDSLTAYALWEQINVTRDSTDYLWYMTD  410

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGF+K G+ P L V SAGH LHV +N QL G+ YG L++ K+TFS SV +R G 
Sbjct  411   VNIDANEGFIKNGQSPVLTVMSAGHVLHVLINDQLSGTVYGGLDSHKLTFSDSVKLRVGN  470

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL+L
Sbjct  471   NKISLLSIAVGLPNVGPHFETWNAGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNL  530

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEWVQGS + ++QPL WYKTTF+ P GN+PLALDM +MGKGQ WING+SIGR
Sbjct  531   NTVSGSSSVEWVQGSLLAKQQPLAWYKTTFSTPAGNDPLALDMISMGKGQAWINGRSIGR  590

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNCG C YAG + +KKC   CGE + RWYH+PRS+L P+GN
Sbjct  591   HWPGYIARGNCGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGN  639



>gb|KDO57764.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=702

 Score =   471 bits (1213),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 229/336 (68%), Positives = 266/336 (79%), Gaps = 2/336 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF SKSG  CAAFLAN+D    AKVSFGN  Y+LPPWS+S+LPDCK  VFNTA
Sbjct  368   GKNQEAHVFNSKSG-KCAAFLANYDTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTA  426

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QSSQ K  PV   F+WQSY EET +S  DNTFT  GL EQ+  T DASDYLWY TD
Sbjct  427   RVGVQSSQKKFVPVINAFSWQSYIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTD  486

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFLK G+ P L ++SAGHAL VF+NGQL G+ YGSLENPK+TFSK+V +R GV
Sbjct  487   VNIDSNEGFLKNGQDPLLTIWSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGV  546

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS +VGLPN+G  FE WN G+LGPV+L GLNEG RD++ QKW+YKIGLKGEALSL
Sbjct  547   NKISLLSTSVGLPNVGTHFEKWNAGVLGPVTLKGLNEGTRDISKQKWTYKIGLKGEALSL  606

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEW QG+ + QKQP+TWYKTTFN PPGN+PLALDM  MGKG VWINGQSIGR
Sbjct  607   HTVSGSSSVEWAQGASLAQKQPMTWYKTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGR  666

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             +WP    +GNCG CNYAG + EKKC   CG+ + RW
Sbjct  667   HWPGYIGNGNCGGCNYAGTYTEKKCRTYCGKPSQRW  702



>gb|KJB07254.1| hypothetical protein B456_001G011600 [Gossypium raimondii]
Length=701

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 229/336 (68%), Positives = 269/336 (80%), Gaps = 2/336 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKSG ACAAFLAN+D     KV FGN  Y+LP WS+SILPDCK  VFNTA
Sbjct  367   GSKQEAHVFKSKSG-ACAAFLANYDTRYSVKVKFGNGQYDLPRWSISILPDCKTAVFNTA  425

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             +IGA SS+  M PV+  F+WQSY E++ +  D   TV  GL EQI  TRDASDYLWY TD
Sbjct  426   KIGAHSSKKAMVPVNSAFSWQSYTEQSPTADDREATVHNGLWEQIYLTRDASDYLWYMTD  485

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V IDP EGFLKG + P L V+SAGHALHVF NGQL G+ YG L+NPK+TFS +V +RAG+
Sbjct  486   VKIDPNEGFLKGRQGPILTVWSAGHALHVFTNGQLSGTVYGGLDNPKLTFSNNVKLRAGI  545

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N+I+LLS+AVGLPN G  FETWN G+LGPV+L GLNEG RD++ Q WSYKIGLKGEAL+L
Sbjct  546   NRISLLSVAVGLPNFGTHFETWNAGVLGPVTLKGLNEGTRDISKQNWSYKIGLKGEALNL  605

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWVQGS +V+KQP+TWYKTTFNAP GNEPLALDM++MGKGQVWINGQSIGR
Sbjct  606   HTVTGSSSVEWVQGSQLVKKQPMTWYKTTFNAPRGNEPLALDMSSMGKGQVWINGQSIGR  665

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             +WP   A G+CG C+YAG + +KKC   CGE + RW
Sbjct  666   HWPGYIARGSCGACDYAGTYTDKKCRTNCGEPSQRW  701



>ref|XP_011093727.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=730

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 280/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QE  VF+SKSG ACAAFL+N+D+    K++F N+ Y+LPPWS+SILPDCK  V+NTA
Sbjct  361   GKNQEVHVFRSKSG-ACAAFLSNYDRTYPTKLTFRNIQYDLPPWSISILPDCKTEVYNTA  419

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI + SSQ KM P+S   +WQSYNE+T S  D +T  + GL EQIN TRD+SDYLWY T+
Sbjct  420   RISSMSSQAKMVPISGDLSWQSYNEQTPSADDSDTLAMDGLWEQINVTRDSSDYLWYLTE  479

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK G+WP L V SAGHALHVF+NG L G+ YGSL++ K+T+  +V++RAG+
Sbjct  480   VGIASDEGFLKSGQWPLLTVMSAGHALHVFINGLLSGTVYGSLDSTKLTYGGNVDLRAGI  539

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN G  +E WNTG+LGPV+L GLNEG RDLT Q+WSYK GLKGE+LSL
Sbjct  540   NKISLLSVAVGLPNAGMHYERWNTGVLGPVTLQGLNEGTRDLTKQRWSYKAGLKGESLSL  599

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
              +++GSSSVEW++G  + QKQPLTWYKTTF+AP G++PLA+DM +MGKG++WINGQSIGR
Sbjct  600   DTVSGSSSVEWIEGLLLAQKQPLTWYKTTFDAPEGSDPLAIDMISMGKGEIWINGQSIGR  659

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP  KA G+CG CNYAG F EKKC R C + + RWYH+PRS+L+ +GN
Sbjct  660   HWPGYKAKGSCGECNYAGTFSEKKCQRGCDQPSQRWYHLPRSWLKSSGN  708



>ref|XP_003550633.1| PREDICTED: beta-galactosidase-like [Glycine max]
Length=839

 Score =   475 bits (1222),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 273/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+ E  VFK+   GACAAFLAN+D  S A V FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  361   GNNLEVHVFKTS--GACAAFLANYDTKSSASVKFGNGQYDLPPWSISILPDCKTAVFNTA  418

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS MKMT V+  F WQSYNEE  +S  D++ T   L EQIN TRD++DYLWY TD
Sbjct  419   RLGAQSSLMKMTAVNSAFDWQSYNEEPASSNEDDSLTAYALWEQINVTRDSTDYLWYMTD  478

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGF+K G+ P L V SAGH LHV +N QL G+ YG L++ K+TFS SV +R G 
Sbjct  479   VNIDANEGFIKNGQSPVLTVMSAGHVLHVLINDQLSGTVYGGLDSHKLTFSDSVKLRVGN  538

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLSIAVGLPN+GP FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL+L
Sbjct  539   NKISLLSIAVGLPNVGPHFETWNAGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALNL  598

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             ++++GSSSVEWVQGS + ++QPL WYKTTF+ P GN+PLALDM +MGKGQ WING+SIGR
Sbjct  599   NTVSGSSSVEWVQGSLLAKQQPLAWYKTTFSTPAGNDPLALDMISMGKGQAWINGRSIGR  658

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNCG C YAG + +KKC   CGE + RWYH+PRS+L P+GN
Sbjct  659   HWPGYIARGNCGDCYYAGTYTDKKCRTNCGEPSQRWYHIPRSWLNPSGN  707



>ref|XP_009760185.1| PREDICTED: beta-galactosidase-like isoform X2 [Nicotiana sylvestris]
Length=839

 Score =   475 bits (1222),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 277/349 (79%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +QEA VF+SKSG  CAAFL+N+D     KV+F  M Y+L PWS+SILP CK  V+NTA
Sbjct  358   GKNQEAHVFRSKSGD-CAAFLSNYDTKYSVKVTFQTMQYDLSPWSISILPYCKTAVYNTA  416

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             RI +Q SQM M PV    +WQSY+EET S  + +T +  GLLEQIN TRD+SDYLWY TD
Sbjct  417   RISSQCSQMMMAPVVGSLSWQSYSEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTD  476

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V + P EGFLK GK P+L V SAGHA+HVF+NGQL G+ YG L+NPK+T+S +V +RAG+
Sbjct  477   VNVGPDEGFLKNGKDPFLTVMSAGHAMHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGI  536

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FE+WNTG+LGPV+L GLN+G RDLT Q+WSYK+GLKGE+LS 
Sbjct  537   NKISLLSVAVGLPNVGLHFESWNTGVLGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSF  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR
Sbjct  597   HTSSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGR  656

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
              WP   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  657   QWPGYIAKGHCGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  705



>ref|NP_001266133.1| beta-galactosidase-like [Cicer arietinum]
 emb|CAA06309.1| beta-galactosidase [Cicer arietinum]
Length=730

 Score =   471 bits (1212),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 274/350 (78%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + E  V+K+ S GACAAFLAN+D  S AKV+FGN  Y+LPPWS+SILPDCK  VFNTA
Sbjct  361   GKNLEVHVYKT-STGACAAFLANYDTTSPAKVTFGNGQYDLPPWSISILPDCKTAVFNTA  419

Query  181   RIGAQSS-QMKMTPVSQGFAWQSYNEETTSYG-DNTFTVVGLLEQINTTRDASDYLWYTT  354
             ++G   S   KMTPVS  F WQSYNE   S G D++ T   LLEQI  TRD+SDYLWY T
Sbjct  420   KVGTVPSFHRKMTPVSSAFDWQSYNEAPASSGIDDSTTANALLEQIKVTRDSSDYLWYMT  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             DV I P EGF+K G++P L   SAGH LHVFVNGQ  G+AYG LENPK+TFS SV +R G
Sbjct  480   DVNISPNEGFIKNGQYPVLTAMSAGHVLHVFVNGQFSGTAYGGLENPKLTFSNSVKLRVG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKI+LLS+AVGL N+G  +ETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGE L+
Sbjct  540   NNKISLLSVAVGLSNVGLHYETWNVGVLGPVTLKGLNEGTRDLSGQKWSYKIGLKGETLN  599

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             LH+L GSSSV+W +GS +V+KQPLTWYK TF+AP GN+PLALDM++MGKG++W+NG+SIG
Sbjct  600   LHTLIGSSSVQWTKGSSLVKKQPLTWYKATFDAPAGNDPLALDMSSMGKGEIWVNGESIG  659

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA  A G+CG CNYAG F +KKC   CG+ T +WYH+PRS++ P GN
Sbjct  660   RHWPAYIARGSCGGCNYAGTFTDKKCRTSCGQPTQKWYHIPRSWVNPRGN  709



>emb|CDX76254.1| BnaA04g05180D [Brassica napus]
Length=588

 Score =   466 bits (1198),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSK+  +CAAFL+N+D    AKV F    Y+LPPWS+SILPDCK    NTA
Sbjct  219   GNKQEAHVFKSKT--SCAAFLSNYDTSYPAKVMFRGFPYDLPPWSISILPDCKTEYHNTA  276

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I + S  MKM P S   +W+SYNE   S GD  TF   GLLEQI+ TRD +DY WY TD
Sbjct  277   KIRSPSILMKMVPTSTRLSWESYNEAIPSSGDYGTFARDGLLEQISMTRDKTDYFWYLTD  336

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   EGFLK G+ P L + SAGHALHVFVNGQL G++YG+L +PK+TFS+ + +R GV
Sbjct  337   ITISSNEGFLKTGEDPLLTICSAGHALHVFVNGQLAGTSYGALSSPKLTFSQRIKLREGV  396

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+A+LS AVGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  397   NKLAILSTAVGLPNAGVHYETWNTGVLGPATLNGVNSGAWDMSKWKWSYKIGTKGEAMSL  456

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSSSVEW +GSFV  KQPLTWYK++FNAP GNEP+ALDMNTMGKGQVW+NG++IGR
Sbjct  457   HTTTGSSSVEWTEGSFVAVKQPLTWYKSSFNAPVGNEPIALDMNTMGKGQVWVNGRNIGR  516

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG + EKKCL  CG+++ RWYHVPRS+L+P+GN
Sbjct  517   HWPAYTAHGNCGRCNYAGIYSEKKCLSNCGQSSQRWYHVPRSWLKPSGN  565



>ref|XP_010062625.1| PREDICTED: beta-galactosidase 1 [Eucalyptus grandis]
Length=825

 Score =   473 bits (1218),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 226/348 (65%), Positives = 270/348 (78%), Gaps = 13/348 (4%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS SG ACAAFLAN++Q S+AKVSFG+MHYNLPPWS+SILPDCKNTV+NTA
Sbjct  356   GIYQEAHVFKSDSG-ACAAFLANYNQWSFAKVSFGSMHYNLPPWSISILPDCKNTVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSS MKMTPV   F+W+ Y+E + +Y D++FT+ GLLEQINTTRD +DYLWY TDV
Sbjct  415   RVGAQSSHMKMTPVDGNFSWEVYSEASAAYEDSSFTMTGLLEQINTTRDVTDYLWYMTDV  474

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              +DP E FLK G +P L V SAGHALHVFVNG+L G++Y            S+ +   +N
Sbjct  475   DVDPNEEFLKSGSYPVLTVLSAGHALHVFVNGELAGNSY------------SLRLLVPLN  522

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              ++     + + N+G  FETWN GILGPV+L GLN+G RDL+WQ WSY +GLKGEA+ LH
Sbjct  523   DLSSFLHCLNVTNVGVHFETWNAGILGPVTLSGLNDGWRDLSWQNWSYAVGLKGEAMGLH  582

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GS SVEW Q S V +KQPLTWYKT FNAP G+ PLALDM++M KGQVWINGQS+GRY
Sbjct  583   SLSGSVSVEWAQESLVAEKQPLTWYKTIFNAPGGSAPLALDMDSMSKGQVWINGQSLGRY  642

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KASG C  CNY G F+E KCL  CGEA+ RWYH+PRS+L PTGN
Sbjct  643   WPAYKASGTCNSCNYTGTFNENKCLSNCGEASQRWYHIPRSWLYPTGN  690



>dbj|BAB83260.1| beta-D-galactosidase [Persea americana]
Length=766

 Score =   471 bits (1213),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 275/349 (79%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+SQEA VFK +SG AC+AFL N D+ ++ KV+F  M Y LPPWS+SILPDC N V+NT 
Sbjct  367   GDSQEAHVFKFESG-ACSAFLENKDETNFVKVTFQGMQYELPPWSISILPDCVNVVYNTG  425

Query  181   RIGAQSSQMKMTPVSQG-FAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G Q+S M M   S   F+W SYNE+T SY + + T+ GL EQI+ T+D++DYL YTTD
Sbjct  426   RVGTQTSMMTMLSASNNEFSWASYNEDTASYNEESMTIEGLSEQISITKDSTDYLRYTTD  485

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             VTI   EGFLK G++P L V SAGHAL VFVNGQL G+AYGS+ +P++TFS  V + AG 
Sbjct  486   VTIGQNEGFLKNGEYPVLTVNSAGHALQVFVNGQLSGTAYGSVNDPRLTFSGKVKLWAGN  545

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS AVGLPN+G  FETWN G+LGPV+L GLNEGKRDL+ QKWSYK+G+ GEAL L
Sbjct  546   NKISLLSSAVGLPNVGTHFETWNYGVLGPVTLNGLNEGKRDLSLQKWSYKVGVIGEALQL  605

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HS TGSSSVEW  GS   + QP TWYKTTFNAP GN+PLALDMNTMGKGQ+WINGQSIGR
Sbjct  606   HSPTGSSSVEW--GSSTSKIQPFTWYKTTFNAPGGNDPLALDMNTMGKGQIWINGQSIGR  663

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWPA KA+G C  C+Y GW+DEKKC   CGEA+ RWYH+PRS+L PTGN
Sbjct  664   YWPAYKANGKCSACHYTGWYDEKKCGFNCGEASQRWYHIPRSWLNPTGN  712



>tpg|DAA58691.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=655

 Score =   468 bits (1203),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 236/348 (68%), Positives = 279/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q+A VF+S S  AC AFL N D+ SYA+VSF  MHY+LPPWS+SILPDCK TV+NTA
Sbjct  184   GNAQQASVFRS-STDACVAFLENKDKVSYARVSFNGMHYDLPPWSISILPDCKTTVYNTA  242

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
              +G+Q SQMKM   + GF WQSYNE+  S GD +F  VGLLEQIN TRD +DYLWYTT V
Sbjct  243   SVGSQISQMKME-WAGGFTWQSYNEDINSLGDESFATVGLLEQINVTRDNTDYLWYTTYV  301

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FL  GK P L V SAGHALH+FVNGQL G+ YGS+E+PK+T+S +V + +G N
Sbjct  302   DIAQDEQFLSNGKNPMLTVMSAGHALHIFVNGQLTGTVYGSVEDPKLTYSGNVKLWSGSN  361

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+YK+GLKGEALSLH
Sbjct  362   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYKVGLKGEALSLH  421

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW +    VQKQPL+WYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  422   SLSGSSSVEWGE---PVQKQPLSWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  478

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG+C+Y G +DEKKC   CG+++ RWYHVPRS+L PTGN
Sbjct  479   WPGYKASGTCGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGN  526



>ref|NP_001265889.1| beta-galactosidase-like precursor [Cicer arietinum]
 emb|CAA09457.1| beta-galactosidase [Cicer arietinum]
Length=723

 Score =   469 bits (1208),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 266/349 (76%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN  EA V+ S     CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK  VFNTA
Sbjct  355   GNKLEAHVY-STGTSVCAAFLANYDTKSAATVTFGNGKYDLPPWSVSILPDCKTDVFNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETT-SYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++GAQSSQ  M   +  F WQSY EE   S  D++ T   L EQIN TRD+SDYLWY TD
Sbjct  414   KVGAQSSQKTMISTNSTFDWQSYIEEPAFSSEDDSITAEALWEQINVTRDSSDYLWYLTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P E F+K G++P LNV SAGH LHVFVNGQL G+ YG L+NPK+TFS SVN+  G 
Sbjct  474   VNISPNEDFIKNGQYPILNVMSAGHVLHVFVNGQLSGTVYGVLDNPKLTFSNSVNLTVGN  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+WQKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVAVGLPNVGLHFETWNVGVLGPVTLKGLNEGTRDLSWQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TG SSV+W QGS + +KQPLTWYK TFNAP GN+PL LDM++MGKG++W+N QSIGR
Sbjct  594   HTITGGSSVDWTQGSLLAKKQPLTWYKATFNAPAGNDPLGLDMSSMGKGEIWVNDQSIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG F   KC   CG  T  WYH+PRS+L PTGN
Sbjct  654   HWPGYIAHGSCGDCDYAGTFTNTKCRTNCGNPTQTWYHIPRSWLNPTGN  702



>ref|XP_009148744.1| PREDICTED: beta-galactosidase 2 isoform X2 [Brassica rapa]
Length=539

 Score =   463 bits (1191),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSK+  +CAAFL+N+D    AKV F    Y+LPPWS+SILPDCK    NTA
Sbjct  170   GNKQEAHVFKSKT--SCAAFLSNYDTTYPAKVMFRGFPYDLPPWSISILPDCKTEYHNTA  227

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I + S  MKM P S   +W+SYNE   S GD  TF   GLLEQI+ TRD +DY WY TD
Sbjct  228   KIRSPSILMKMVPTSTRLSWESYNEAIPSSGDYGTFARDGLLEQISMTRDKTDYFWYLTD  287

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   EGFLK G+ P L + SAGHALHVFVNGQL G++YG+L +PK+TFS+ + +R GV
Sbjct  288   ITISSNEGFLKTGEDPLLTICSAGHALHVFVNGQLAGTSYGALSSPKLTFSQRIKLREGV  347

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+A+L+ AVGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  348   NKLAILNTAVGLPNAGVHYETWNTGVLGPATLNGVNSGAWDMSKWKWSYKIGTKGEAMSL  407

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSSSVEW +GSFV  KQPLTWYK++FNAP GNEP+ALDMNTMGKGQVW+NG++IGR
Sbjct  408   HTTTGSSSVEWTEGSFVAVKQPLTWYKSSFNAPVGNEPIALDMNTMGKGQVWVNGRNIGR  467

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG + EKKCL  CG+++ RWYHVPRS+L+P+GN
Sbjct  468   HWPAYTAHGNCGRCNYAGIYSEKKCLSNCGQSSQRWYHVPRSWLKPSGN  516



>ref|XP_006646030.1| PREDICTED: beta-galactosidase 2-like [Oryza brachyantha]
Length=827

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/348 (68%), Positives = 285/348 (82%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q++ VFKS S GACAAFL N D+ SYA+V+F  MHY+LPPWS+SILPDCK TVFNTA
Sbjct  356   GNAQKSSVFKS-STGACAAFLENKDKVSYARVAFNGMHYDLPPWSISILPDCKTTVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G+Q SQMKM   + GFAWQSYNEE  S+ ++ FT VGLLEQIN TRD +DYLWYTT+V
Sbjct  415   RVGSQISQMKME-WAGGFAWQSYNEEINSFDEDPFTTVGLLEQINVTRDNTDYLWYTTNV  473

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ++  E FL  G+ P L V SAGHALHVF+NGQL G+ YGS++NPK+T++ +V + AG N
Sbjct  474   DVEQDEQFLSNGENPKLTVMSAGHALHVFINGQLTGTVYGSVDNPKLTYTGNVKLWAGSN  533

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+Y++GLKGE+LSLH
Sbjct  534   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYQVGLKGESLSLH  593

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW +    VQKQPLTWYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  594   SLSGSSTVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  650

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KA+GNCG C+Y G +DE KC   CG+++ RWYHVPRS+L PTGN
Sbjct  651   WPGYKATGNCGTCDYRGEYDESKCQTNCGDSSQRWYHVPRSWLNPTGN  698



>sp|P48981.1|BGAL_MALDO RecName: Full=Beta-galactosidase; AltName: Full=Acid beta-galactosidase; 
Short=Lactase; AltName: Full=Exo-(1-->4)-beta-D-galactanase; 
Flags: Precursor [Malus domestica]
 gb|AAA62324.1| b-galactosidase-related protein; putative [Malus domestica]
Length=731

 Score =   468 bits (1205),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 281/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKS+S   CAAFLAN+D     KVSFG   Y+LPPWS+SILPDCK  V+NTA
Sbjct  356   GSNQEAHVFKSESD--CAAFLANYDAKYSVKVSFGGGQYDLPPWSISILPDCKTEVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSY-NEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G+QSSQ++MTPV  GF WQS+  E T+S   +T T+ GL EQIN TRD +DYLWY TD
Sbjct  414   KVGSQSSQVQMTPVHSGFPWQSFIEETTSSDETDTTTLDGLYEQINITRDTTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK P L +FSAGHAL+VF+NGQL G+ YGSLENPK++FS++VN+R+G+
Sbjct  474   ITIGSDEAFLKNGKSPLLTIFSAGHALNVFINGQLSGTVYGSLENPKLSFSQNVNLRSGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP++L GLN G  D++  KW+YK GLKGEAL L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNAGVLGPITLKGLNSGTWDMSGWKWTYKTGLKGEALGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+G  + +KQPLTWYK TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVEWVEGPSMAEKQPLTWYKATFNAPPGDAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG +D+KKC   CGE + RWYH+PRS+L PTGN
Sbjct  654   HWPGYIARGSCGDCSYAGTYDDKKCRTHCGEPSQRWYHIPRSWLTPTGN  702



>ref|XP_009760184.1| PREDICTED: beta-galactosidase-like isoform X1 [Nicotiana sylvestris]
Length=841

 Score =   472 bits (1214),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 219/347 (63%), Positives = 275/347 (79%), Gaps = 2/347 (1%)
 Frame = +1

Query  7     SQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARI  186
              Q+A VF+SKSG  CAAFL+N+D     KV+F  M Y+L PWS+SILP CK  V+NTARI
Sbjct  362   EQQAHVFRSKSGD-CAAFLSNYDTKYSVKVTFQTMQYDLSPWSISILPYCKTAVYNTARI  420

Query  187   GAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTDVT  363
              +Q SQM M PV    +WQSY+EET S  + +T +  GLLEQIN TRD+SDYLWY TDV 
Sbjct  421   SSQCSQMMMAPVVGSLSWQSYSEETPSAEESDTLSANGLLEQINITRDSSDYLWYMTDVN  480

Query  364   IDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNK  543
             + P EGFLK GK P+L V SAGHA+HVF+NGQL G+ YG L+NPK+T+S +V +RAG+NK
Sbjct  481   VGPDEGFLKNGKDPFLTVMSAGHAMHVFINGQLSGTVYGGLDNPKLTYSGNVKLRAGINK  540

Query  544   IALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHS  723
             I+LLS+AVGLPN+G  FE+WNTG+LGPV+L GLN+G RDLT Q+WSYK+GLKGE+LS H+
Sbjct  541   ISLLSVAVGLPNVGLHFESWNTGVLGPVTLSGLNDGTRDLTIQRWSYKVGLKGESLSFHT  600

Query  724   LTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYW  903
              +G SSVEWV+GS + Q+QPLTWYK TF+AP GN+P+ALDM +MGKGQ+W+NG+ +GR W
Sbjct  601   SSGGSSVEWVEGSLLAQRQPLTWYKATFDAPEGNDPVALDMVSMGKGQIWVNGEGVGRQW  660

Query  904   PANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             P   A G+CG CNYAG + EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  661   PGYIAKGHCGECNYAGEYTEKKCQTNCGQPSQRWYHVPRSWLKPSGN  707



>ref|XP_008775429.1| PREDICTED: beta-galactosidase 2-like [Phoenix dactylifera]
Length=832

 Score =   471 bits (1212),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 230/348 (66%), Positives = 276/348 (79%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++Q+A V++S+SG  CAAFLAN D  SYAKVSF  MH +LPPWS+SILPDCK TVFNTA
Sbjct  362   GSAQQAYVYRSQSGD-CAAFLANFDSGSYAKVSFNGMHDDLPPWSISILPDCKTTVFNTA  420

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
              +G Q+S M M  V  GF++QSYNEET+SY D +FT VGLLEQ+N TRD SDYLWYTT V
Sbjct  421   MVGFQTSLMNMEWVG-GFSFQSYNEETSSYDDKSFTTVGLLEQVNVTRDNSDYLWYTTYV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK GK+P L V SAGH+L VF+NGQL G+AYGS+E+P++T++ +V +  G N
Sbjct  480   DIGQDEQFLKNGKYPVLTVMSAGHSLLVFINGQLTGTAYGSVEDPRLTYTGNVKLWQGSN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I++LS++VGLPN+G  FETWN G+LGPV+L GLNEG RDLTWQKW+Y+IGLKGE LSL+
Sbjct  540   TISILSVSVGLPNVGEHFETWNAGVLGPVTLNGLNEGTRDLTWQKWTYQIGLKGETLSLY  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL GSS VEW + S   Q  PLTWYK  FNAP GNEPLALDM++MGKGQVWINGQSIGRY
Sbjct  600   SLAGSSFVEWDEAS---QNHPLTWYKAFFNAPEGNEPLALDMSSMGKGQVWINGQSIGRY  656

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KA G C  C+Y G +DEKKC   CGE++ +WYHVPRS+L PTGN
Sbjct  657   WPGYKAYGTCSNCDYRGEYDEKKCQTNCGESSQKWYHVPRSWLNPTGN  704



>ref|XP_003589081.1| Beta-galactosidase [Medicago truncatula]
Length=589

 Score =   462 bits (1190),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 265/345 (77%), Gaps = 2/345 (1%)
 Frame = +1

Query  13    EARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARIGA  192
             EA V+   +   CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK  VFNTA +  
Sbjct  225   EAHVYYVNTS-ICAAFLANYDTKSAATVTFGNGQYDLPPWSVSILPDCKTVVFNTATVNG  283

Query  193   QSSQMKMTPVSQGFAWQSYNEETT-SYGDNTFTVVGLLEQINTTRDASDYLWYTTDVTID  369
              S   +MTPV   F WQSY+EE   S  D++     L EQIN TRD+SDYLWY TDV I 
Sbjct  284   HSFHKRMTPVETTFDWQSYSEEPAYSSDDDSIIANALWEQINVTRDSSDYLWYLTDVNIS  343

Query  370   PREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNKIA  549
             P E F+K G++P L + SAGH LHVFVNGQL G+ YG L+NPKVTFS+SVN++ G NKI+
Sbjct  344   PSESFIKNGQFPTLTINSAGHVLHVFVNGQLSGTVYGGLDNPKVTFSESVNLKVGNNKIS  403

Query  550   LLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLT  729
             LLS+AVGLPN+G  FETWN G+LGPV L GL+EG RDL+WQKWSYK+GLKGE+LSLH++T
Sbjct  404   LLSVAVGLPNVGLHFETWNVGVLGPVRLKGLDEGTRDLSWQKWSYKVGLKGESLSLHTIT  463

Query  730   GSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPA  909
             GSSS++W QGS + +KQPLTWYKTTF+AP GN+P+ALDM++MGKG++WIN QSIGR+WPA
Sbjct  464   GSSSIDWTQGSSLAKKQPLTWYKTTFDAPSGNDPVALDMSSMGKGEIWINDQSIGRHWPA  523

Query  910   NKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
               A GNC  CNYAG F   KC   CGE T +WYH+PRS+L  +GN
Sbjct  524   YIAHGNCDECNYAGTFTNPKCRTNCGEPTQKWYHIPRSWLSSSGN  568



>ref|XP_003595162.1| Beta-galactosidase [Medicago truncatula]
 gb|ABN08770.1| Galactose-binding like [Medicago truncatula]
 gb|AES65413.1| beta-like galactosidase [Medicago truncatula]
Length=726

 Score =   467 bits (1202),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 276/349 (79%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + E  ++K+ S GACAAFLAN+D  S+AKV+FGN HY+LPPWS+SILPDCK  VFNTA
Sbjct  358   GKNLEVHLYKT-SFGACAAFLANYDTGSWAKVAFGNGHYDLPPWSISILPDCKTEVFNTA  416

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A      MTP +  F WQSYNE+    G++ ++T  GLLEQ++ T D SDYLWY TD
Sbjct  417   KVRAPRVHRSMTPANSAFNWQSYNEQPAFSGESGSWTANGLLEQLSQTWDKSDYLWYMTD  476

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I P EGF+K G+ P L   SAGH LHVF+NGQ  G+AYGSL+NPK+TFS SV +R G 
Sbjct  477   VNISPNEGFIKNGQNPVLTAMSAGHVLHVFINGQFWGTAYGSLDNPKLTFSNSVKLRVGN  536

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS+AVGL N+G  +E WN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGE+L+L
Sbjct  537   NKISLLSVAVGLSNVGVHYEKWNVGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGESLNL  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSV+W QGSF+ +KQPLTWYKTTFNAP GN+PLALDM++MGKG++W+NGQSIGR
Sbjct  597   HTTSGSSSVKWTQGSFLSKKQPLTWYKTTFNAPAGNDPLALDMSSMGKGEIWVNGQSIGR  656

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG F +KKC   CG+ T +WYH+PRS+L P+GN
Sbjct  657   HWPAYIARGNCGSCNYAGTFTDKKCRTNCGQPTQKWYHIPRSWLNPSGN  705



>ref|XP_010545348.1| PREDICTED: beta-galactosidase 12-like isoform X1 [Tarenaya hassleriana]
Length=726

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 272/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKSKS  +CAAFL+N+D  S  +V+F  + Y+LPPWSVSILPDCK    NTA
Sbjct  357   GAKQEAHVFKSKS--SCAAFLSNYDPDSAVRVTFWGLPYDLPPWSVSILPDCKTVYHNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A+   M M P    F+W+SYNEET S  D+ TFT+ GL+EQI+ TRD +DYLWY TD
Sbjct  415   KVYAKGVHMNMIPTGVHFSWESYNEETLSGNDDGTFTLNGLVEQISMTRDKTDYLWYFTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK G  P L ++SAGHALHVFVNGQL G+ YGSL+NPK+TFS+ + + AGV
Sbjct  475   ITIGHDEKFLKTGDNPLLTIWSAGHALHVFVNGQLAGTVYGSLDNPKLTFSQKIKLYAGV  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS+AVGL N+G  FETWN G+LGPVSL G+N G  D++  KWSYKIGLKGEALSL
Sbjct  535   NKLALLSVAVGLANVGVHFETWNVGVLGPVSLKGMNSGTWDMSKWKWSYKIGLKGEALSL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TG SS++WV GS V +KQPLTWYK TFN P GNEPLALDMNTMGKGQ+WING++IGR
Sbjct  595   HTVTGDSSLKWVAGSLVAKKQPLTWYKATFNTPAGNEPLALDMNTMGKGQIWINGRNIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNCG C+Y G F EKKCL  CGEA+ RWYHVPRS+L P+GN
Sbjct  655   HWPGYTARGNCGRCSYTGTFTEKKCLSNCGEASQRWYHVPRSWLEPSGN  703



>ref|XP_009408846.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=730

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 223/348 (64%), Positives = 283/348 (81%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA V++SKSG +CAAFL+N + HSYA V+F  M YN+P WS+SILPDCK +VFNTA
Sbjct  365   GNYQEAHVYRSKSG-SCAAFLSNFNPHSYASVTFNGMKYNIPSWSISILPDCKTSVFNTA  423

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             ++GA +SQ+KMT V  GF+W+S++E+T S GDN+FT  GL+EQI+ TRD +DYLWYT+ V
Sbjct  424   KVGAPTSQIKMTWVG-GFSWESFSEDTNSLGDNSFTKDGLVEQISMTRDRTDYLWYTSYV  482

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              ID  E FLK G++P+L V SAGH++HVF+NG+  G+  GSL+NPK+TF ++V + AG N
Sbjct  483   NIDSNEQFLKNGRYPFLTVMSAGHSMHVFINGERAGTVSGSLDNPKLTFRENVKLWAGSN  542

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS+AVGLPN+G  FETWN G+LGPV+L GLNEGKRDL+ QKW Y+IGL+GE+LS+H
Sbjct  543   KISILSVAVGLPNVGNHFETWNAGVLGPVTLEGLNEGKRDLSSQKWIYQIGLRGESLSIH  602

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             +L+GSSSVEW   S    KQPLTWYK  FNAP GNEPLALDM++MGKGQ+WINGQSIGRY
Sbjct  603   TLSGSSSVEWGGAS---TKQPLTWYKAFFNAPAGNEPLALDMSSMGKGQIWINGQSIGRY  659

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WPA KA G+C  C+Y G ++EKKC   CGE + +WYHVPR++L PTGN
Sbjct  660   WPAYKAYGSCDWCDYRGTYNEKKCQTNCGEPSQKWYHVPRAWLNPTGN  707



>ref|XP_006413222.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
 gb|ESQ54675.1| hypothetical protein EUTSA_v10024511mg [Eutrema salsugineum]
Length=737

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 273/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKS  +CAAFL+N++  S A+V FG   Y+LPPWS+SILP+CK   +NTA
Sbjct  358   GDNQEAHVFKSKS--SCAAFLSNYNASSTARVLFGGSTYDLPPWSISILPNCKTEYYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A S  MKM P +  F+W SYNEE  S  DN TF   GL EQI+ TRD +DY WY TD
Sbjct  416   KVNAPSIHMKMVPTNTQFSWGSYNEEIPSPNDNGTFAQDGLAEQISITRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK G+ P L V SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + AGV
Sbjct  476   ITIGTDEKFLKTGEDPLLTVGSAGHALHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHAGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSIA GLPN+G  +ETWNTG+LGP++L G+N G  D++  KWSYKIG KGEALSL
Sbjct  536   NKLALLSIAAGLPNVGVHYETWNTGVLGPITLNGVNSGTWDMSKWKWSYKIGTKGEALSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEW +GS V +KQPLTWYK+TF+ P GNEPLALDMNTMGKGQVWINGQ+IGR
Sbjct  596   HTVTGSSSVEWKEGSLVAKKQPLTWYKSTFDTPAGNEPLALDMNTMGKGQVWINGQNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G C  C+YAG + EKKCL  CGEA+ RWYHVPRS+++P+ N
Sbjct  656   HWPAYTARGKCDRCSYAGTYSEKKCLSNCGEASQRWYHVPRSWVKPSAN  704



>ref|XP_010313633.1| PREDICTED: ss-galactosidase isoform X1 [Solanum lycopersicum]
Length=581

 Score =   461 bits (1185),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  YNLPPWS+SILPDCK  V+NTA
Sbjct  212   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTA  270

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +QSS +KMTP   G +WQSYNEET +  D +T T  GL EQ N TRD+SDYLWY T+
Sbjct  271   QVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTN  330

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  331   VNIASNEGFLKNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  390

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  QKWSYK+GLKGE+LSL
Sbjct  391   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSL  450

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS V QKQPLTWYK TFNAP GN+PLALDM +MGKGQ+WING+ +GR
Sbjct  451   HSLSGSSSVEWVRGSLVAQKQPLTWYKATFNAPGGNDPLALDMASMGKGQIWINGEGVGR  510

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  511   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  559



>gb|KJB65166.1| hypothetical protein B456_010G082900 [Gossypium raimondii]
Length=697

 Score =   464 bits (1193),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 268/336 (80%), Gaps = 2/336 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKSG ACAAFLAN+D     KV+FG+ HY LP WS++ILPDCK  VFNTA
Sbjct  363   GSNQEAHVFKSKSG-ACAAFLANYDTKYSVKVTFGSAHYELPRWSITILPDCKTAVFNTA  421

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTV-VGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS+ KM   +  F+WQSYNEE+ S  D   TV  GL EQI  TRDA+DYLWY TD
Sbjct  422   RLGAQSSEKKMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTD  481

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFL+ G+ P L ++SAGHALHVF+NGQL G+ YG LENPK+TFS +V +RAG+
Sbjct  482   VQIDSDEGFLRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGI  541

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ LLS+AVGL N+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYKIGLKGEAL L
Sbjct  542   NKVTLLSVAVGLSNVGTHFETWNVGVLGPVTLKGLNEGTRDLSKQKWSYKIGLKGEALKL  601

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++ GSSSVEWV+GS +V+KQP+TWYKTTF+AP GNEPL LDM++MGKGQ+WINGQSIGR
Sbjct  602   HTVAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQLWINGQSIGR  661

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRW  1005
             +WP   A GNC  C+YAG + ++KC   CGE + RW
Sbjct  662   HWPGYIAHGNCYACDYAGTYSDQKCRTNCGEPSQRW  697



>ref|NP_001280755.1| beta-galactosidase precursor [Malus domestica]
 gb|AGE44111.1| beta-galactosidase 101 [Malus domestica]
Length=725

 Score =   464 bits (1195),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 274/349 (79%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VF +KSG  CAAFLAN+D     +VSFG   Y+LPPWS+SILPDCK  VFNTA
Sbjct  356   GNNQEAHVFNTKSG--CAAFLANYDTKYPVRVSFGQGQYDLPPWSISILPDCKTAVFNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++  ++SQ++M PV     WQS+ EETT+  ++ T T+ GL EQI  TRDA+DYLWY TD
Sbjct  414   KVTWKTSQVQMKPVYSRLPWQSFIEETTTSDESGTTTLDGLYEQIYMTRDATDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FL  GK+P L +FSA HALHVF+NGQL G+ YGSLENPK+TFS++V +R G+
Sbjct  474   ITIGSDEAFLNNGKFPLLTIFSACHALHVFINGQLSGTVYGSLENPKLTFSQNVKLRPGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP+SL GLN G  D++  KW+YKIG+KGEAL L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNAGVLGPISLKGLNTGTWDMSRWKWTYKIGMKGEALGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSV+W +G  + +KQPLTWYK TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVDWAEGPSMAKKQPLTWYKATFNAPPGHAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG CNYAG F +KKC   CG+ + RWYH+PRS+L PTGN
Sbjct  654   HWPGYIAQGSCGTCNYAGTFYDKKCRTYCGKPSQRWYHIPRSWLTPTGN  702



>ref|XP_002867577.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43836.1| beta-galactosidase 12 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   464 bits (1195),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 227/351 (65%), Positives = 274/351 (78%), Gaps = 6/351 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA+VFKS+S  +CAAFL+N++  S A+VSFG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEAQVFKSQS--SCAAFLSNYNTSSAARVSFGGSTYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSS--QMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYT  351
             ++  ++S   MKM P +  F+W SYNEE  S  DN TF+  GL+EQI+ TRD +DY WY 
Sbjct  416   KVQVRTSSIHMKMVPTNTLFSWGSYNEEIPSANDNGTFSQDGLVEQISITRDKTDYFWYL  475

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TD+TI P E FL G   P LN+ SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + A
Sbjct  476   TDITISPDEKFLTGED-PLLNIGSAGHALHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHA  534

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             GVNK+ALLSIA GLPN+G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG KGEAL
Sbjct  535   GVNKLALLSIAAGLPNVGVHYETWNTGVLGPVTLKGVNSGTWDMSQWKWSYKIGTKGEAL  594

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             S+H++TGSS+VEW QGS V  KQPLTWYK+TF+ P GNEPLALDMNTMGKGQ WINGQ+I
Sbjct  595   SIHTVTGSSTVEWKQGSLVATKQPLTWYKSTFDTPAGNEPLALDMNTMGKGQTWINGQNI  654

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA  A G C  C+YAG F E KCL  CGEA+ RWYHVPRS+L+PT N
Sbjct  655   GRHWPAYTARGKCERCSYAGTFTENKCLSNCGEASQRWYHVPRSWLKPTNN  705



>dbj|BAE72073.1| pear beta-galactosidase1 [Pyrus communis]
Length=731

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 280/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKS+S   CAAFLAN+D     KVSFG   Y+LPPWS+SILPDCK  V+NTA
Sbjct  356   GSNQEAHVFKSESD--CAAFLANYDAKYSVKVSFGGGQYDLPPWSISILPDCKTEVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSY-NEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G+QSSQ++MTPV  GF WQS+  E T+S   +T T+ GL EQIN TRD +DYLWY TD
Sbjct  414   KVGSQSSQVQMTPVHSGFPWQSFIEETTSSDETDTTTLDGLYEQINITRDTTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK P L + SAGHAL+VF+NGQL G+ YGSLENPK++FS++VN+R+G+
Sbjct  474   ITIGSDEAFLKNGKSPLLTISSAGHALNVFINGQLSGTVYGSLENPKLSFSQNVNLRSGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP++L GLN G  D++  KW+YK GLKGEAL L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNAGVLGPITLKGLNSGTWDMSGWKWTYKTGLKGEALGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+G  + +KQPLTWYK TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG +D+KKC   CGE + RWYH+PRS+L PTGN
Sbjct  654   HWPGYIARGSCGDCSYAGTYDDKKCRTHCGEPSQRWYHIPRSWLTPTGN  702



>dbj|BAB21492.1| beta-D-galactosidase [Pyrus pyrifolia]
Length=731

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 280/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKS+S   CAAFLAN+D     KVSFG   Y+LPPWS+SILPDCK  V++TA
Sbjct  356   GSNQEAHVFKSESD--CAAFLANYDAKYSVKVSFGGGQYDLPPWSISILPDCKTEVYSTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSY-NEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G+QSSQ++MTPV  GF WQS+  E T+S   +T T+ GL EQIN TRD +DYLWY TD
Sbjct  414   KVGSQSSQVQMTPVHSGFPWQSFIEETTSSDETDTTTLDGLYEQINITRDTTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK P L +FSAGHAL+VF+NGQL G+ YGSLENPK++FS++VN+R+G+
Sbjct  474   ITIGSDEAFLKNGKSPLLTIFSAGHALNVFINGQLSGTVYGSLENPKLSFSQNVNLRSGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP++L GLN G  D++  KW+YK GLKGEAL L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNAGVLGPITLKGLNSGTWDMSGWKWTYKTGLKGEALGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+G  + +KQPLTWYK TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG +D+KKC   CGE + RWYH+PRS+L P GN
Sbjct  654   HWPGYIARGSCGDCSYAGTYDDKKCRTHCGEPSQRWYHIPRSWLTPNGN  702



>emb|CDX95380.1| BnaC04g27780D [Brassica napus]
Length=727

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 270/349 (77%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSK+  +CAAFL+N+D    AKV F    Y+LPPWS+SILPDCK    NTA
Sbjct  358   GNKQEAHVFKSKT--SCAAFLSNYDTSYAAKVMFRGFPYDLPPWSISILPDCKTEYHNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I + S  MKM P S  F+W+SYNE   S GD  TF   G LEQI+ TRD +DY WY TD
Sbjct  416   KIRSPSILMKMVPTSTRFSWESYNEAIPSSGDYGTFARDGFLEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   EGFLK G+ P L + SAGHALHVFVNGQL G++YG+L +PK+TFS+ + +R GV
Sbjct  476   ITISSNEGFLKTGEDPLLTICSAGHALHVFVNGQLAGTSYGALSSPKLTFSQRIKLREGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+A+LS AVGLP+ G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  536   NKLAILSTAVGLPDAGVHYETWNTGVLGPATLNGVNSGAWDMSKWKWSYKIGTKGEAMSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSSSVEW +GSFV  KQPLTWYK++FNAP GNEPLALDMNTMGKGQVW+NG +IGR
Sbjct  596   HTTTGSSSVEWTEGSFVAVKQPLTWYKSSFNAPVGNEPLALDMNTMGKGQVWVNGHNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
              WPA  A GNCG CNYAG ++EKKCL  CG+++ RWYHVPRS+L+P+GN
Sbjct  656   QWPAYTAHGNCGRCNYAGIYNEKKCLSNCGQSSQRWYHVPRSWLKPSGN  704



>ref|XP_009352652.1| PREDICTED: beta-galactosidase [Pyrus x bretschneideri]
Length=731

 Score =   464 bits (1194),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 280/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKS+S   CAAFLAN+D     KVSFG   Y+LPPWS+SILPDCK  V++TA
Sbjct  356   GSNQEAHVFKSESD--CAAFLANYDAKYSVKVSFGGGQYDLPPWSISILPDCKTEVYSTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSY-NEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G+QSSQ++MTPV  GF WQS+  E T+S   +T T+ GL EQIN TRD +DYLWY TD
Sbjct  414   KVGSQSSQVQMTPVHSGFPWQSFIEETTSSDETDTTTLDGLYEQINITRDTTDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK P L +FSAGHAL+VF+NGQL G+ YGSLENPK++FS++VN+R+G+
Sbjct  474   ITIGSDEAFLKNGKSPLLTIFSAGHALNVFINGQLSGTVYGSLENPKLSFSQNVNLRSGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP++L GLN G  D++  KW+YK GLKGEAL L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNAGVLGPITLKGLNSGTWDMSGWKWTYKTGLKGEALGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+G  + +KQPLTWYK TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVEWVEGPSMAKKQPLTWYKATFNAPPGDAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG +D+KKC   CGE + RWYH+PRS+L P GN
Sbjct  654   HWPGYIARGSCGDCSYAGTYDDKKCRTHCGEPSQRWYHIPRSWLTPNGN  702



>ref|XP_010932916.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=845

 Score =   467 bits (1202),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 280/351 (80%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ +EA VF S+SGG CAAFLAN++ +S+A+V F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  354   GSYEEAHVFSSESGG-CAAFLANYNPNSFARVIFNNMHYNLPPWSISILPDCRNIVFNTA  412

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  SQ   W++Y+E+  S GDN+  T+ GLLEQIN TRDASDYLWY T
Sbjct  413   KVGVQTSQMQMLPANSQSLMWETYDEDVASLGDNSLITIAGLLEQINVTRDASDYLWYIT  472

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V + P EGFL+GG++P L V SAGHALHVFVNGQL GSAYG+ +N ++T++ +VN+ AG
Sbjct  473   SVDVSPAEGFLRGGQFPVLTVQSAGHALHVFVNGQLSGSAYGNRKNRRITYTGNVNLHAG  532

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS+AVGLPN G  +E WNTG+LGPV L G++EGKRDLTWQKWSY++GLKGEA++
Sbjct  533   SNRIALLSVAVGLPNAGVHYELWNTGVLGPVVLHGVDEGKRDLTWQKWSYQVGLKGEAMN  592

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L+SL G+SSVEW++ S V Q+ QPLTWY+  F+AP G++PL LDM +MGKGQ WINGQSI
Sbjct  593   LNSLEGTSSVEWIKESLVSQRQQPLTWYRAYFDAPAGHDPLGLDMGSMGKGQAWINGQSI  652

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW     +G+C  CNYAG +   KC   CG+ T  WYHVPRS+L+PT N
Sbjct  653   GRYWTLLAPNGDCKGCNYAGTYRIPKCQTGCGQPTQLWYHVPRSWLQPTKN  703



>ref|XP_008672351.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA58688.1| TPA: hypothetical protein ZEAMMB73_223728 [Zea mays]
Length=830

 Score =   466 bits (1200),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/348 (68%), Positives = 279/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q+A VF+S S  AC AFL N D+ SYA+VSF  MHY+LPPWS+SILPDCK TV+NTA
Sbjct  359   GNAQQASVFRS-STDACVAFLENKDKVSYARVSFNGMHYDLPPWSISILPDCKTTVYNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
              +G+Q SQMKM   + GF WQSYNE+  S GD +F  VGLLEQIN TRD +DYLWYTT V
Sbjct  418   SVGSQISQMKME-WAGGFTWQSYNEDINSLGDESFATVGLLEQINVTRDNTDYLWYTTYV  476

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FL  GK P L V SAGHALH+FVNGQL G+ YGS+E+PK+T+S +V + +G N
Sbjct  477   DIAQDEQFLSNGKNPMLTVMSAGHALHIFVNGQLTGTVYGSVEDPKLTYSGNVKLWSGSN  536

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+YK+GLKGEALSLH
Sbjct  537   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYKVGLKGEALSLH  596

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW +    VQKQPL+WYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  597   SLSGSSSVEWGE---PVQKQPLSWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  653

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG+C+Y G +DEKKC   CG+++ RWYHVPRS+L PTGN
Sbjct  654   WPGYKASGTCGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGN  701



>ref|XP_009395554.1| PREDICTED: beta-galactosidase 5 [Musa acuminata subsp. malaccensis]
Length=842

 Score =   467 bits (1201),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 275/351 (78%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S+SGG CAAFL+NH+ +S+A+V F NMHYN+PPWS+SILPDC+N VFNTA
Sbjct  351   GSLQQAHVFSSQSGG-CAAFLSNHNPNSFARVMFNNMHYNIPPWSISILPDCRNVVFNTA  409

Query  181   RIGAQSSQMKMTPVS-QGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P++ Q   W+ Y+EE  S  +N+  T  GLLEQIN TRD SDYLWY T
Sbjct  410   KVGVQTSQMQMYPINVQSLMWERYDEEVASLEENSLITTTGLLEQINVTRDTSDYLWYIT  469

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V + P EGFL+G K P L V SAGHALH+FVNGQL GSAYGS E+ ++ FS +VN+RAG
Sbjct  470   SVDVSPAEGFLRGRKRPVLMVESAGHALHIFVNGQLSGSAYGSREDRRIKFSGNVNLRAG  529

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS+AVGLPN G  +E W+TG+LGPV L GL+EG RDLTWQKWSY++GLKGEA++
Sbjct  530   TNRIALLSVAVGLPNAGVHYELWSTGVLGPVVLHGLDEGSRDLTWQKWSYQLGLKGEAMN  589

Query  715   LHSLTGSSSVEWVQGSFVVQ-KQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L+SL G+SSVEW+QGS V Q +QPLTWY+  F+AP GN+PLALDM +MGKG VWINGQSI
Sbjct  590   LNSLEGASSVEWMQGSLVAQNQQPLTWYRAYFDAPDGNDPLALDMGSMGKGHVWINGQSI  649

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW A   S  C  C+Y G +   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  650   GRYWTAYAPSEYCNSCSYRGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRN  700



>ref|XP_009148743.1| PREDICTED: beta-galactosidase 2 isoform X1 [Brassica rapa]
Length=727

 Score =   463 bits (1191),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN QEA VFKSK+  +CAAFL+N+D    AKV F    Y+LPPWS+SILPDCK    NTA
Sbjct  358   GNKQEAHVFKSKT--SCAAFLSNYDTTYPAKVMFRGFPYDLPPWSISILPDCKTEYHNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I + S  MKM P S   +W+SYNE   S GD  TF   GLLEQI+ TRD +DY WY TD
Sbjct  416   KIRSPSILMKMVPTSTRLSWESYNEAIPSSGDYGTFARDGLLEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   EGFLK G+ P L + SAGHALHVFVNGQL G++YG+L +PK+TFS+ + +R GV
Sbjct  476   ITISSNEGFLKTGEDPLLTICSAGHALHVFVNGQLAGTSYGALSSPKLTFSQRIKLREGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+A+L+ AVGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  536   NKLAILNTAVGLPNAGVHYETWNTGVLGPATLNGVNSGAWDMSKWKWSYKIGTKGEAMSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSSSVEW +GSFV  KQPLTWYK++FNAP GNEP+ALDMNTMGKGQVW+NG++IGR
Sbjct  596   HTTTGSSSVEWTEGSFVAVKQPLTWYKSSFNAPVGNEPIALDMNTMGKGQVWVNGRNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG + EKKCL  CG+++ RWYHVPRS+L+P+GN
Sbjct  656   HWPAYTAHGNCGRCNYAGIYSEKKCLSNCGQSSQRWYHVPRSWLKPSGN  704



>ref|XP_006285652.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
 gb|EOA18550.1| hypothetical protein CARUB_v10007108mg [Capsella rubella]
Length=730

 Score =   463 bits (1191),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 277/351 (79%), Gaps = 5/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKS  +CAAFL+N++  S A+VSFG   Y+LPPWSVSILPDCK   +NTA
Sbjct  359   GDKQEAHVFKSKS--SCAAFLSNYNASSAARVSFGGSTYDLPPWSVSILPDCKTEYYNTA  416

Query  181   RIGAQSSQ--MKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYT  351
             ++  ++ +  MKM+P +  F+W+SYNEE  S  DN  F+  GL+EQI+ TRD +DY WY 
Sbjct  417   KVQVRAPRIHMKMSPTNTQFSWESYNEEIPSAYDNGNFSHDGLVEQISITRDKTDYFWYM  476

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TD+TI P E FLK G+ P L + SAGHALHV+VNGQL G+AYGSLE PK+TFS+++ + A
Sbjct  477   TDITISPDETFLKTGEDPLLTIGSAGHALHVYVNGQLAGTAYGSLEQPKLTFSQNIKLHA  536

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             GVNK+ALLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG KGEAL
Sbjct  537   GVNKLALLSTAAGLPNVGLHYETWNTGVLGPVTLKGVNSGTWDMSKWKWSYKIGTKGEAL  596

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             S+H++TGSS+VEW  G  VV+KQPLTWYK+TF+ P GNEPLALDMN+MGKGQ+WINGQ+I
Sbjct  597   SIHTVTGSSTVEWKAGPLVVEKQPLTWYKSTFDTPVGNEPLALDMNSMGKGQIWINGQNI  656

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA  A G C  C+YAG F EKKCL  CGEA+ RWYHVPRS+L+PT N
Sbjct  657   GRHWPAYTARGKCERCSYAGTFTEKKCLSNCGEASQRWYHVPRSWLKPTNN  707



>emb|CAH18936.1| beta-galactosidase [Pyrus communis]
Length=724

 Score =   462 bits (1189),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 280/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKS+S   CAAFLAN+D     KVSFG   Y+LPPWS+SILPDCK  V+NTA
Sbjct  349   GSNQEAHVFKSESD--CAAFLANYDAKYSVKVSFGGGQYDLPPWSISILPDCKTEVYNTA  406

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             ++G+QSSQ++MTPV  GF WQS+ EETTS  +   T + GL EQIN TRD +DYLWY TD
Sbjct  407   KVGSQSSQVQMTPVHSGFPWQSFIEETTSSDETDTTYMDGLYEQINITRDTTDYLWYMTD  466

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK P L + SAGHAL+VF+NGQL G+ YGSLENPK++FS++VN+R+G+
Sbjct  467   ITIGSDEAFLKNGKSPLLTISSAGHALNVFINGQLSGTVYGSLENPKLSFSQNVNLRSGI  526

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWN G+LGP++L GLN G  D++  KW+YK GLKGEAL L
Sbjct  527   NKLALLSISVGLPNVGTHFETWNAGVLGPITLKGLNSGTWDMSGWKWTYKTGLKGEALGL  586

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSVEWV+G  + +KQPLTW+K TFNAPPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  587   HTVTGSSSVEWVEGPSMAKKQPLTWHKATFNAPPGDAPLALDMGSMGKGQIWINGQSVGR  646

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C+YAG +D+KKC   CGE + RWYH+PRS+L PTGN
Sbjct  647   HWPGYIARGSCGDCSYAGTYDDKKCRTHCGEPSQRWYHIPRSWLTPTGN  695



>ref|XP_003589080.1| Beta-galactosidase [Medicago truncatula]
Length=718

 Score =   462 bits (1189),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 265/345 (77%), Gaps = 2/345 (1%)
 Frame = +1

Query  13    EARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARIGA  192
             EA V+   +   CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK  VFNTA +  
Sbjct  354   EAHVYYVNTS-ICAAFLANYDTKSAATVTFGNGQYDLPPWSVSILPDCKTVVFNTATVNG  412

Query  193   QSSQMKMTPVSQGFAWQSYNEETT-SYGDNTFTVVGLLEQINTTRDASDYLWYTTDVTID  369
              S   +MTPV   F WQSY+EE   S  D++     L EQIN TRD+SDYLWY TDV I 
Sbjct  413   HSFHKRMTPVETTFDWQSYSEEPAYSSDDDSIIANALWEQINVTRDSSDYLWYLTDVNIS  472

Query  370   PREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNKIA  549
             P E F+K G++P L + SAGH LHVFVNGQL G+ YG L+NPKVTFS+SVN++ G NKI+
Sbjct  473   PSESFIKNGQFPTLTINSAGHVLHVFVNGQLSGTVYGGLDNPKVTFSESVNLKVGNNKIS  532

Query  550   LLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLT  729
             LLS+AVGLPN+G  FETWN G+LGPV L GL+EG RDL+WQKWSYK+GLKGE+LSLH++T
Sbjct  533   LLSVAVGLPNVGLHFETWNVGVLGPVRLKGLDEGTRDLSWQKWSYKVGLKGESLSLHTIT  592

Query  730   GSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPA  909
             GSSS++W QGS + +KQPLTWYKTTF+AP GN+P+ALDM++MGKG++WIN QSIGR+WPA
Sbjct  593   GSSSIDWTQGSSLAKKQPLTWYKTTFDAPSGNDPVALDMSSMGKGEIWINDQSIGRHWPA  652

Query  910   NKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
               A GNC  CNYAG F   KC   CGE T +WYH+PRS+L  +GN
Sbjct  653   YIAHGNCDECNYAGTFTNPKCRTNCGEPTQKWYHIPRSWLSSSGN  697



>ref|NP_849553.1| beta-galactosidase 12 [Arabidopsis thaliana]
 sp|Q9SCV0.1|BGA12_ARATH RecName: Full=Beta-galactosidase 12; Short=Lactase 12; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB64748.1| putative beta-galactosidase [Arabidopsis thaliana]
 gb|AEE85162.1| beta-galactosidase 12 [Arabidopsis thaliana]
Length=728

 Score =   462 bits (1189),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 273/351 (78%), Gaps = 6/351 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKS  +CAAFL+N++  S A+V FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEAHVFKSKS--SCAAFLSNYNTSSAARVLFGGSTYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSS--QMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYT  351
             ++  ++S   MKM P +  F+W SYNEE  S  DN TF+  GL+EQI+ TRD +DY WY 
Sbjct  416   KVQVRTSSIHMKMVPTNTPFSWGSYNEEIPSANDNGTFSQDGLVEQISITRDKTDYFWYL  475

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TD+TI P E FL G   P L + SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + A
Sbjct  476   TDITISPDEKFLTGED-PLLTIGSAGHALHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHA  534

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             GVNK+ALLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D+T  KWSYKIG KGEAL
Sbjct  535   GVNKLALLSTAAGLPNVGVHYETWNTGVLGPVTLNGVNSGTWDMTKWKWSYKIGTKGEAL  594

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             S+H+L GSS+VEW +GS V +KQPLTWYK+TF++P GNEPLALDMNTMGKGQ+WINGQ+I
Sbjct  595   SVHTLAGSSTVEWKEGSLVAKKQPLTWYKSTFDSPTGNEPLALDMNTMGKGQMWINGQNI  654

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA  A G C  C+YAG F EKKCL  CGEA+ RWYHVPRS+L+PT N
Sbjct  655   GRHWPAYTARGKCERCSYAGTFTEKKCLSNCGEASQRWYHVPRSWLKPTNN  705



>gb|AES59331.2| beta-like galactosidase [Medicago truncatula]
Length=730

 Score =   462 bits (1188),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 265/345 (77%), Gaps = 2/345 (1%)
 Frame = +1

Query  13    EARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTARIGA  192
             EA V+   +   CAAFLAN+D  S A V+FGN  Y+LPPWSVSILPDCK  VFNTA +  
Sbjct  366   EAHVYYVNTS-ICAAFLANYDTKSAATVTFGNGQYDLPPWSVSILPDCKTVVFNTATVNG  424

Query  193   QSSQMKMTPVSQGFAWQSYNEETT-SYGDNTFTVVGLLEQINTTRDASDYLWYTTDVTID  369
              S   +MTPV   F WQSY+EE   S  D++     L EQIN TRD+SDYLWY TDV I 
Sbjct  425   HSFHKRMTPVETTFDWQSYSEEPAYSSDDDSIIANALWEQINVTRDSSDYLWYLTDVNIS  484

Query  370   PREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVNKIA  549
             P E F+K G++P L + SAGH LHVFVNGQL G+ YG L+NPKVTFS+SVN++ G NKI+
Sbjct  485   PSESFIKNGQFPTLTINSAGHVLHVFVNGQLSGTVYGGLDNPKVTFSESVNLKVGNNKIS  544

Query  550   LLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLHSLT  729
             LLS+AVGLPN+G  FETWN G+LGPV L GL+EG RDL+WQKWSYK+GLKGE+LSLH++T
Sbjct  545   LLSVAVGLPNVGLHFETWNVGVLGPVRLKGLDEGTRDLSWQKWSYKVGLKGESLSLHTIT  604

Query  730   GSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRYWPA  909
             GSSS++W QGS + +KQPLTWYKTTF+AP GN+P+ALDM++MGKG++WIN QSIGR+WPA
Sbjct  605   GSSSIDWTQGSSLAKKQPLTWYKTTFDAPSGNDPVALDMSSMGKGEIWINDQSIGRHWPA  664

Query  910   NKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
               A GNC  CNYAG F   KC   CGE T +WYH+PRS+L  +GN
Sbjct  665   YIAHGNCDECNYAGTFTNPKCRTNCGEPTQKWYHIPRSWLSSSGN  709



>ref|XP_008799994.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=845

 Score =   465 bits (1197),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 278/351 (79%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ +EA VF S+SGG CAAFLAN++ +S+A+V F NMHYNLPPWS+SILPDC+N +FNTA
Sbjct  354   GSYEEAHVFSSESGG-CAAFLANYNPNSFARVMFNNMHYNLPPWSISILPDCRNILFNTA  412

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNT-FTVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  SQ   W++Y+E+  S  DNT  T  GLLEQIN TRDASDYLWY T
Sbjct  413   KVGVQTSQMQMLPANSQSLMWETYDEDVASLEDNTPTTAAGLLEQINVTRDASDYLWYIT  472

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V   P EGFL+GG+ P L V SAGHALHVFVNG+L GSAYGS EN + T++ S+N+RAG
Sbjct  473   SVDASPAEGFLRGGQLPVLTVQSAGHALHVFVNGRLSGSAYGSRENRRFTYTGSINLRAG  532

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS++VGLPN+G  +E WNTG+LGPV L G++EGKRDLTWQKWSY++GLKGEA++
Sbjct  533   SNRIALLSVSVGLPNVGVHYELWNTGVLGPVVLHGVDEGKRDLTWQKWSYQVGLKGEAMN  592

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L++L G+SSVEW++ S V QK QPLTWY+  F+AP G++PLALDM +MGKGQ W+NGQSI
Sbjct  593   LNTLEGTSSVEWIKESLVSQKQQPLTWYRAYFDAPAGDDPLALDMGSMGKGQAWLNGQSI  652

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW     +G+C  CNYAG +   KC   C + T RWYHVPRS+L+PT N
Sbjct  653   GRYWTLWAPNGDCNGCNYAGTYRTPKCQTGCSQPTQRWYHVPRSWLQPTEN  703



>ref|XP_002455836.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
 gb|EES00956.1| hypothetical protein SORBIDRAFT_03g025990 [Sorghum bicolor]
Length=785

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/348 (67%), Positives = 277/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q+A VF+S S  AC AFL N D+ SYA+VSF  MHYNLPPWS+SILPDCK TV+NTA
Sbjct  314   GNAQQASVFRS-STDACVAFLENKDKVSYARVSFNGMHYNLPPWSISILPDCKTTVYNTA  372

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G+Q SQMKM   + GF WQSYNE+  S GD +F  VGLLEQIN TRD +DYLWYTT V
Sbjct  373   RVGSQISQMKME-WAGGFTWQSYNEDINSLGDESFVTVGLLEQINVTRDNTDYLWYTTYV  431

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              +   E FL  GK P L V SAGHALH+FVNGQL G+ YGS+++PK+T+  +V +  G N
Sbjct  432   DVAQDEQFLSNGKNPVLTVMSAGHALHIFVNGQLTGTVYGSVDDPKLTYRGNVKLWPGSN  491

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+YK+GLKGE LSLH
Sbjct  492   TISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYKVGLKGEDLSLH  551

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW +    +QKQPLTWYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  552   SLSGSSSVEWGE---PMQKQPLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  608

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG+C+Y G +DEKKC   CG+++ RWYHVPRS+L PTGN
Sbjct  609   WPGYKASGTCGICDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGN  656



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   465 bits (1196),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 222/350 (63%), Positives = 269/350 (77%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S+SGG CAAFL+NH+ +SYAK+ F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  358   GSLQQAHVFSSESGG-CAAFLSNHEPNSYAKIMFNNMHYNLPPWSISILPDCRNVVFNTA  416

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             +IG Q+SQM+M P  +Q   W+ Y+EE  S  +N+  T  GLLEQIN TRD SDYLWY T
Sbjct  417   KIGVQTSQMQMYPTNTQSLMWERYDEEVASLEENSLITATGLLEQINVTRDTSDYLWYIT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V I   E FLKGGK P L V SAGHALH+FVNGQL GSAYG+ EN ++ FS ++N+RAG
Sbjct  477   SVDISSAEEFLKGGKLPVLTVRSAGHALHIFVNGQLSGSAYGTRENKRIKFSGNINLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS+AVGLPN G  +E W+TG+LGPV L  L+EG RDLTWQ WSY++GLKGE ++
Sbjct  537   TNRIALLSVAVGLPNSGVHYELWSTGVLGPVVLHELDEGSRDLTWQTWSYQVGLKGEDMN  596

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L+SL G+SSVEW+QGS V  +QPLTWY+  F+AP G+EPLALDM +MGKG VWINGQSIG
Sbjct  597   LNSLEGASSVEWMQGSLVQNQQPLTWYRAYFDAPDGDEPLALDMASMGKGHVWINGQSIG  656

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             RYW A     NC  C+Y G +   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  657   RYWTAYAPKENCKSCSYTGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTRN  706



>ref|XP_011077977.1| PREDICTED: beta-galactosidase-like [Sesamum indicum]
Length=726

 Score =   460 bits (1183),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 269/350 (77%), Gaps = 3/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QE RVFKS SG ACAAFLAN+D   + K++F N  Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GNNQEVRVFKSDSG-ACAAFLANYDTADWTKLTFQNFPYDLPPWSISILPDCKTEVYNTA  413

Query  181   RIGAQ-SSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTT  354
             +I  +     KM P    F+WQSYN+   S GD +T+ + GL EQ+N TRD SDYLWY T
Sbjct  414   KIKRKIGPTRKMRPAISTFSWQSYNDHIPSAGDQDTYPMQGLWEQVNVTRDYSDYLWYLT  473

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
             +V IDP EGFLK GKWP L V SAGHAL+V+VNGQL G+ YG+LE P++TF+ +VN++AG
Sbjct  474   EVDIDPNEGFLKSGKWPQLTVMSAGHALNVYVNGQLSGNVYGTLEKPQLTFTSNVNLKAG  533

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLS++VGL N+G  +E WN G+LGP++L GLNEG RDLT Q WS+K+GL GE L 
Sbjct  534   INKIALLSVSVGLANVGVHYEKWNVGVLGPITLDGLNEGTRDLTKQSWSFKVGLIGERLK  593

Query  715   LHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             L +  GSS+ +W QGS V  KQPLTWYKTTF+AP GN+PL LDM +MGKG++WIN Q IG
Sbjct  594   LDTTAGSSAAQWAQGSQVSLKQPLTWYKTTFDAPDGNDPLGLDMYSMGKGEMWINDQGIG  653

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WP N A GNC  CNYAG F EKKCL  CGE + RWYHVPRS+L+PTGN
Sbjct  654   RHWPGNTAKGNCSNCNYAGIFAEKKCLGNCGEPSQRWYHVPRSWLKPTGN  703



>ref|NP_001234842.1| ss-galactosidase precursor [Solanum lycopersicum]
 emb|CAA10175.1| ss-galactosidase [Solanum lycopersicum]
Length=724

 Score =   459 bits (1182),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 227/349 (65%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  YNLPPWS+SILPDCK  V+NTA
Sbjct  355   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +QSS +KMTP   G +WQSYNEET +  D +T T  GL EQ N TRD+SDYLWY T+
Sbjct  414   QVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTN  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  474   VNIASNEGFLKNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  QKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS V QKQPLTWYK TFNAP GN+PLALDM +MGKGQ+WING+ +GR
Sbjct  594   HSLSGSSSVEWVRGSLVAQKQPLTWYKATFNAPGGNDPLALDMASMGKGQIWINGEGVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  654   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  702



>ref|XP_010939579.1| PREDICTED: beta-galactosidase 2-like [Elaeis guineensis]
Length=833

 Score =   463 bits (1191),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 277/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +Q++ VF+S+SG  CAAFLAN D   YA+V+F  M+Y+LPPWSVSILPDCK TVFNTA
Sbjct  362   GITQQSYVFRSQSGD-CAAFLANFDSGYYARVAFNGMNYDLPPWSVSILPDCKTTVFNTA  420

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
              +G+Q+    M  V  GF++QSY+EET+SY DN+FT VGLLEQ+N TRD +DYLWYTT V
Sbjct  421   MVGSQTWVTNMEWVG-GFSFQSYDEETSSYNDNSFTTVGLLEQVNMTRDNTDYLWYTTYV  479

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK G++P L V SAGH+L VF+NGQL G+AYGS+E+P++T++ +V +  G N
Sbjct  480   DIGQDEQFLKNGQYPVLTVMSAGHSLVVFINGQLTGTAYGSVEDPRLTYTGNVKLWQGSN  539

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              I++LS +VGLPN+G  FETWN G+LGPV+L GLNEG RDLTWQKW+YKIGLKGE+LSL+
Sbjct  540   TISILSASVGLPNVGEHFETWNAGVLGPVTLDGLNEGTRDLTWQKWTYKIGLKGESLSLY  599

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SLTGSSSVEW +     Q QPLTWYK  FNAP GNEPLA+DM++MGKGQVWINGQSIGRY
Sbjct  600   SLTGSSSVEWGE---PYQNQPLTWYKAFFNAPEGNEPLAIDMSSMGKGQVWINGQSIGRY  656

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KA G CG C+Y G +DEKKC   CGE++  WYHVPRS+L PTGN
Sbjct  657   WPGYKAYGTCGNCDYRGEYDEKKCQTNCGESSQIWYHVPRSWLNPTGN  704



>ref|XP_009418405.1| PREDICTED: beta-galactosidase 5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   463 bits (1192),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 220/351 (63%), Positives = 274/351 (78%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S++GG CAAFLAN++  S+A+V F N+HYN+PPWS+SILPDC N VFNTA
Sbjct  356   GSLQQAHVFSSQTGG-CAAFLANYNPDSFARVMFNNVHYNIPPWSISILPDCSNVVFNTA  414

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  +Q   W+ Y+E   S  DN+  T  GLLEQIN TRD SDYLWY +
Sbjct  415   KVGVQTSQMQMYPANTQSLMWERYDEVVASLEDNSLITTTGLLEQINVTRDTSDYLWYIS  474

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V + P EGFL GG+ P L V SAGHALH+F+NGQL GSAYGS E+ ++ FS +VN+RAG
Sbjct  475   SVDVSPAEGFLHGGQLPVLTVQSAGHALHIFLNGQLSGSAYGSREDRRIKFSGNVNIRAG  534

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LS+AVGLPN G  +E W+TG+LGPV L GL+EG RDLTWQKWSY++GLKGEA++
Sbjct  535   TNKIAILSVAVGLPNAGVHYEFWSTGVLGPVVLHGLDEGSRDLTWQKWSYQVGLKGEAMN  594

Query  715   LHSLTGSSSVEWVQGSFVVQ-KQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L+SL G+SSVEW+QGS  VQ +QPLTWY+  F+AP GN+PLALDM +MGKGQVWINGQSI
Sbjct  595   LNSLEGASSVEWMQGSLAVQDQQPLTWYRAYFDAPDGNDPLALDMGSMGKGQVWINGQSI  654

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW A   +G+C  C+Y G +   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  655   GRYWTAYAPNGDCNSCSYIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRN  705



>pdb|3W5F|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5F|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4
 pdb|3W5G|A Chain A, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
 pdb|3W5G|B Chain B, Crystal Structure Of Tomato Beta-galactosidase 4 In 
Complex With Galactose
Length=718

 Score =   459 bits (1181),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  YNLPPWS+SILPDCK  V+NTA
Sbjct  338   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTA  396

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +QSS +KMTP   G +WQSYNEET +  D +T T  GL EQ N TRD+SDYLWY T+
Sbjct  397   QVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTN  456

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  457   VNIASNEGFLKNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  516

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  QKWSYK+GLKGE+LSL
Sbjct  517   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSL  576

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS + QKQPLTWYK TFNAP GN+PLALDM +MGKGQ+WING+ +GR
Sbjct  577   HSLSGSSSVEWVRGSLMAQKQPLTWYKATFNAPGGNDPLALDMASMGKGQIWINGEGVGR  636

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  637   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  685



>ref|XP_009418404.1| PREDICTED: beta-galactosidase 5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=860

 Score =   463 bits (1192),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 220/351 (63%), Positives = 274/351 (78%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S++GG CAAFLAN++  S+A+V F N+HYN+PPWS+SILPDC N VFNTA
Sbjct  369   GSLQQAHVFSSQTGG-CAAFLANYNPDSFARVMFNNVHYNIPPWSISILPDCSNVVFNTA  427

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  +Q   W+ Y+E   S  DN+  T  GLLEQIN TRD SDYLWY +
Sbjct  428   KVGVQTSQMQMYPANTQSLMWERYDEVVASLEDNSLITTTGLLEQINVTRDTSDYLWYIS  487

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V + P EGFL GG+ P L V SAGHALH+F+NGQL GSAYGS E+ ++ FS +VN+RAG
Sbjct  488   SVDVSPAEGFLHGGQLPVLTVQSAGHALHIFLNGQLSGSAYGSREDRRIKFSGNVNIRAG  547

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIA+LS+AVGLPN G  +E W+TG+LGPV L GL+EG RDLTWQKWSY++GLKGEA++
Sbjct  548   TNKIAILSVAVGLPNAGVHYEFWSTGVLGPVVLHGLDEGSRDLTWQKWSYQVGLKGEAMN  607

Query  715   LHSLTGSSSVEWVQGSFVVQ-KQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L+SL G+SSVEW+QGS  VQ +QPLTWY+  F+AP GN+PLALDM +MGKGQVWINGQSI
Sbjct  608   LNSLEGASSVEWMQGSLAVQDQQPLTWYRAYFDAPDGNDPLALDMGSMGKGQVWINGQSI  667

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW A   +G+C  C+Y G +   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  668   GRYWTAYAPNGDCNSCSYIGTYRSPKCQSNCGQPTQRWYHVPRSWLQPTRN  718



>gb|AAC25984.1| beta-galactosidase [Solanum lycopersicum]
Length=724

 Score =   459 bits (1180),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  YNLPPWS+SILPDCK  V+NTA
Sbjct  355   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +QSS +KMTP   G +WQSYNEET +  D +T T  GL EQ N TRD+SDYLWY T+
Sbjct  414   QVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTN  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  474   VNIASNEGFLKNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  QKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS + QKQPLTWYK TFNAP GN+PLALDM +MGKGQ+WING+ +GR
Sbjct  594   HSLSGSSSVEWVRGSLMAQKQPLTWYKATFNAPGGNDPLALDMASMGKGQIWINGEGVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  654   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  702



>ref|XP_010515759.1| PREDICTED: beta-galactosidase 2 isoform X2 [Camelina sativa]
Length=580

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 265/349 (76%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSK+  +CAAFL+N+D    A+V FG   Y+LPPWS+SILPDCK    NTA
Sbjct  211   GDKQEAHVFKSKT--SCAAFLSNYDTSHPARVIFGGFPYDLPPWSISILPDCKTEYHNTA  268

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I   S  MKM P S  F+W+SYNE   S  D  TF   GL+EQI+ TRD +DY WY TD
Sbjct  269   KIRVPSILMKMVPTSTRFSWKSYNEAIPSSNDVGTFVKDGLVEQISMTRDKTDYFWYLTD  328

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E F+K G  P L + SAGHALHVFVNGQL G++YG+L N K+TFS+ + +  G+
Sbjct  329   ITISPNEKFVKTGDDPLLTICSAGHALHVFVNGQLSGTSYGALSNSKLTFSQKIKLHVGI  388

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS  VGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  389   NKLALLSTTVGLPNAGVHYETWNTGVLGPATLNGVNSGTWDMSKWKWSYKIGTKGEAMSL  448

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSS+VEW++GSF+ +KQPLTWYK+ F+ P GNEPLALDMNTMGKGQ+W+NG +IGR
Sbjct  449   HTTTGSSNVEWIEGSFMAKKQPLTWYKSYFDTPVGNEPLALDMNTMGKGQIWVNGHNIGR  508

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG ++EKKCL  CGE + RWYHVPRS+L+P GN
Sbjct  509   HWPAYTARGNCGRCNYAGIYNEKKCLSHCGEPSQRWYHVPRSWLKPFGN  557



>ref|XP_010275526.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   462 bits (1189),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/351 (65%), Positives = 276/351 (79%), Gaps = 5/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S+SG  CAAF+AN+D +S A+V F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  357   GSYQQAHVFSSESGD-CAAFIANYDPNSAARVMFNNMHYNLPPWSISILPDCRNMVFNTA  415

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNT-FTVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  S+ F+W++Y+E+ +S  DN+  T VGLLEQIN TRD SDYLWY T
Sbjct  416   KVGVQTSQMQMLPSNSELFSWETYDEDVSSLEDNSMITSVGLLEQINVTRDTSDYLWYIT  475

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V I   E FL+GG+ P L V S GHALHVF+NGQL GSA G+ EN +  F+  VN+RAG
Sbjct  476   SVDISSSESFLRGGQSPTLIVESTGHALHVFINGQLSGSASGTRENRRFMFTGKVNLRAG  535

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +NKIALLSIAVGLPN+G  FE W TGILGPV L GL++GK DLTWQKWSY++GLKGEA++
Sbjct  536   INKIALLSIAVGLPNVGTHFEAWKTGILGPVVLHGLDQGKMDLTWQKWSYQVGLKGEAMN  595

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L S  G SSV+W+QGS VVQK QPLTWYK  FNAP G+EPLALDM++MGKGQVWINGQSI
Sbjct  596   LVSPNGISSVDWMQGSLVVQKQQPLTWYKAYFNAPEGDEPLALDMSSMGKGQVWINGQSI  655

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW    A+GNC  C+Y+G F   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  656   GRYWTI-YANGNCNGCSYSGTFRPPKCQIGCGQPTQRWYHVPRSWLKPTQN  705



>emb|CDY69471.1| BnaAnng30540D, partial [Brassica napus]
Length=416

 Score =   447 bits (1150),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 265/345 (77%), Gaps = 5/345 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF SKS  +CAAFL+N+D +S A+V F    Y+LPPWSVSILPDCK   +NTA
Sbjct  52    GAKQEAHVFWSKS--SCAAFLSNNDANSAARVMFRGFPYDLPPWSVSILPDCKTEYYNTA  109

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A      M P    F+W+S+NE T S  + +TF   GL+EQI+ T D SDY WY TD
Sbjct  110   KVNAPRIHRTMVPTGTRFSWESFNEATPSANERDTFARNGLVEQISMTWDKSDYFWYLTD  169

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK G +P L ++SAGHALHVFVNGQL GSAYG L +PK+TFS+ + + AGV
Sbjct  170   ITIGAGERFLKTGDYPLLTIWSAGHALHVFVNGQLAGSAYGGLSHPKLTFSQKIKLHAGV  229

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS+AVGLPN+G  FETWN G+LGPV+L G+N G  D++  +WSYKIG+KGEA+SL
Sbjct  230   NKLALLSVAVGLPNVGQHFETWNKGVLGPVTLKGVNSGTWDMSKWRWSYKIGVKGEAMSL  289

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H  T SSSV W QGS+VV+KQPLTWYK+TF AP GNEPLA+DMNTMGKG VWING++IGR
Sbjct  290   H--TDSSSVSWNQGSYVVKKQPLTWYKSTFAAPGGNEPLAIDMNTMGKGHVWINGRNIGR  347

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLR  1032
             +WPA KA GNCG CNYAG FD KKCL  CGEA+ RWYHVPRS+L+
Sbjct  348   HWPAYKAQGNCGRCNYAGTFDAKKCLSNCGEASQRWYHVPRSWLK  392



>gb|AAF67341.1| beta galactosidase [Vigna radiata]
Length=721

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 272/349 (78%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA VF +   GACAAF+AN+D  S AK +FG+  Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GYNLEAHVFSTP--GACAAFIANYDTKSSAKATFGSGQYDLPPWSISILPDCKTVVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G      KMTPV+ GFAWQSYNEE  +S  D++     L EQ+N TRD+SDYLWY TD
Sbjct  413   RVG-NGWVKKMTPVNSGFAWQSYNEEPASSSQDDSIAAEALWEQVNVTRDSSDYLWYMTD  471

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I+  EGFLK G+ P L V SAGH LHVF+NGQL G+ YG L NPK+TFS +VN+R G 
Sbjct  472   VYINGNEGFLKNGRSPVLTVMSAGHLLHVFINGQLSGTVYGGLGNPKLTFSDNVNLRVGN  531

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK+GLKGEAL+L
Sbjct  532   NKLSLLSVAVGLPNVGVHFETWNAGVLGPVTLKGLNEGTRDLSRQKWSYKVGLKGEALNL  591

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW+QGS V +KQPLTWYK TF+AP GN+PLALD+ +MGKG+VW+NG+SIGR
Sbjct  592   HTESGSSSVEWIQGSLVAKKQPLTWYKATFSAPAGNDPLALDLGSMGKGEVWVNGRSIGR  651

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  CNYAG++ ++KC   CG+ + RWYHVPRS+L   GN
Sbjct  652   HWPGYIAHGSCNACNYAGYYTDQKCRTNCGKPSQRWYHVPRSWLNSGGN  700



>ref|XP_006353531.1| PREDICTED: beta-galactosidase-like [Solanum tuberosum]
Length=726

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  Y+LPPWS+SILPDCK  V+NTA
Sbjct  357   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYDLPPWSISILPDCKTAVYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+ ++SS +KMTP   G +WQSYNEET +  D +T +  GL EQ N TRD+SDYLWY TD
Sbjct  416   RVNSRSSSIKMTPAGGGLSWQSYNEETPTADDSDTLSANGLWEQKNVTRDSSDYLWYMTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFLK GK P+  V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  476   VNIASNEGFLKNGKDPYFTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  Q+WSYK+GLKGE+LSL
Sbjct  536   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQRWSYKVGLKGESLSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEW++GS V QKQPLTWYK TFNAP GNEPLALDM +MGKGQ+WING+ +GR
Sbjct  596   HSLSGSSSVEWIRGSLVAQKQPLTWYKATFNAPGGNEPLALDMASMGKGQIWINGEGVGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RWYHVPRS+L+P+GN
Sbjct  656   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWYHVPRSWLKPSGN  704



>ref|XP_007138730.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
 gb|ESW10724.1| hypothetical protein PHAVU_009G232500g [Phaseolus vulgaris]
Length=722

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 219/349 (63%), Positives = 271/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA VF +   GACAAF+AN+D  S AK +FG+  Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GYNLEAHVFSTP--GACAAFIANYDTKSSAKATFGSGQYDLPPWSISILPDCKTAVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEE-TTSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++GA +   KMTPV+  FAWQSYNEE  +S  D++     L EQ+N TRD+SDYLWY TD
Sbjct  413   KVGANNWLKKMTPVNSAFAWQSYNEEPASSNQDDSIAADALWEQVNVTRDSSDYLWYMTD  472

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I+  EGF+K G+ P L V SAGH LHVF+NGQL G+ YG L NPK+TFS +VN+R G 
Sbjct  473   VYINANEGFIKNGQSPVLTVMSAGHLLHVFINGQLSGTVYGGLGNPKLTFSDNVNLRVGN  532

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS++VGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK+GLKGEA +L
Sbjct  533   NKLSLLSVSVGLPNVGLHFETWNAGVLGPVTLKGLNEGTRDLSRQKWSYKVGLKGEASNL  592

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW QGS V +KQPLTWYK TF+AP GN+PLALDM +MGKG+VWING+SIGR
Sbjct  593   HTESGSSSVEWTQGSLVAKKQPLTWYKATFSAPSGNDPLALDMGSMGKGEVWINGRSIGR  652

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  CNYAG++ +KKC   CG+ + RWYHVPRS+L   GN
Sbjct  653   HWPGYIAHGSCNACNYAGYYTDKKCRTNCGKPSQRWYHVPRSWLNSGGN  701



>gb|EMT02336.1| Beta-galactosidase 2 [Aegilops tauschii]
Length=813

 Score =   460 bits (1183),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 275/349 (79%), Gaps = 6/349 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G +Q++ VF+S S GACAAFL N D+ SYA+VSF  MHY+LPPWS+SILPDCK TVFNTA
Sbjct  341   GKAQKSSVFRS-STGACAAFLENKDKLSYARVSFSGMHYDLPPWSISILPDCKTTVFNTA  399

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+Q SQMKM   + G  WQSYNEE  SY +   FT VGLLEQIN TRD +DYLWYTT 
Sbjct  400   RVGSQISQMKME-WAGGLTWQSYNEEINSYSEEEAFTAVGLLEQINMTRDNTDYLWYTTY  458

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V +   E FL  GK P L V SAGHALHVFVNGQL G+ YGS+E+PK+T++ SV + AG 
Sbjct  459   VDVAKDEQFLTSGKSPKLTVMSAGHALHVFVNGQLTGTVYGSVEDPKLTYTGSVKLWAGS  518

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N I+ LSIAVGLPN+G  FETWN GILGPV L GLNEG+RDLTWQKW+Y++GLKGEA+SL
Sbjct  519   NTISCLSIAVGLPNVGEHFETWNAGILGPVILYGLNEGRRDLTWQKWTYQVGLKGEAMSL  578

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEW +    VQKQPLTWYK  FNAP G+EPLALDMN+MGKGQ+WINGQ IGR
Sbjct  579   HSLSGSSSVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMNSMGKGQIWINGQGIGR  635

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWP  KA G CG C+Y G ++E KC   CG+++ RWYHVPR +L PTGN
Sbjct  636   YWPGYKAPGTCGYCDYRGEYNETKCQTNCGDSSQRWYHVPRPWLNPTGN  684



>emb|CAB39679.1| putative beta-galactosidase [Arabidopsis thaliana]
 emb|CAB79469.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=729

 Score =   457 bits (1177),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 273/352 (78%), Gaps = 7/352 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKS  +CAAFL+N++  S A+V FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEAHVFKSKS--SCAAFLSNYNTSSAARVLFGGSTYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSS--QMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYT  351
             ++  ++S   MKM P +  F+W SYNEE  S  DN TF+  GL+EQI+ TRD +DY WY 
Sbjct  416   KVQVRTSSIHMKMVPTNTPFSWGSYNEEIPSANDNGTFSQDGLVEQISITRDKTDYFWYL  475

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TD+TI P E FL G   P L + SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + A
Sbjct  476   TDITISPDEKFLTGED-PLLTIGSAGHALHVFVNGQLAGTAYGSLEKPKLTFSQKIKLHA  534

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYK-IGLKGEA  708
             GVNK+ALLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D+T  KWSYK IG KGEA
Sbjct  535   GVNKLALLSTAAGLPNVGVHYETWNTGVLGPVTLNGVNSGTWDMTKWKWSYKQIGTKGEA  594

Query  709   LSLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQS  888
             LS+H+L GSS+VEW +GS V +KQPLTWYK+TF++P GNEPLALDMNTMGKGQ+WINGQ+
Sbjct  595   LSVHTLAGSSTVEWKEGSLVAKKQPLTWYKSTFDSPTGNEPLALDMNTMGKGQMWINGQN  654

Query  889   IGRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             IGR+WPA  A G C  C+YAG F EKKCL  CGEA+ RWYHVPRS+L+PT N
Sbjct  655   IGRHWPAYTARGKCERCSYAGTFTEKKCLSNCGEASQRWYHVPRSWLKPTNN  706



>ref|XP_007217046.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
 gb|EMJ18245.1| hypothetical protein PRUPE_ppa001415mg [Prunus persica]
Length=835

 Score =   461 bits (1185),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 219/349 (63%), Positives = 274/349 (79%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VFKS     CAAFLAN+D +   +V FG+  Y+LPPWS+SILPDCK  V+NTA
Sbjct  357   GRHQEAHVFKSSY--QCAAFLANYDTNYSVEVRFGDGQYDLPPWSISILPDCKTAVYNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+GAQSSQMKMTPV+   +WQS+ EET S  D +TFT+ GL +QIN T D++DYLWY TD
Sbjct  415   RLGAQSSQMKMTPVNNALSWQSFAEETASSDDPDTFTLDGLRDQINMTWDSTDYLWYMTD  474

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P EGFL+ G+ P L + SAGHALHVF+NG+L G+AYGSLE  ++ FS +V +R+G+
Sbjct  475   ITISPDEGFLESGQSPLLTIGSAGHALHVFINGKLSGTAYGSLEKRRLRFSDNVKLRSGI  534

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS+++GLPNIG  FETWN G+LG V+L GLN G  DL+ +KW+YK+GLKGEALSL
Sbjct  535   NKLALLSVSLGLPNIGLHFETWNVGVLGSVTLKGLNSGTWDLSQRKWTYKVGLKGEALSL  594

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++ GSSSVEWVQ  ++ +K PLTWYK TF+AP GN+PLALDM +MGKGQ+WING+SIGR
Sbjct  595   HTVNGSSSVEWVQKPYLAKKPPLTWYKATFDAPSGNDPLALDMVSMGKGQIWINGRSIGR  654

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G C  C YAG ++E KC  KCGE + RWYHVPR +L P+GN
Sbjct  655   HWPAYTAHGACRDCYYAGTYNENKCRTKCGEPSQRWYHVPRGWLNPSGN  703



>gb|ACF22882.1| beta-galactosidase [Glycine max]
 gb|KHN35842.1| Beta-galactosidase [Glycine soja]
Length=721

 Score =   456 bits (1174),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 218/349 (62%), Positives = 270/349 (77%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA VF +   GACAAF+AN+D  SYAK  FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GYNLEAHVFSAP--GACAAFIANYDTKSYAKAKFGNGQYDLPPWSISILPDCKTVVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G    + KMTPV+  FAWQSYNEE  S    ++     L EQ+N TRD+SDYLWY TD
Sbjct  413   KVGYGWLK-KMTPVNSAFAWQSYNEEPASSSQADSIAAYALWEQVNVTRDSSDYLWYMTD  471

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ++  EGFLK G+ P L V SAGH LHVF+NGQL G+ +G L NPK+TFS +V +RAG 
Sbjct  472   VNVNANEGFLKNGQSPLLTVMSAGHVLHVFINGQLAGTVWGGLGNPKLTFSDNVKLRAGN  531

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK+GLKGE+LSL
Sbjct  532   NKLSLLSVAVGLPNVGVHFETWNAGVLGPVTLKGLNEGTRDLSRQKWSYKVGLKGESLSL  591

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW+QGS V +KQPLTWYKTTF+AP GN+PLALD+ +MGKG+VW+NG+SIGR
Sbjct  592   HTESGSSSVEWIQGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKGEVWVNGRSIGR  651

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  CNYAG++ + KC   CG+ + RWYHVPRS+L   GN
Sbjct  652   HWPGYIAHGSCNACNYAGYYTDTKCRTNCGQPSQRWYHVPRSWLSSGGN  700



>ref|NP_001289260.1| beta-galactosidase precursor [Pyrus x bretschneideri]
 dbj|BAD91081.1| beta-D-galactosidase [Pyrus pyrifolia]
 gb|AGR44463.1| beta-D-galactosidase 4 [Pyrus x bretschneideri]
Length=725

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 276/349 (79%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA VF SKSG  CAAFLANHD     +VSFG+  Y+LPPWS+SILPDCK  VFNTA
Sbjct  356   GNNQEAHVFNSKSG--CAAFLANHDTKYSVRVSFGHGQYDLPPWSISILPDCKTAVFNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVV-GLLEQINTTRDASDYLWYTTD  357
             ++  ++S+++M PV     WQS+ EETT+  +   T + GL EQI  TRDA+DYLWY TD
Sbjct  414   KVAWKASEVQMKPVYSRLPWQSFIEETTTSDETGTTTLDGLYEQIYMTRDATDYLWYMTD  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK GK+P L +FSAGHALHVF+NGQL G+ YGSLENPK+TFS++V +R G+
Sbjct  474   ITIGSDEAFLKNGKFPLLTIFSAGHALHVFINGQLSGTVYGSLENPKLTFSQNVKLRPGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLSI+VGLPN+G  FETWNTG+LGP+SL GLN G  D++  KW+YKIG+KGE+L L
Sbjct  534   NKLALLSISVGLPNVGTHFETWNTGVLGPISLKGLNTGTWDMSRWKWTYKIGMKGESLGL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSSSV+W +G  + QKQPLTWYK TF+APPG+ PLALDM +MGKGQ+WINGQS+GR
Sbjct  594   HTVTGSSSVDWAEGPSMAQKQPLTWYKATFDAPPGHAPLALDMGSMGKGQIWINGQSVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+CG C YAG F++KKC   CG+ + RWYH+PRS+L PTGN
Sbjct  654   HWPGYIAQGSCGNCYYAGTFNDKKCRTYCGKPSQRWYHIPRSWLTPTGN  702



>ref|XP_008809207.1| PREDICTED: beta-galactosidase 5-like [Phoenix dactylifera]
Length=852

 Score =   460 bits (1184),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/351 (62%), Positives = 275/351 (78%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ ++A VF S+SG  CAAFLAN++ +S A+V F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  361   GSYEQAHVFSSESG-RCAAFLANYNLNSVARVMFNNMHYNLPPWSISILPDCRNVVFNTA  419

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  SQ   W++Y+EE  S  DN+  +  GLLEQIN TRDASDYLWY T
Sbjct  420   KVGVQTSQMQMFPADSQSLMWETYDEEVASLEDNSLISTTGLLEQINVTRDASDYLWYIT  479

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V + P EGFL+GG+ P L V SAGHALHVFVN QL GSAYG+ EN ++T++ ++N+RAG
Sbjct  480   SVDVSPAEGFLRGGQLPVLTVQSAGHALHVFVNDQLSGSAYGTRENRRITYTGNINLRAG  539

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS+AVGLPN+G  +E WNTG+LGPV L G++EGKRDLTWQKWSY++GLKGEA++
Sbjct  540   SNRIALLSVAVGLPNVGVHYELWNTGVLGPVVLHGVDEGKRDLTWQKWSYQVGLKGEAMN  599

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             ++SL G+SSVEW++ S   QK QPLTWY+  F+AP G++PLALDM +MGKGQVWINGQS+
Sbjct  600   INSLDGTSSVEWMKESLASQKQQPLTWYRAYFDAPAGDDPLALDMGSMGKGQVWINGQSV  659

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW      G+C  CNYAG +    C   CG+ T RWYHVPRS+L+P  N
Sbjct  660   GRYWSLWAPDGDCKGCNYAGTYRSPNCQSGCGQPTQRWYHVPRSWLQPAQN  710



>emb|CDY70594.1| BnaCnng68980D, partial [Brassica napus]
Length=416

 Score =   446 bits (1146),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 265/345 (77%), Gaps = 5/345 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G  QEA VF SKS  +CAAFL+N+D +S A+V F    Y+LPPWSVSILPDCK   +NTA
Sbjct  52    GAKQEAHVFWSKS--SCAAFLSNNDANSAARVMFRGFPYDLPPWSVSILPDCKTEYYNTA  109

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ A      M P    F+W+S+NE T S  + +TF   GL+EQI+ T D SDY WY TD
Sbjct  110   KVNAPRVHRNMVPTGTRFSWESFNEATPSANERDTFARNGLVEQISMTWDKSDYFWYLTD  169

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FL+ G +P L ++SAGHALHVFVNGQL GSAYG L +PK+TFS+ + + AGV
Sbjct  170   ITIGAGERFLQTGDYPLLTIWSAGHALHVFVNGQLAGSAYGGLSHPKLTFSQKIKLHAGV  229

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS+AVGLPN+G  FETWN G+LGPV+L G+N G  D++  KWSYKIG+KGEA+SL
Sbjct  230   NKLALLSVAVGLPNVGQHFETWNKGVLGPVTLKGVNSGTWDMSKWKWSYKIGVKGEAMSL  289

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H  T SSSV W QGS+VV+KQPLTWYK+TF+AP GNEPLALDMNTMGKG VWING++IGR
Sbjct  290   H--TDSSSVSWNQGSYVVKKQPLTWYKSTFSAPGGNEPLALDMNTMGKGHVWINGRNIGR  347

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLR  1032
             +WPA KA GNC  CNYAG FD KKCL  CGEA+ RWYHVPRS+L+
Sbjct  348   HWPAYKAQGNCRRCNYAGTFDAKKCLSNCGEASQRWYHVPRSWLK  392



>gb|KHG01120.1| Beta-galactosidase [Gossypium arboreum]
Length=837

 Score =   459 bits (1181),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 269/349 (77%), Gaps = 13/349 (4%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QE  VFKSKSG ACAAFLAN+D     KV+FG+ HY LP WS++ILPDCK  VFNTA
Sbjct  369   GSNQEGHVFKSKSG-ACAAFLANYDTKYSVKVTFGSAHYELPSWSITILPDCKTAVFNTA  427

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTV-VGLLEQINTTRDASDYLWYTTD  357
             R+GAQSS+ KM   +  F+WQSYNEE+ S  D   TV  GL EQI  TRDA+DYLWY TD
Sbjct  428   RLGAQSSEKKMVLANTAFSWQSYNEESPSADDQDVTVHDGLWEQIYITRDATDYLWYMTD  487

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V ID  EGFL+ G+ P L ++SAGHALHVF+NGQL G+ YG LENPK+TFS +V +RAG+
Sbjct  488   VQIDSDEGFLRSGQDPLLTIWSAGHALHVFINGQLSGTVYGGLENPKLTFSNNVKLRAGI  547

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK           N+G  FETWN G+LGPV+L GLNEG RD + QKWSYKIGLKGEAL L
Sbjct  548   NK-----------NVGTHFETWNVGVLGPVTLKGLNEGTRDFSKQKWSYKIGLKGEALKL  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+  GSSSVEWV+GS +V+KQP+TWYKTTF+AP GNEPL LDM++MGKGQVWINGQSIGR
Sbjct  597   HTDAGSSSVEWVEGSQLVKKQPMTWYKTTFDAPGGNEPLGLDMSSMGKGQVWINGQSIGR  656

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A GNC  C+Y+G + ++KC   CG+ + RWYHVPRS+L+P+GN
Sbjct  657   HWPGYIAHGNCDACDYSGTYSDQKCRTNCGQPSQRWYHVPRSWLKPSGN  705



>ref|XP_003566806.1| PREDICTED: beta-galactosidase 2 [Brachypodium distachyon]
Length=831

 Score =   459 bits (1181),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 235/349 (67%), Positives = 276/349 (79%), Gaps = 6/349 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q+A VF+S S GACAAFL N  + SYA+VSF  MHY+LPPWS+SILPDCK TVFNTA
Sbjct  359   GNAQKASVFRS-STGACAAFLENKHKLSYARVSFNGMHYDLPPWSISILPDCKTTVFNTA  417

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G+Q SQMKM   + G  WQSYNEE  S+ +  +FT VGLLEQIN TRD +DYLWYTT 
Sbjct  418   RVGSQISQMKME-WAGGLTWQSYNEEINSFSELESFTTVGLLEQINMTRDNTDYLWYTTY  476

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V +   E FL  GK P L V SAGHALHVF+NGQL G+ YGS+ENPK+T++  V + +G 
Sbjct  477   VDVAKDEQFLTSGKNPKLTVMSAGHALHVFINGQLSGTVYGSVENPKLTYTGKVKLWSGS  536

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             N I+ LSIAVGLPN+G  FETWN GILGPV+L GLNEGKRDLTWQKW+Y++GLKGEA+SL
Sbjct  537   NTISCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGKRDLTWQKWTYQVGLKGEAMSL  596

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEW +    VQKQPLTWYK  FNAP G+EPLALDMN+MGKGQ+WINGQ IGR
Sbjct  597   HSLSGSSSVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMNSMGKGQIWINGQGIGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             YWP  KASG CG C+Y G ++E KC   CG+ + RWYHVPR +L PTGN
Sbjct  654   YWPGYKASGTCGHCDYRGEYNETKCQTNCGDPSQRWYHVPRPWLNPTGN  702



>ref|XP_004969419.1| PREDICTED: beta-galactosidase 2-like [Setaria italica]
Length=825

 Score =   458 bits (1179),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/348 (66%), Positives = 276/348 (79%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+Q+A VF+S S GAC AFL N D+ SYA+V+F  MHY LPPWS+SILPDCK TV+NTA
Sbjct  354   GNAQQASVFRS-STGACVAFLENKDKVSYARVAFNGMHYGLPPWSISILPDCKTTVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+G+Q SQMKM   + G  WQSYNE+  S G+ +FT +GLLEQIN TRD +DYLWYTT V
Sbjct  413   RVGSQISQMKME-WAGGLTWQSYNEDINSLGEESFTTIGLLEQINVTRDKTDYLWYTTYV  471

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FL  GK P L V SAGHALH+F+NGQL G+ YG++E+P++T+  SV +  G N
Sbjct  472   EIAQDEQFLSNGKNPTLTVMSAGHALHIFINGQLTGTVYGNVEDPRLTYRGSVKLWPGSN  531

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
              ++ LSIAVGLPN+G  FETWN GILGPV+L GLNEG+RDLTWQKW+Y++GLKGE LSLH
Sbjct  532   TVSCLSIAVGLPNVGEHFETWNAGILGPVTLDGLNEGRRDLTWQKWTYQVGLKGETLSLH  591

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW +    VQKQPLTWYK  FNAP G+EPLALDM++MGKGQ+WINGQ IGRY
Sbjct  592   SLSGSSSVEWGE---PVQKQPLTWYKAFFNAPDGDEPLALDMSSMGKGQIWINGQGIGRY  648

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KASG CG C+Y G +DEKKC   CG+++ RWYHVPRS+L PTGN
Sbjct  649   WPGYKASGTCGNCDYRGEYDEKKCQTNCGDSSQRWYHVPRSWLNPTGN  696



>ref|XP_010917686.1| PREDICTED: beta-galactosidase 5-like [Elaeis guineensis]
Length=849

 Score =   459 bits (1181),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 217/351 (62%), Positives = 278/351 (79%), Gaps = 4/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+  +A VF S+SG +CAAFLAN++ +S+++V F NMHY+LPPWS+SILPDC+N VFNTA
Sbjct  358   GSYAQAHVFSSESG-SCAAFLANYNPNSFSRVMFNNMHYSLPPWSISILPDCRNVVFNTA  416

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNTF-TVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P  S    W++Y+EE  S+ DN+  +  GLLEQIN TRDASDYLWY T
Sbjct  417   KVGVQTSQMQMFPADSTSLMWETYDEEVASFDDNSLISTTGLLEQINVTRDASDYLWYIT  476

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V +   EGFL+GG+ P L V SAGHALHVFVNGQL GSAYG+ E+ ++T++ ++N+RAG
Sbjct  477   SVDVSSAEGFLQGGQLPVLTVQSAGHALHVFVNGQLSGSAYGTREDRRITYTGNINLRAG  536

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              N+IALLS+AVGLPN+G  +E WNTG+LGPV L G++EGKRDLTWQKWSY++GLKGEA++
Sbjct  537   SNRIALLSVAVGLPNVGMHYELWNTGVLGPVVLHGVDEGKRDLTWQKWSYQVGLKGEAMN  596

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L+SL G+SSVEW++ S   QK QPLTWY+  F+AP G++PLALDM +MGKGQ WINGQSI
Sbjct  597   LNSLDGTSSVEWMKQSLTSQKQQPLTWYRAYFDAPAGDDPLALDMGSMGKGQAWINGQSI  656

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW     +G+C  CNYAG +   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  657   GRYWSLWAPNGDCNGCNYAGTYRSPKCQSGCGQPTQRWYHVPRSWLQPTQN  707



>emb|CDX94367.1| BnaC01g18170D [Brassica napus]
Length=712

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 274/351 (78%), Gaps = 5/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSKS  +CAAFL+N++  S A+VSFG   Y+LPPWSVSILP+CK   +NTA
Sbjct  331   GDKQEAHVFKSKS--SCAAFLSNYNTSSAARVSFGGATYDLPPWSVSILPNCKTEYYNTA  388

Query  181   RIGAQ--SSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYT  351
             ++  +  S QMKM P +   +W SY+EE  S   N TF   GL+EQI+ TRD +DY WY 
Sbjct  389   KVQVRTPSIQMKMVPTNTQLSWGSYSEEIPSPNYNGTFAKDGLVEQISITRDKTDYFWYL  448

Query  352   TDVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRA  531
             TD+TI   E FLK G+ P L + SAGHAL VFVNGQ VG+AYGSLE PK+TFS+ + + A
Sbjct  449   TDITISADEKFLKTGEDPLLTIGSAGHALSVFVNGQFVGTAYGSLEKPKLTFSQKIKLAA  508

Query  532   GVNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEAL  711
             GVNK+ALLSIAVGLPN+G  +ET NTG+LGPV+L G+N G  D++  KWSYKIG KGEAL
Sbjct  509   GVNKLALLSIAVGLPNVGLHYETRNTGVLGPVTLEGVNSGTWDMSKWKWSYKIGTKGEAL  568

Query  712   SLHSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             S+H++TGSS+VEW +G+ V +KQPLTWYK+TF+ P GNEPLALDMNTMGKGQVWINGQ+I
Sbjct  569   SIHTVTGSSTVEWKEGTLVAKKQPLTWYKSTFDTPAGNEPLALDMNTMGKGQVWINGQNI  628

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GR+WPA KA G C  C+YAG F+EKKCL  CGEA+ RWYHVPRS+L+P+ N
Sbjct  629   GRHWPAYKARGKCDRCSYAGTFNEKKCLSNCGEASQRWYHVPRSWLKPSAN  679



>ref|XP_010433545.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   455 bits (1170),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 218/349 (62%), Positives = 272/349 (78%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSKS  +CAAFL+N++  S A+V FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDNQEAHVFKSKS--SCAAFLSNYNASSAARVLFGGFPYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             ++   S  MKM   +  F+W SYNEE  S  DN TF+  GL+EQI+ TRD +DY WY TD
Sbjct  416   KVRGPSIHMKMVSTNTQFSWGSYNEEIPSAYDNGTFSQDGLVEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FLK G+ P L + SAGHALHVFVNGQL G+AYGSL+ PK+TFS+ + + AGV
Sbjct  476   LTISPDEKFLKTGEDPLLTIASAGHALHVFVNGQLAGTAYGSLKQPKLTFSQKIKLHAGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG KGEA+S+
Sbjct  536   NKLALLSTAAGLPNVGVHYETWNTGVLGPVTLQGVNSGTWDMSKWKWSYKIGTKGEAMSI  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSS+V+W +G  + +KQPLTWYK+TFN P GNEPLAL+MN+MGKGQ+WINGQ+IGR
Sbjct  596   HTVTGSSNVDWKEGPLMAKKQPLTWYKSTFNTPLGNEPLALEMNSMGKGQIWINGQNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G C  C+YAG F EKKCL  CG+A+ RWYHVPRS+L+PT N
Sbjct  656   HWPAYTARGKCERCSYAGTFTEKKCLSNCGQASQRWYHVPRSWLKPTNN  704



>ref|XP_010448320.1| PREDICTED: beta-galactosidase 12-like isoform X2 [Camelina sativa]
Length=726

 Score =   455 bits (1170),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 218/349 (62%), Positives = 269/349 (77%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKS S  +CAAFL+N++  S A+V FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEAHVFKSTS--SCAAFLSNYNASSAARVLFGGFPYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++   S  MKM   +  F+W SYNEE   +Y ++TF+  GL+EQI+ TRD +DY WY TD
Sbjct  416   KVRGPSIHMKMVSTNTQFSWGSYNEEIPAAYDNSTFSNDGLVEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FLK G+ P L + SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + AGV
Sbjct  476   LTISPDEKFLKTGEDPLLTIASAGHALHVFVNGQLAGTAYGSLEQPKLTFSQKIKLHAGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG KGE LS+
Sbjct  536   NKLSLLSTAAGLPNVGVHYETWNTGVLGPVTLTGVNSGTWDMSKWKWSYKIGTKGEDLSI  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H++TGSS+VEW  G  V +KQPLTWYK+TFN P GNEPLALDMN+MGKGQ+WINGQ+IGR
Sbjct  596   HTVTGSSNVEWKDGPLVAKKQPLTWYKSTFNTPVGNEPLALDMNSMGKGQIWINGQNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G C  C+YAG F EKKCL  CG+A+ RWYHVPRS+L+PT N
Sbjct  656   HWPAYTARGKCERCSYAGTFTEKKCLSNCGQASQRWYHVPRSWLKPTNN  704



>ref|XP_008793242.1| PREDICTED: beta-galactosidase [Phoenix dactylifera]
Length=840

 Score =   458 bits (1178),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 233/348 (67%), Positives = 283/348 (81%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VF+SKSG ACAAFLAN++  SY +++F  MHY+LPPWS+SILP+CK TVFNTA
Sbjct  369   GSNQEAHVFRSKSG-ACAAFLANYNPSSYGRITFNGMHYDLPPWSISILPNCKTTVFNTA  427

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSSQMKM  V  GF+W SYNE+T S   + FT  GL+EQI+ T D SDYLWYTT V
Sbjct  428   RVGAQSSQMKMERVG-GFSWNSYNEDTNSLDADAFTKDGLVEQISMTWDRSDYLWYTTYV  486

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK GK+P L V SAGHA+HVF+NGQL G+ +G L+NPK+T+S +V + AG N
Sbjct  487   NIGQNEQFLKNGKYPVLTVLSAGHAMHVFINGQLAGNVFGGLDNPKLTYSGNVKLWAGSN  546

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS+AVGLPN+G  FETWN G+LGPV+L GLN+GKRDL+ QKW+Y+IGLKGEALSLH
Sbjct  547   KISILSVAVGLPNVGNHFETWNAGVLGPVTLDGLNQGKRDLSRQKWTYQIGLKGEALSLH  606

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSSSVEW Q S   +KQPLTWYKT F+AP GNEPLALDM++MGKGQ+WING+SIGRY
Sbjct  607   SLSGSSSVEWGQAS---KKQPLTWYKTVFSAPAGNEPLALDMSSMGKGQIWINGESIGRY  663

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP  KA G+CG C+Y G + EKKC   CGE++  WYHVPRS+L PTGN
Sbjct  664   WPGYKAYGSCGGCDYRGTYSEKKCQTNCGESSQTWYHVPRSWLNPTGN  711



>ref|XP_010254673.1| PREDICTED: beta-galactosidase 3-like [Nelumbo nucifera]
Length=853

 Score =   458 bits (1179),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 228/351 (65%), Positives = 274/351 (78%), Gaps = 5/351 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ Q+A VF S+SGG CAAFLAN++ +S A+V F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  357   GSYQQAHVFSSRSGG-CAAFLANYNPNSAARVMFNNMHYNLPPWSISILPDCRNVVFNTA  415

Query  181   RIGAQSSQMKMTPV-SQGFAWQSYNEETTSYGDNT-FTVVGLLEQINTTRDASDYLWYTT  354
             +IG Q+SQM+M P  S+  AW++Y+E+ +S  DN+  T VGLLEQIN TRD SDYLWY T
Sbjct  416   KIGVQTSQMQMLPSNSKLLAWETYDEDISSLDDNSMITTVGLLEQINVTRDNSDYLWYIT  475

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V I   E FL+GG+ P L V SAGHALHV+VNGQL GSA G+ E  + TF   VN+RAG
Sbjct  476   SVEISSSESFLRGGQNPTLIVQSAGHALHVYVNGQLSGSASGTREKRRFTFIGKVNLRAG  535

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
             +N+IALLSIAVGLPNIG  +E W+TG+LGPV L GL+EGKRDLTWQKWSY++GLKGEA+ 
Sbjct  536   INRIALLSIAVGLPNIGTHYEMWSTGVLGPVVLHGLDEGKRDLTWQKWSYQVGLKGEAMD  595

Query  715   LHSLTGSSSVEWVQGSFVVQK-QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSI  891
             L S    S+V+W++GS  VQK QPLTWYK  FNAP G+EPLALDM +MGKGQVWINGQSI
Sbjct  596   LVSPNRISNVDWIRGSLAVQKQQPLTWYKAYFNAPEGDEPLALDMGSMGKGQVWINGQSI  655

Query  892   GRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             GRYW  + ASG+C  C+Y G F   KC   CG+ T RWYHVPRS+L+PT N
Sbjct  656   GRYWTIH-ASGDCNGCSYTGTFRPPKCQTGCGQPTQRWYHVPRSWLKPTQN  705



>emb|CAC44502.1| beta-galactosidase [Fragaria x ananassa]
Length=722

 Score =   454 bits (1169),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 273/349 (78%), Gaps = 5/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA V++S+SG  CAAFLAN+D     +V+F N  YNLPPWS+SILPDCK  VFNTA
Sbjct  357   GNNQEAHVYQSRSG--CAAFLANYDTKYPVRVTFWNKQYNLPPWSISILPDCKTEVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QS   KMTPV+   +WQ+Y E+  TS  DN FT VGL EQI+ T D +DYLWY TD
Sbjct  415   RVG-QSPPTKMTPVAH-LSWQAYIEDVATSADDNAFTSVGLREQISLTWDNTDYLWYMTD  472

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+ GK+P L V SAGHALHVF+NGQL GSAYG+L  PK+ F++ V +RAG+
Sbjct  473   ITIGPNEQFLRTGKYPTLKVDSAGHALHVFINGQLSGSAYGTLAFPKLEFNQGVKLRAGI  532

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS++VGL N+G  FETWNTG+LGPV+L G+N G  D+T  +W+YKIG++GE +SL
Sbjct  533   NKLALLSVSVGLANVGLHFETWNTGVLGPVTLAGVNSGTWDMTRWQWTYKIGMRGEDMSL  592

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEWVQGS + Q +PLTWYK   NAPPGN PLALDM +MGKGQ+WINGQSIGR
Sbjct  593   HTVSGSSSVEWVQGSLLAQYRPLTWYKAILNAPPGNAPLALDMGSMGKGQMWINGQSIGR  652

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA KA G+CG C YAG + E KC   CG+ + RWYHVPRS+L+ +GN
Sbjct  653   HWPAYKAHGSCGACYYAGTYTENKCRTNCGQPSQRWYHVPRSWLKSSGN  701



>gb|ADO34789.1| beta-galactosidase STBG4 [Solanum lycopersicum]
Length=724

 Score =   454 bits (1168),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 281/349 (81%), Gaps = 2/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA V++SKSG ACAAFL+N+D     KV+F N  YNLPPWS+SILPDCK  V+NTA
Sbjct  355   GSNQEAHVYRSKSG-ACAAFLSNYDSRYSVKVTFQNRPYNLPPWSISILPDCKTAVYNTA  413

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++ +QSS +KMTP   G +WQSYNEET +  D +T T  GL EQ N TRD+SDYLWY T+
Sbjct  414   QVNSQSSSIKMTPAGGGLSWQSYNEETPTADDSDTLTANGLWEQKNVTRDSSDYLWYMTN  473

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I   EGFL+ GK P+L V SAGH LHVFVNG+L G+ YG+L+NPK+T+S +V +RAG+
Sbjct  474   VNIASNEGFLRNGKDPYLTVMSAGHVLHVFVNGKLSGTVYGTLDNPKLTYSGNVKLRAGI  533

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NKI+LLS++VGLPN+G  ++TWN G+LGPV+L GLNEG R+L  QKWSYK+GLKGE+LSL
Sbjct  534   NKISLLSVSVGLPNVGVHYDTWNAGVLGPVTLSGLNEGSRNLAKQKWSYKVGLKGESLSL  593

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             HSL+GSSSVEWV+GS V QKQPLTWYK TFNAP GN+PLAL M +MGKGQ+WING+ +GR
Sbjct  594   HSLSGSSSVEWVRGSLVAQKQPLTWYKATFNAPGGNDPLALGMASMGKGQIWINGEGVGR  653

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  C+YAG F+EKKC   CG+ + RW+HVPRS+L+P+GN
Sbjct  654   HWPGYIAQGDCSKCSYAGTFNEKKCQTNCGQPSQRWHHVPRSWLKPSGN  702



>ref|XP_008805774.1| PREDICTED: beta-galactosidase-like isoform X2 [Phoenix dactylifera]
Length=841

 Score =   457 bits (1177),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 232/348 (67%), Positives = 277/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SKSG  CAAFLAN++  SY +V+F  +HY+LPPWS+SILPDCK  VFNTA
Sbjct  364   GSYQEAHVFRSKSG-VCAAFLANYNPSSYGRVTFNGIHYDLPPWSISILPDCKTAVFNTA  422

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSS MKM  V  GF+W+SYNEE  S   + FT  GL+EQI+ T D SDYLWYTT +
Sbjct  423   RVGAQSSHMKMERVG-GFSWKSYNEEINSLDADAFTKDGLIEQISITWDRSDYLWYTTYI  481

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK GK+P LNV SAGH +HVF+NGQ  G+ YGSL +PK+T+S +V + AG N
Sbjct  482   NIGQDEQFLKNGKYPVLNVLSAGHGMHVFINGQPAGNVYGSLNSPKLTYSGNVKLWAGSN  541

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS+AVGLPN+G  FETWN G+LGPV+L GLNEG+RDL+ QKW+Y+IGLKGEALSLH
Sbjct  542   KISILSVAVGLPNVGDHFETWNAGVLGPVTLDGLNEGERDLSRQKWTYQIGLKGEALSLH  601

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW   S     QPLTWYKT FNAP GNEPLALDM +MGKGQ+WING+SIGRY
Sbjct  602   SLSGSSTVEWGDTS---NMQPLTWYKTFFNAPAGNEPLALDMRSMGKGQIWINGESIGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP NKA G+CGVC+Y G +DEKKC   CGE + RWYHVPRS+L PTGN
Sbjct  659   WPGNKAYGSCGVCDYRGTYDEKKCQTNCGEPSQRWYHVPRSWLNPTGN  706



>ref|XP_008805772.1| PREDICTED: beta-galactosidase-like isoform X1 [Phoenix dactylifera]
Length=846

 Score =   457 bits (1177),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 232/348 (67%), Positives = 277/348 (80%), Gaps = 5/348 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VF+SKSG  CAAFLAN++  SY +V+F  +HY+LPPWS+SILPDCK  VFNTA
Sbjct  364   GSYQEAHVFRSKSG-VCAAFLANYNPSSYGRVTFNGIHYDLPPWSISILPDCKTAVFNTA  422

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDNTFTVVGLLEQINTTRDASDYLWYTTDV  360
             R+GAQSS MKM  V  GF+W+SYNEE  S   + FT  GL+EQI+ T D SDYLWYTT +
Sbjct  423   RVGAQSSHMKMERVG-GFSWKSYNEEINSLDADAFTKDGLIEQISITWDRSDYLWYTTYI  481

Query  361   TIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGVN  540
              I   E FLK GK+P LNV SAGH +HVF+NGQ  G+ YGSL +PK+T+S +V + AG N
Sbjct  482   NIGQDEQFLKNGKYPVLNVLSAGHGMHVFINGQPAGNVYGSLNSPKLTYSGNVKLWAGSN  541

Query  541   KIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSLH  720
             KI++LS+AVGLPN+G  FETWN G+LGPV+L GLNEG+RDL+ QKW+Y+IGLKGEALSLH
Sbjct  542   KISILSVAVGLPNVGDHFETWNAGVLGPVTLDGLNEGERDLSRQKWTYQIGLKGEALSLH  601

Query  721   SLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGRY  900
             SL+GSS+VEW   S     QPLTWYKT FNAP GNEPLALDM +MGKGQ+WING+SIGRY
Sbjct  602   SLSGSSTVEWGDTS---NMQPLTWYKTFFNAPAGNEPLALDMRSMGKGQIWINGESIGRY  658

Query  901   WPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             WP NKA G+CGVC+Y G +DEKKC   CGE + RWYHVPRS+L PTGN
Sbjct  659   WPGNKAYGSCGVCDYRGTYDEKKCQTNCGEPSQRWYHVPRSWLNPTGN  706



>ref|XP_010438797.1| PREDICTED: beta-galactosidase 12 isoform X2 [Camelina sativa]
Length=726

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 270/349 (77%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKS S  +CAAFL+N++  S A+V FG   Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEAHVFKSNS--SCAAFLSNYNASSAARVLFGGFPYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTS-YGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++   S  MKM   +  F+W SYNEE  S Y ++TF+  GL+EQI+ TRD +DY WY  D
Sbjct  416   KVRGPSIHMKMVSTNTQFSWGSYNEEIPSAYDNSTFSKDGLVEQISMTRDKTDYFWYLND  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FLK G+ P L + SAGHALHVFVNGQL G+AYGSLE PK+TFS+ + + AGV
Sbjct  476   LTISPDEKFLKTGEDPLLTIASAGHALHVFVNGQLAGTAYGSLEQPKLTFSQKIKLYAGV  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS A GLPN+G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG KGEA+S+
Sbjct  536   NKLALLSTAAGLPNVGVHYETWNTGVLGPVTLQGVNSGTWDMSKWKWSYKIGTKGEAMSI  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
              ++TGSSSVEW +G+ V +KQPLTWYK+TF+ P GNEPLALDMN+MGKG++WINGQ+IGR
Sbjct  596   QTVTGSSSVEWKEGTLVAKKQPLTWYKSTFDTPVGNEPLALDMNSMGKGKIWINGQNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A G C  C+YAG F EKKCL  CG+A+ RWYHVPRS+L+PT N
Sbjct  656   HWPAYTARGKCERCSYAGTFTEKKCLSNCGQASQRWYHVPRSWLKPTNN  704



>ref|XP_004287559.1| PREDICTED: beta-galactosidase isoform X5 [Fragaria vesca subsp. 
vesca]
Length=722

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 274/349 (79%), Gaps = 5/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN+QEA V++S+SG  CAAFLAN+D     +V+F N  YNLPPWS+SILPDCK  VFNTA
Sbjct  357   GNNQEAHVYQSRSG--CAAFLANYDTKYPVRVTFWNKQYNLPPWSISILPDCKTEVFNTA  414

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEET-TSYGDNTFTVVGLLEQINTTRDASDYLWYTTD  357
             R+G QS   KMTPV+   +WQ+Y E+  TS  DN FT VGL EQ++ T D +DYLWY TD
Sbjct  415   RVG-QSPPTKMTPVAH-LSWQAYIEDVATSADDNAFTSVGLREQLSVTWDNTDYLWYMTD  472

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E FL+ GK+P L V SAGHALHVF+NGQL GSAYG+L +PK+ F++ V +RAG+
Sbjct  473   ITIGPNEQFLRTGKYPTLKVDSAGHALHVFINGQLSGSAYGTLASPKLEFNQGVKLRAGI  532

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS++VGL N+G  FETWNTG+LGPV+L G+N G  D++  +W+YK+G++GE +SL
Sbjct  533   NKLALLSVSVGLANVGLHFETWNTGVLGPVTLAGVNSGTWDMSRWQWTYKVGMRGEDMSL  592

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+++GSSSVEWVQGS + Q +PLTWYK   NAPPGN PLALDM +MGKGQ+WINGQSIGR
Sbjct  593   HTVSGSSSVEWVQGSLLAQYRPLTWYKAILNAPPGNAPLALDMGSMGKGQMWINGQSIGR  652

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA KA G+CG C YAG + E KC   CG+ + RWYHVPRS+L+ +GN
Sbjct  653   HWPAYKAHGSCGACYYAGTYTENKCRTNCGQPSQRWYHVPRSWLKSSGN  701



>ref|XP_010515757.1| PREDICTED: beta-galactosidase 2 isoform X1 [Camelina sativa]
Length=727

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 265/349 (76%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QEA VFKSK+  +CAAFL+N+D    A+V FG   Y+LPPWS+SILPDCK    NTA
Sbjct  358   GDKQEAHVFKSKT--SCAAFLSNYDTSHPARVIFGGFPYDLPPWSISILPDCKTEYHNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I   S  MKM P S  F+W+SYNE   S  D  TF   GL+EQI+ TRD +DY WY TD
Sbjct  416   KIRVPSILMKMVPTSTRFSWKSYNEAIPSSNDVGTFVKDGLVEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E F+K G  P L + SAGHALHVFVNGQL G++YG+L N K+TFS+ + +  G+
Sbjct  476   ITISPNEKFVKTGDDPLLTICSAGHALHVFVNGQLSGTSYGALSNSKLTFSQKIKLHVGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS  VGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  536   NKLALLSTTVGLPNAGVHYETWNTGVLGPATLNGVNSGTWDMSKWKWSYKIGTKGEAMSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSS+VEW++GSF+ +KQPLTWYK+ F+ P GNEPLALDMNTMGKGQ+W+NG +IGR
Sbjct  596   HTTTGSSNVEWIEGSFMAKKQPLTWYKSYFDTPVGNEPLALDMNTMGKGQIWVNGHNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG ++EKKCL  CGE + RWYHVPRS+L+P GN
Sbjct  656   HWPAYTARGNCGRCNYAGIYNEKKCLSHCGEPSQRWYHVPRSWLKPFGN  704



>ref|XP_010426910.1| PREDICTED: beta-galactosidase 2-like [Camelina sativa]
Length=727

 Score =   452 bits (1164),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 265/349 (76%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G++QEA VFKSK+  +CAAFL+N+D    A+V F    Y+LPPWS+SILPDCK    NTA
Sbjct  358   GDNQEAHVFKSKT--SCAAFLSNYDTSHPARVIFRGFPYDLPPWSISILPDCKTEYHNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             +I   S  MKM P S  F W+SYNE   S  D  TF   GL+EQI+ TRD +DY WY TD
Sbjct  416   KIRVPSVLMKMVPTSTRFPWKSYNEAIPSSNDVGTFVKDGLVEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI P E F+K G  P L + SAGHALHVFVNGQL G++YG+L N K+TFS+ + +  G+
Sbjct  476   ITISPNEKFVKTGDDPLLTICSAGHALHVFVNGQLSGTSYGALSNSKLTFSQKIKLHVGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS AVGLPN G  +ETWNTG+LGP +L G+N G  D++  KWSYKIG KGEA+SL
Sbjct  536   NKLALLSTAVGLPNAGVHYETWNTGVLGPATLTGVNSGTWDMSKWKWSYKIGTKGEAMSL  595

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ TGSSSVEW++GSF+ +KQPLTWYK+ F+ P GNEPLALDMNTMGKGQ+W+NG +IGR
Sbjct  596   HTTTGSSSVEWIEGSFMAKKQPLTWYKSYFDTPVGNEPLALDMNTMGKGQIWVNGHNIGR  655

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WPA  A GNCG CNYAG ++EKKCL  CGE + RWYHVPRS+L+P GN
Sbjct  656   HWPAYTARGNCGRCNYAGIYNEKKCLSHCGEPSQRWYHVPRSWLKPFGN  704



>gb|KHN24609.1| Beta-galactosidase [Glycine soja]
Length=710

 Score =   452 bits (1162),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 268/349 (77%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA VF +   GACAAF+AN+D  SYAK +FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  344   GYNLEAHVFSTP--GACAAFIANYDTKSYAKATFGNGQYDLPPWSISILPDCKTVVYNTA  401

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G  S   KMTPV+  FAWQSYNEE  S    ++     L EQ+N TRD+SDYLWY TD
Sbjct  402   KVG-NSWLKKMTPVNSAFAWQSYNEEPASSSQADSIAAYALWEQVNVTRDSSDYLWYMTD  460

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I+  EGFLK G+ P L   SAGH LHVF+N QL G+ +G L NPK+TFS +V +R G 
Sbjct  461   VYINANEGFLKNGQSPVLTAMSAGHVLHVFINDQLAGTVWGGLANPKLTFSDNVKLRVGN  520

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK+GLKGE+LSL
Sbjct  521   NKLSLLSVAVGLPNVGVHFETWNAGVLGPVTLKGLNEGTRDLSSQKWSYKVGLKGESLSL  580

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW++GS V +KQPLTWYKTTF+AP GN+PLALD+ +MGKG+VW+NG+SIGR
Sbjct  581   HTESGSSSVEWIRGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKGEVWVNGRSIGR  640

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  CNYAG++ + KC   CG+ + RWYHVPRS+L   GN
Sbjct  641   HWPGYIAHGSCNACNYAGFYTDTKCRTNCGQPSQRWYHVPRSWLSSGGN  689



>gb|AGR44464.1| beta-D-galactosidase 5, partial [Pyrus x bretschneideri]
Length=697

 Score =   451 bits (1161),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 272/352 (77%), Gaps = 6/352 (2%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             GN Q+A V+ S+SG  C+AFL+NHD  S A+V F NMHYNLPPWS+SILPDC+N VFNTA
Sbjct  201   GNFQQAYVYTSESGD-CSAFLSNHDSKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTA  259

Query  181   RIGAQSSQMKMTPVS-QGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTT  354
             ++G Q+SQM+M P +    +W+SY+E+ TS  D+ T T  GLLEQIN TRD++DYLWY T
Sbjct  260   KVGVQTSQMQMLPTNIPMLSWESYDEDLTSMDDSSTMTAPGLLEQINVTRDSTDYLWYIT  319

Query  355   DVTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAG  534
              V ID  E FL GG+ P L V S GHA+H+F+NGQL GSA+G+ E+ + T++  VN+RAG
Sbjct  320   SVDIDSSESFLHGGELPTLIVQSTGHAVHIFINGQLTGSAFGTRESRRFTYTGKVNLRAG  379

Query  535   VNKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALS  714
              NKIALLS+AVGLPN+G  FE WNTGILGPV+L GLN+GK DL+WQKW+Y++GLKGEA++
Sbjct  380   TNKIALLSVAVGLPNVGGHFEAWNTGILGPVALHGLNQGKWDLSWQKWTYQVGLKGEAMN  439

Query  715   LHSLTGSSSVEWVQGSFVVQK--QPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQS  888
             L S    SSVEW+ GS + QK  QPLTW+KT FN P G+EPLALDM  MGKGQ+WINGQS
Sbjct  440   LVSQNAFSSVEWISGSLIAQKKQQPLTWHKTIFNEPEGSEPLALDMEGMGKGQIWINGQS  499

Query  889   IGRYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             IGRYW A  A+GNC  C+YAG F   KC   CG+ T R+YHVPRS+L+PT N
Sbjct  500   IGRYWTA-FANGNCNGCSYAGGFRPTKCQSGCGKPTQRYYHVPRSWLKPTQN  550



>ref|XP_002876169.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52428.1| AT3g52840/F8J2_10 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score =   452 bits (1163),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 271/350 (77%), Gaps = 4/350 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G+ QE  VFKSK+  +CAAFL+N+D  S A++ F    Y+LPPWSVSILPDCK   +NTA
Sbjct  358   GDKQEVHVFKSKT--SCAAFLSNYDTSSAARIMFRGFPYDLPPWSVSILPDCKTEYYNTA  415

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGDN-TFTVVGLLEQINTTRDASDYLWYTTD  357
             +I A +  MKM P S  F+W+SYNE + S  D+ TF   GL+EQI+ TRD +DY WY TD
Sbjct  416   KIRAPTILMKMVPTSTKFSWESYNEGSPSSNDDGTFVKDGLVEQISMTRDKTDYFWYLTD  475

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             +TI   E FLK G  P L +FSAGHALHVFVNG L G++YG+L N K+TFS+ + +  G+
Sbjct  476   ITIGSDESFLKTGDDPLLTIFSAGHALHVFVNGLLAGTSYGALSNSKLTFSQKIKLSVGI  535

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK+ALLS AVGLPN G  +ETWNTG+LGPV+L G+N G  D++  KWSYKIG++GEA+S 
Sbjct  536   NKLALLSTAVGLPNAGVHYETWNTGVLGPVTLKGVNSGTWDMSKWKWSYKIGIRGEAMSF  595

Query  718   HSLTGSSSVE-WVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIG  894
             H++ GSS+V+ W++GSFVV+K+PLTWYK++F+ P GNEPLALDMNTMGKGQVW+NG +IG
Sbjct  596   HTIAGSSAVKWWIKGSFVVKKEPLTWYKSSFDTPKGNEPLALDMNTMGKGQVWVNGHNIG  655

Query  895   RYWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             R+WPA  A GNCG CNYAG ++EKKCL  CGE + RWYHVPRS+L+P GN
Sbjct  656   RHWPAYTARGNCGRCNYAGIYNEKKCLSHCGEPSQRWYHVPRSWLKPFGN  705



>ref|XP_003546457.1| PREDICTED: beta-galactosidase-like isoform X1 [Glycine max]
 ref|XP_006597816.1| PREDICTED: beta-galactosidase-like isoform X2 [Glycine max]
Length=721

 Score =   452 bits (1162),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 268/349 (77%), Gaps = 4/349 (1%)
 Frame = +1

Query  1     GNSQEARVFKSKSGGACAAFLANHDQHSYAKVSFGNMHYNLPPWSVSILPDCKNTVFNTA  180
             G + EA VF +   GACAAF+AN+D  SYAK +FGN  Y+LPPWS+SILPDCK  V+NTA
Sbjct  355   GYNLEAHVFSTP--GACAAFIANYDTKSYAKATFGNGQYDLPPWSISILPDCKTVVYNTA  412

Query  181   RIGAQSSQMKMTPVSQGFAWQSYNEETTSYGD-NTFTVVGLLEQINTTRDASDYLWYTTD  357
             ++G  S   KMTPV+  FAWQSYNEE  S    ++     L EQ+N TRD+SDYLWY TD
Sbjct  413   KVG-NSWLKKMTPVNSAFAWQSYNEEPASSSQADSIAAYALWEQVNVTRDSSDYLWYMTD  471

Query  358   VTIDPREGFLKGGKWPWLNVFSAGHALHVFVNGQLVGSAYGSLENPKVTFSKSVNMRAGV  537
             V I+  EGFLK G+ P L   SAGH LHVF+N QL G+ +G L NPK+TFS +V +R G 
Sbjct  472   VYINANEGFLKNGQSPVLTAMSAGHVLHVFINDQLAGTVWGGLANPKLTFSDNVKLRVGN  531

Query  538   NKIALLSIAVGLPNIGPRFETWNTGILGPVSLGGLNEGKRDLTWQKWSYKIGLKGEALSL  717
             NK++LLS+AVGLPN+G  FETWN G+LGPV+L GLNEG RDL+ QKWSYK+GLKGE+LSL
Sbjct  532   NKLSLLSVAVGLPNVGVHFETWNAGVLGPVTLKGLNEGTRDLSSQKWSYKVGLKGESLSL  591

Query  718   HSLTGSSSVEWVQGSFVVQKQPLTWYKTTFNAPPGNEPLALDMNTMGKGQVWINGQSIGR  897
             H+ +GSSSVEW++GS V +KQPLTWYKTTF+AP GN+PLALD+ +MGKG+VW+NG+SIGR
Sbjct  592   HTESGSSSVEWIRGSLVAKKQPLTWYKTTFSAPAGNDPLALDLGSMGKGEVWVNGRSIGR  651

Query  898   YWPANKASGNCGVCNYAGWFDEKKCLRKCGEATXRWYHVPRSFLRPTGN  1044
             +WP   A G+C  CNYAG++ + KC   CG+ + RWYHVPRS+L   GN
Sbjct  652   HWPGYIAHGSCNACNYAGFYTDTKCRTNCGQPSQRWYHVPRSWLSSGGN  700



Lambda      K        H        a         alpha
   0.317    0.133    0.430    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2692985702418