BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6328

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006354871.1|  PREDICTED: uncharacterized protein LOC102593...    263   4e-80   Solanum tuberosum [potatoes]
ref|XP_006354872.1|  PREDICTED: uncharacterized protein LOC102593...    259   1e-78   Solanum tuberosum [potatoes]
ref|XP_009627300.1|  PREDICTED: uncharacterized protein LOC104117877    254   7e-77   Nicotiana tomentosiformis
ref|XP_004238148.1|  PREDICTED: uncharacterized protein LOC101252...    251   1e-75   Solanum lycopersicum
ref|XP_009803541.1|  PREDICTED: uncharacterized protein LOC104248888    248   2e-74   Nicotiana sylvestris
ref|XP_010320329.1|  PREDICTED: uncharacterized protein LOC101252...    248   3e-74   Solanum lycopersicum
emb|CDP01326.1|  unnamed protein product                                224   3e-65   Coffea canephora [robusta coffee]
ref|XP_011074420.1|  PREDICTED: uncharacterized protein LOC105159160    221   4e-64   Sesamum indicum [beniseed]
gb|EYU36309.1|  hypothetical protein MIMGU_mgv1a004146mg                213   2e-61   Erythranthe guttata [common monkey flower]
gb|EYU36308.1|  hypothetical protein MIMGU_mgv1a004146mg                209   5e-60   Erythranthe guttata [common monkey flower]
ref|XP_007017208.1|  Remorin family protein isoform 2                   202   4e-57   
ref|XP_007017207.1|  Remorin family protein isoform 1                   202   5e-57   
ref|XP_002282806.2|  PREDICTED: uncharacterized protein LOC100257562    196   7e-55   Vitis vinifera
ref|XP_010112186.1|  hypothetical protein L484_009552                   190   1e-52   Morus notabilis
ref|XP_012071648.1|  PREDICTED: uncharacterized protein LOC105633635    189   5e-52   Jatropha curcas
ref|XP_004142866.1|  PREDICTED: uncharacterized protein LOC101202771    187   2e-51   Cucumis sativus [cucumbers]
ref|XP_008444612.1|  PREDICTED: uncharacterized protein LOC103487882    185   1e-50   Cucumis melo [Oriental melon]
gb|KJB58494.1|  hypothetical protein B456_009G212800                    182   3e-50   Gossypium raimondii
gb|KJB58491.1|  hypothetical protein B456_009G212800                    184   4e-50   Gossypium raimondii
gb|KJB58495.1|  hypothetical protein B456_009G212800                    184   4e-50   Gossypium raimondii
gb|KJB58492.1|  hypothetical protein B456_009G212800                    182   4e-50   Gossypium raimondii
gb|KHG13345.1|  hypothetical protein F383_04792                         183   7e-50   Gossypium arboreum [tree cotton]
emb|CAN66979.1|  hypothetical protein VITISV_004452                     180   7e-49   Vitis vinifera
gb|KJB58493.1|  hypothetical protein B456_009G212800                    176   2e-47   Gossypium raimondii
gb|ACP27605.1|  remorin-like protein                                    171   4e-47   Dimocarpus longan [longan]
gb|AGC39092.2|  remorin-1 protein                                       172   3e-46   Dimocarpus longan [longan]
gb|KCW68729.1|  hypothetical protein EUGRSUZ_F02334                     172   4e-46   Eucalyptus grandis [rose gum]
gb|AGN88925.1|  remorin-1 protein                                       172   6e-46   Dimocarpus longan [longan]
ref|XP_010061739.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    171   1e-45   Eucalyptus grandis [rose gum]
ref|XP_002510204.1|  DNA binding protein, putative                      171   1e-45   Ricinus communis
ref|XP_006374925.1|  hypothetical protein POPTR_0014s02780g             168   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006374924.1|  hypothetical protein POPTR_0014s02780g             167   3e-44   
ref|XP_006473309.1|  PREDICTED: uncharacterized protein LOC102607...    167   6e-44   Citrus sinensis [apfelsine]
ref|XP_002302434.2|  hypothetical protein POPTR_0002s12690g             166   8e-44   
ref|XP_006473308.1|  PREDICTED: uncharacterized protein LOC102607...    166   1e-43   Citrus sinensis [apfelsine]
ref|XP_011029757.1|  PREDICTED: uncharacterized protein LOC105129411    166   1e-43   Populus euphratica
gb|KJB63843.1|  hypothetical protein B456_010G020400                    165   2e-43   Gossypium raimondii
gb|KJB63852.1|  hypothetical protein B456_010G020400                    164   3e-43   Gossypium raimondii
gb|KJB63844.1|  hypothetical protein B456_010G020400                    164   3e-43   Gossypium raimondii
gb|KJB63851.1|  hypothetical protein B456_010G020400                    164   3e-43   Gossypium raimondii
ref|XP_006434750.1|  hypothetical protein CICLE_v10000692mg             164   5e-43   Citrus clementina [clementine]
gb|KHN35684.1|  Hypothetical protein glysoja_037594                     164   7e-43   Glycine soja [wild soybean]
gb|KDO84140.1|  hypothetical protein CISIN_1g008047mg                   163   9e-43   Citrus sinensis [apfelsine]
ref|XP_006434749.1|  hypothetical protein CICLE_v10000692mg             163   1e-42   Citrus clementina [clementine]
gb|KDO84141.1|  hypothetical protein CISIN_1g008047mg                   162   1e-42   Citrus sinensis [apfelsine]
ref|XP_006601287.1|  PREDICTED: uncharacterized protein LOC100792...    162   3e-42   Glycine max [soybeans]
ref|XP_006601286.1|  PREDICTED: uncharacterized protein LOC100792...    162   3e-42   Glycine max [soybeans]
gb|KHG12312.1|  hypothetical protein F383_19939                         161   3e-42   Gossypium arboreum [tree cotton]
ref|XP_007160859.1|  hypothetical protein PHAVU_001G022700g             160   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004292813.1|  PREDICTED: uncharacterized protein LOC101314344    159   2e-41   Fragaria vesca subsp. vesca
ref|XP_003544462.1|  PREDICTED: uncharacterized protein LOC100782306    159   3e-41   Glycine max [soybeans]
ref|XP_009795222.1|  PREDICTED: uncharacterized protein LOC104241...    155   5e-40   Nicotiana sylvestris
ref|XP_004499051.1|  PREDICTED: uncharacterized protein LOC101504...    155   8e-40   Cicer arietinum [garbanzo]
ref|XP_008220239.1|  PREDICTED: uncharacterized protein LOC103320346    154   1e-39   Prunus mume [ume]
ref|XP_011017191.1|  PREDICTED: uncharacterized protein LOC105120...    154   3e-39   Populus euphratica
ref|XP_009605374.1|  PREDICTED: uncharacterized protein LOC104099944    152   7e-39   Nicotiana tomentosiformis
ref|XP_011017193.1|  PREDICTED: uncharacterized protein LOC105120...    151   2e-38   Populus euphratica
ref|XP_008378037.1|  PREDICTED: uncharacterized protein LOC103441...    148   2e-37   
ref|XP_008378035.1|  PREDICTED: uncharacterized protein LOC103441...    147   3e-37   
ref|XP_008367665.1|  PREDICTED: uncharacterized protein LOC103431302    147   3e-37   
gb|KHN12790.1|  hypothetical protein glysoja_008753                     145   3e-36   Glycine soja [wild soybean]
ref|XP_009359706.1|  PREDICTED: uncharacterized protein LOC103950...    143   9e-36   
ref|XP_009359703.1|  PREDICTED: uncharacterized protein LOC103950...    143   1e-35   Pyrus x bretschneideri [bai li]
gb|KJB58498.1|  hypothetical protein B456_009G212800                    143   1e-35   Gossypium raimondii
ref|XP_010269599.1|  PREDICTED: uncharacterized protein LOC104606...    140   8e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010269583.1|  PREDICTED: uncharacterized protein LOC104606...    140   1e-34   Nelumbo nucifera [Indian lotus]
gb|KJB63849.1|  hypothetical protein B456_010G020400                    139   3e-34   Gossypium raimondii
gb|KJB63848.1|  hypothetical protein B456_010G020400                    139   4e-34   Gossypium raimondii
gb|KJB58497.1|  hypothetical protein B456_009G212800                    138   6e-34   Gossypium raimondii
ref|XP_010540365.1|  PREDICTED: uncharacterized protein LOC104814166    136   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010552520.1|  PREDICTED: uncharacterized protein LOC104822856    136   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_010538113.1|  PREDICTED: uncharacterized protein LOC104812570    135   4e-33   Tarenaya hassleriana [spider flower]
gb|KCW68728.1|  hypothetical protein EUGRSUZ_F02334                     133   3e-32   Eucalyptus grandis [rose gum]
ref|XP_003589173.1|  Remorin                                            134   3e-32   Medicago truncatula
ref|XP_010688867.1|  PREDICTED: uncharacterized protein LOC104902690    129   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011654112.1|  PREDICTED: uncharacterized protein LOC101215...    127   3e-30   Cucumis sativus [cucumbers]
ref|XP_004141261.1|  PREDICTED: uncharacterized protein LOC101215...    127   3e-30   Cucumis sativus [cucumbers]
ref|NP_973976.1|  remorin-like protein                                  124   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452561.1|  PREDICTED: uncharacterized protein LOC103493...    122   4e-28   
ref|XP_008452559.1|  PREDICTED: uncharacterized protein LOC103493...    122   4e-28   
ref|XP_002894013.1|  remorin family protein                             120   1e-27   
ref|XP_010479085.1|  PREDICTED: uncharacterized protein LOC104757990    118   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010500198.1|  PREDICTED: uncharacterized protein LOC104777615    117   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010461485.1|  PREDICTED: uncharacterized protein LOC104742...    117   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010461486.1|  PREDICTED: uncharacterized protein LOC104742...    115   8e-26   Camelina sativa [gold-of-pleasure]
gb|KFK36165.1|  hypothetical protein AALP_AA4G086500                    115   1e-25   Arabis alpina [alpine rockcress]
ref|XP_006393653.1|  hypothetical protein EUTSA_v10011395mg             114   2e-25   
ref|XP_006307067.1|  hypothetical protein CARUB_v10008653mg             114   2e-25   
ref|XP_009795225.1|  PREDICTED: uncharacterized protein LOC104241...    112   4e-25   Nicotiana sylvestris
ref|XP_006307066.1|  hypothetical protein CARUB_v10008653mg             112   2e-24   
ref|XP_010269591.1|  PREDICTED: uncharacterized protein LOC104606...    104   6e-22   Nelumbo nucifera [Indian lotus]
gb|ABC47866.1|  remorin                                                 103   9e-22   Glycine max [soybeans]
gb|KEH40032.1|  carboxy-terminal region remorin                         103   2e-21   Medicago truncatula
ref|XP_009107448.1|  PREDICTED: uncharacterized protein LOC103833110    102   2e-21   Brassica rapa
emb|CDY17058.1|  BnaA08g04220D                                          102   2e-21   Brassica napus [oilseed rape]
emb|CDY43217.1|  BnaC08g04900D                                          102   2e-21   Brassica napus [oilseed rape]
gb|KHN22327.1|  Hypothetical protein glysoja_022083                     100   1e-20   Glycine soja [wild soybean]
ref|XP_010939408.1|  PREDICTED: uncharacterized protein LOC105058...  84.7    4e-15   
ref|XP_010939409.1|  PREDICTED: uncharacterized protein LOC105058...  84.7    4e-15   
ref|XP_010939410.1|  PREDICTED: uncharacterized protein LOC105058...  81.6    4e-14   
ref|XP_008777596.1|  PREDICTED: uncharacterized protein LOC103697...  75.9    3e-12   Phoenix dactylifera
ref|XP_006576631.1|  PREDICTED: uncharacterized protein LOC100306...  70.9    1e-11   
ref|XP_006576629.1|  PREDICTED: uncharacterized protein LOC100306...  70.1    2e-11   
ref|XP_008777597.1|  PREDICTED: uncharacterized protein LOC103697...  71.6    8e-11   Phoenix dactylifera
gb|KHN28724.1|  hypothetical protein glysoja_049021                   65.9    1e-09   Glycine soja [wild soybean]
ref|XP_010263528.1|  PREDICTED: uncharacterized protein LOC104601769  63.9    2e-09   
ref|XP_010943079.1|  PREDICTED: uncharacterized protein LOC105060...  64.3    2e-08   Elaeis guineensis
gb|KCW68730.1|  hypothetical protein EUGRSUZ_F02334                   63.5    2e-08   Eucalyptus grandis [rose gum]
dbj|BAK05282.1|  predicted protein                                    62.8    7e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05507.1|  predicted protein                                    62.4    8e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009391360.1|  PREDICTED: uncharacterized protein LOC103977...  62.0    1e-07   
ref|XP_008777598.1|  PREDICTED: uncharacterized protein LOC103697...  62.0    1e-07   
gb|EMS45100.1|  hypothetical protein TRIUR3_26924                     62.0    1e-07   Triticum urartu
ref|XP_004957009.1|  PREDICTED: uncharacterized protein LOC101758590  59.3    9e-07   Setaria italica
ref|XP_007017209.1|  Remorin family protein isoform 3                 58.5    1e-06   
gb|ABK93434.1|  unknown                                               57.0    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010263530.1|  PREDICTED: uncharacterized protein LOC104601770  58.2    2e-06   
ref|XP_010943080.1|  PREDICTED: uncharacterized protein LOC105060...  58.2    3e-06   Elaeis guineensis
gb|EEC83721.1|  hypothetical protein OsI_29560                        57.8    3e-06   Oryza sativa Indica Group [Indian rice]
gb|EEC84699.1|  hypothetical protein OsI_31639                        57.4    3e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001063361.1|  Os09g0456100                                     57.4    3e-06   
gb|KJB63847.1|  hypothetical protein B456_010G020400                  57.4    4e-06   Gossypium raimondii
gb|EEE69848.1|  hypothetical protein OsJ_29623                        57.4    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660693.1|  PREDICTED: uncharacterized protein LOC102711560  56.6    7e-06   
ref|NP_001062016.1|  Os08g0471800                                     56.2    9e-06   
ref|XP_010652810.1|  PREDICTED: uncharacterized protein LOC100252502  56.2    9e-06   Vitis vinifera
gb|EEE68847.1|  hypothetical protein OsJ_27640                        56.2    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222845.1|  hypothetical protein PRUPE_ppa006694mg           55.8    1e-05   
ref|NP_001169618.1|  hypothetical protein                             55.1    2e-05   Zea mays [maize]
ref|XP_008651734.1|  PREDICTED: hypothetical protein isoform X1       55.1    3e-05   Zea mays [maize]
emb|CBI21424.3|  unnamed protein product                              54.7    3e-05   Vitis vinifera
ref|XP_009391362.1|  PREDICTED: uncharacterized protein LOC103977...  53.5    6e-05   
ref|XP_010235213.1|  PREDICTED: uncharacterized protein LOC100834...  53.1    9e-05   
gb|ACU14749.1|  unknown                                               50.1    1e-04   Glycine max [soybeans]
ref|XP_010235212.1|  PREDICTED: uncharacterized protein LOC100834...  53.1    1e-04   
ref|XP_003537303.1|  PREDICTED: uncharacterized protein LOC100816437  52.8    1e-04   Glycine max [soybeans]
ref|XP_010235209.1|  PREDICTED: uncharacterized protein LOC100834...  53.1    1e-04   
ref|XP_010232271.1|  PREDICTED: uncharacterized protein LOC100839505  52.4    2e-04   
ref|XP_010093640.1|  hypothetical protein L484_011063                 51.6    3e-04   Morus notabilis
ref|XP_010943081.1|  PREDICTED: uncharacterized protein LOC105060...  51.2    3e-04   



>ref|XP_006354871.1| PREDICTED: uncharacterized protein LOC102593823 isoform X1 [Solanum 
tuberosum]
Length=579

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 176/221 (80%), Gaps = 10/221 (5%)
 Frame = +2

Query  119  MAELGFRDQASGF----RARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            M ELGF+D  SG       RDVSPDSVI+T DSN S+FSSAS SVDRCSFASDAHD +DS
Sbjct  1    MPELGFQDSRSGLGFSRSVRDVSPDSVIYTGDSNFSIFSSASGSVDRCSFASDAHD-QDS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIAD-NSEIETEDEN  451
            S SD SQ HLAGHE  +AS G  +D     VH    LSRKEKAKVQ A+ NSEIETEDEN
Sbjct  60   SVSDVSQQHLAGHECREASGGTVTDPNKTMVHRNSHLSRKEKAKVQKAEKNSEIETEDEN  119

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
            L++DSARNSFSQALKECQDRR  SG  LKKPDRRRPASLDLNN+V N  +SSSP+FGVMK
Sbjct  120  LSLDSARNSFSQALKECQDRRFGSGSLLKKPDRRRPASLDLNNAVINTCHSSSPRFGVMK  179

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  +TTSR G FPSP TPNYR+SS+G+QKGWSSERVPLHSS
Sbjct  180  KTPITTSRVGTFPSPRTPNYRHSSVGVQKGWSSERVPLHSS  220



>ref|XP_006354872.1| PREDICTED: uncharacterized protein LOC102593823 isoform X2 [Solanum 
tuberosum]
Length=578

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 176/221 (80%), Gaps = 11/221 (5%)
 Frame = +2

Query  119  MAELGFRDQASGF----RARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            M ELGF+D  SG       RDVSPDSVI+T DSN S+FSSAS SVDRCSFASDAHD +DS
Sbjct  1    MPELGFQDSRSGLGFSRSVRDVSPDSVIYTGDSNFSIFSSASGSVDRCSFASDAHD-QDS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIAD-NSEIETEDEN  451
            S SD SQ HLAGHE  +AS G  +D     VH    LSRKEKAKVQ A+ NSEIETEDEN
Sbjct  60   SVSDVSQ-HLAGHECREASGGTVTDPNKTMVHRNSHLSRKEKAKVQKAEKNSEIETEDEN  118

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
            L++DSARNSFSQALKECQDRR  SG  LKKPDRRRPASLDLNN+V N  +SSSP+FGVMK
Sbjct  119  LSLDSARNSFSQALKECQDRRFGSGSLLKKPDRRRPASLDLNNAVINTCHSSSPRFGVMK  178

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  +TTSR G FPSP TPNYR+SS+G+QKGWSSERVPLHSS
Sbjct  179  KTPITTSRVGTFPSPRTPNYRHSSVGVQKGWSSERVPLHSS  219



>ref|XP_009627300.1| PREDICTED: uncharacterized protein LOC104117877 [Nicotiana tomentosiformis]
Length=577

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 176/220 (80%), Gaps = 10/220 (5%)
 Frame = +2

Query  119  MAELGFRDQASGFR---ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M ELGF++  SG R   ARDVSPDSVIFT DSN SLFSSAS SVDRCSFASDAHD +DSS
Sbjct  1    MPELGFQELRSGIRFRSARDVSPDSVIFTGDSNFSLFSSASGSVDRCSFASDAHD-QDSS  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQ-IADNSEIETEDENL  454
             SD SQ HLAGHE  +A     +D     VH    L RKEKAKVQ +  NSE+ETEDENL
Sbjct  60   VSDVSQ-HLAGHECREALGSTVTDPNKVIVHKNSHLGRKEKAKVQKLEKNSEVETEDENL  118

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
            ++DSARNSFSQALKECQDRR RS   LKKPDRRRPASLDLNN++ N ++SSSP+FGVMK+
Sbjct  119  SLDSARNSFSQALKECQDRRFRSEFLLKKPDRRRPASLDLNNAMINTSHSSSPRFGVMKR  178

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              VTTSR G+FPSP TPNYR+SS+G+QKGWSSERVPLHS+
Sbjct  179  TPVTTSRAGSFPSPRTPNYRHSSVGVQKGWSSERVPLHSA  218



>ref|XP_004238148.1| PREDICTED: uncharacterized protein LOC101252176 isoform X1 [Solanum 
lycopersicum]
Length=579

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 174/221 (79%), Gaps = 10/221 (5%)
 Frame = +2

Query  119  MAELGFRDQASGF----RARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            M ELGF+D  SG       RDVSPDSVI+T DSN S+FSSAS SVDRCSFASDAHD +DS
Sbjct  1    MPELGFQDSRSGLGFSRSVRDVSPDSVIYTGDSNFSIFSSASGSVDRCSFASDAHD-QDS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIAD-NSEIETEDEN  451
            S SD SQ HLAGHE  +AS G  +D     +H    + RKEKAKVQ A+ NSEIETEDEN
Sbjct  60   SVSDVSQQHLAGHECREASGGTVTDPNKAMLHRNSHIGRKEKAKVQKAEKNSEIETEDEN  119

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
            L++DSARNSFSQALKECQDRR  SG  LKKPDRRRPASLDLNN+V N  +SSSP+FG+MK
Sbjct  120  LSLDSARNSFSQALKECQDRRFGSGSLLKKPDRRRPASLDLNNAVINTCHSSSPRFGIMK  179

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  +TTSR G F SP TP+YR+SS+G+QKGWSSERVPLHS+
Sbjct  180  KTPITTSRVGTFLSPRTPSYRHSSVGVQKGWSSERVPLHSA  220



>ref|XP_009803541.1| PREDICTED: uncharacterized protein LOC104248888 [Nicotiana sylvestris]
Length=577

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 174/220 (79%), Gaps = 10/220 (5%)
 Frame = +2

Query  119  MAELGFRDQASGF---RARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M ELGF++  SG      RDVSPDSVIFT DSN SLFSSAS SVDRCSFASDAHD +DSS
Sbjct  1    MPELGFQEFRSGIGIRSVRDVSPDSVIFTGDSNFSLFSSASGSVDRCSFASDAHD-QDSS  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQ-IADNSEIETEDENL  454
             SD SQ HLAGHE  +A   + +D     VH    L RKEKAKVQ +  NSE+ETEDENL
Sbjct  60   VSDVSQ-HLAGHECREALGSKVTDPNKAIVHKNSHLGRKEKAKVQKLETNSEVETEDENL  118

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
            ++DSARNSFSQALKECQDRR RS   LKKPDR RPASLDLNN+V N ++SSSP+FGVMK+
Sbjct  119  SLDSARNSFSQALKECQDRRFRSEFLLKKPDRPRPASLDLNNAVINTSHSSSPRFGVMKR  178

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              VTTSR G+FPSP TPNYR+SS+G+QKGWSSERVPLHS+
Sbjct  179  TPVTTSRAGSFPSPRTPNYRHSSVGVQKGWSSERVPLHSA  218



>ref|XP_010320329.1| PREDICTED: uncharacterized protein LOC101252176 isoform X2 [Solanum 
lycopersicum]
Length=578

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 174/221 (79%), Gaps = 11/221 (5%)
 Frame = +2

Query  119  MAELGFRDQASGF----RARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            M ELGF+D  SG       RDVSPDSVI+T DSN S+FSSAS SVDRCSFASDAHD +DS
Sbjct  1    MPELGFQDSRSGLGFSRSVRDVSPDSVIYTGDSNFSIFSSASGSVDRCSFASDAHD-QDS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIAD-NSEIETEDEN  451
            S SD SQ HLAGHE  +AS G  +D     +H    + RKEKAKVQ A+ NSEIETEDEN
Sbjct  60   SVSDVSQ-HLAGHECREASGGTVTDPNKAMLHRNSHIGRKEKAKVQKAEKNSEIETEDEN  118

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
            L++DSARNSFSQALKECQDRR  SG  LKKPDRRRPASLDLNN+V N  +SSSP+FG+MK
Sbjct  119  LSLDSARNSFSQALKECQDRRFGSGSLLKKPDRRRPASLDLNNAVINTCHSSSPRFGIMK  178

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  +TTSR G F SP TP+YR+SS+G+QKGWSSERVPLHS+
Sbjct  179  KTPITTSRVGTFLSPRTPSYRHSSVGVQKGWSSERVPLHSA  219



>emb|CDP01326.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 166/224 (74%), Gaps = 16/224 (7%)
 Frame = +2

Query  119  MAELG-FRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELG F+DQ SGF ARD SPDSVIFTADSN S+FSS SASVDRCSFASD  D +DS  S
Sbjct  1    MQELGTFQDQRSGFGARDFSPDSVIFTADSNFSIFSSNSASVDRCSFASDVPD-QDSCLS  59

Query  296  DTSQP-HLAGHEFHDASHGRASDRKTP-----------AVHL-SRKEKAKVQIADNSEIE  436
            D SQ  HLAGHE  + S  R      P           +VHL +RK+KAKVQ  ++SE+E
Sbjct  60   DNSQSQHLAGHELREGSGSRGGPYADPDPHKFTVHNKNSVHLCARKQKAKVQELESSEVE  119

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsv-tnaansssP  613
            TED+N  +DSARNSFSQALKECQDRRSR     KKPDRRRPASLDLNNSV + AANSSSP
Sbjct  120  TEDDNSIIDSARNSFSQALKECQDRRSRLDASRKKPDRRRPASLDLNNSVISTAANSSSP  179

Query  614  QFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
             FGVMKK      R G FPSPGTP+YR++S+G+QKGWSSERVPL
Sbjct  180  SFGVMKKHSAVNRRTGTFPSPGTPSYRHTSVGVQKGWSSERVPL  223



>ref|XP_011074420.1| PREDICTED: uncharacterized protein LOC105159160 [Sesamum indicum]
Length=579

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 166/219 (76%), Gaps = 9/219 (4%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M E GF+D  SGFRARD+SPDSVIFTA+SN SLFSSASASV+RCSFASD  D +DS  S 
Sbjct  1    MPEPGFQDLRSGFRARDISPDSVIFTAESNFSLFSSASASVERCSFASDVPD-QDSVASV  59

Query  299  TSQPHLAGHEFHDASHGRASD-RKTPAVH-----LSRKEKAKVQIADNSEIET-EDENLA  457
             SQ HLAGHE  +   G   D  KT  V      LSRKEKAK    D+SE ET EDEN+A
Sbjct  60   VSQ-HLAGHELSEVMSGPDPDPNKTTLVQKNSISLSRKEKAKAHKLDSSEAETTEDENIA  118

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
            +DSARNSFSQALKECQDRR RS + LKK DRRRPASLDLNNSVTN  NSSSP+ G MKK 
Sbjct  119  IDSARNSFSQALKECQDRRLRSEILLKKTDRRRPASLDLNNSVTNVVNSSSPRLGAMKKT  178

Query  638  YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              +T R G FPSPGTPNYR+ S+GIQKGWSSERVPL +S
Sbjct  179  STSTRRTGTFPSPGTPNYRHPSVGIQKGWSSERVPLQTS  217



>gb|EYU36309.1| hypothetical protein MIMGU_mgv1a004146mg [Erythranthe guttata]
Length=542

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 158/219 (72%), Gaps = 16/219 (7%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            MAELGF+D  SGFRARD+SPDSVIFT +SN SLFSSASASV+RCSF SD  D +DS  S 
Sbjct  1    MAELGFQDSRSGFRARDLSPDSVIFTPESNFSLFSSASASVERCSFTSDIPD-QDSVSSA  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------AVHLSRKEKAKVQIADNSEIET-EDENLA  457
             SQ HLA H+      G   D   P      ++ LS+K KAKVQ  D+S+ +T EDEN+A
Sbjct  60   LSQQHLAVHDLSQELSGPDPDPNKPISVHKNSITLSKKGKAKVQKLDSSDADTTEDENVA  119

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
             DSARNSFSQALKECQDRR RS V LKKP+ +RPASLDL        NSSSP+  +MKK 
Sbjct  120  ADSARNSFSQALKECQDRRFRSEVLLKKPNHQRPASLDL--------NSSSPRLKIMKKP  171

Query  638  YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               T R   FPSPGTPNYR+SS+G+QKGWSSER+PLHS+
Sbjct  172  SSATPRTANFPSPGTPNYRHSSVGVQKGWSSERIPLHSN  210



>gb|EYU36308.1| hypothetical protein MIMGU_mgv1a004146mg [Erythranthe guttata]
Length=541

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 158/219 (72%), Gaps = 17/219 (8%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            MAELGF+D  SGFRARD+SPDSVIFT +SN SLFSSASASV+RCSF SD  D +DS  S 
Sbjct  1    MAELGFQDSRSGFRARDLSPDSVIFTPESNFSLFSSASASVERCSFTSDIPD-QDSVSSA  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------AVHLSRKEKAKVQIADNSEIET-EDENLA  457
             SQ HLA H+      G   D   P      ++ LS+K KAKVQ  D+S+ +T EDEN+A
Sbjct  60   LSQ-HLAVHDLSQELSGPDPDPNKPISVHKNSITLSKKGKAKVQKLDSSDADTTEDENVA  118

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
             DSARNSFSQALKECQDRR RS V LKKP+ +RPASLDL        NSSSP+  +MKK 
Sbjct  119  ADSARNSFSQALKECQDRRFRSEVLLKKPNHQRPASLDL--------NSSSPRLKIMKKP  170

Query  638  YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               T R   FPSPGTPNYR+SS+G+QKGWSSER+PLHS+
Sbjct  171  SSATPRTANFPSPGTPNYRHSSVGVQKGWSSERIPLHSN  209



>ref|XP_007017208.1| Remorin family protein isoform 2 [Theobroma cacao]
 gb|EOY14433.1| Remorin family protein isoform 2 [Theobroma cacao]
Length=579

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 160/229 (70%), Gaps = 24/229 (10%)
 Frame = +2

Query  119  MAELGFRDQA----SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            MAELGF++Q+    SG+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS
Sbjct  1    MAELGFQEQSAVRSSGYRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASD----RKTPAVH----LSRK-EKAKVQIADNSEIE-  436
              S+ S  HLAGHE  D +   +       K   VH    LSRK EK KVQ  +N+E   
Sbjct  60   LASELSL-HLAGHEGGDQNESLSGPDLDPNKAMTVHKHSRLSRKGEKVKVQKGENNEAHI  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
             EDEN  +DSARNSFS ALKECQDRR+RS   LK PDRRRPASLDL     N  ++SSP+
Sbjct  119  VEDENQLIDSARNSFSLALKECQDRRTRSEALLKNPDRRRPASLDL-----NNVSASSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRYSSM---GIQKGWSSERVPLHSS  754
             G MKK  V T + GAFPSPGTP+Y +      G+QKGWSSERVPLH++
Sbjct  174  LGAMKKSSVATRKSGAFPSPGTPSYHHHHHSSAGMQKGWSSERVPLHNN  222



>ref|XP_007017207.1| Remorin family protein isoform 1 [Theobroma cacao]
 gb|EOY14432.1| Remorin family protein isoform 1 [Theobroma cacao]
Length=581

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 160/229 (70%), Gaps = 24/229 (10%)
 Frame = +2

Query  119  MAELGFRDQA----SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDS  286
            MAELGF++Q+    SG+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS
Sbjct  1    MAELGFQEQSAVRSSGYRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DS  59

Query  287  SFSDTSQPHLAGHEFHDASHGRASD----RKTPAVH----LSRK-EKAKVQIADNSEIE-  436
              S+ S  HLAGHE  D +   +       K   VH    LSRK EK KVQ  +N+E   
Sbjct  60   LASELSL-HLAGHEGGDQNESLSGPDLDPNKAMTVHKHSRLSRKGEKVKVQKGENNEAHI  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
             EDEN  +DSARNSFS ALKECQDRR+RS   LK PDRRRPASLDL     N  ++SSP+
Sbjct  119  VEDENQLIDSARNSFSLALKECQDRRTRSEALLKNPDRRRPASLDL-----NNVSASSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRYSSM---GIQKGWSSERVPLHSS  754
             G MKK  V T + GAFPSPGTP+Y +      G+QKGWSSERVPLH++
Sbjct  174  LGAMKKSSVATRKSGAFPSPGTPSYHHHHHSSAGMQKGWSSERVPLHNN  222



>ref|XP_002282806.2| PREDICTED: uncharacterized protein LOC100257562 [Vitis vinifera]
 emb|CBI19509.3| unnamed protein product [Vitis vinifera]
Length=570

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 157/220 (71%), Gaps = 16/220 (7%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELGF+DQ+    G  ARD SPDSVIFT +SN SLFSSASASVDRCSFASD HDH DS 
Sbjct  1    MAELGFQDQSLLRFGLGARDASPDSVIFTQESNFSLFSSASASVDRCSFASDVHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVH-----LSRKEKAKVQIADNSEIETEDENL  454
             S+ S  HLAGH+  + S G         VH     + ++EKAKV + ++ ++E E+ENL
Sbjct  60   ASEVSL-HLAGHDLQETSSGPDLIPNKATVHKHSRLIRKEEKAKV-LKEDKQVEAEEENL  117

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
             +DSARNSFS ALKECQDRRSRS    KK DRRRPASLDL     N A SSSP+ G MKK
Sbjct  118  VLDSARNSFSLALKECQDRRSRSEALSKKHDRRRPASLDL-----NNATSSSPRLGGMKK  172

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               ++ R G FPSPGTPNYR+S+ GIQKGWSSERVP H++
Sbjct  173  SSASSRRSGTFPSPGTPNYRHSNFGIQKGWSSERVPSHTN  212



>ref|XP_010112186.1| hypothetical protein L484_009552 [Morus notabilis]
 gb|EXC32852.1| hypothetical protein L484_009552 [Morus notabilis]
Length=571

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 156/223 (70%), Gaps = 22/223 (10%)
 Frame = +2

Query  119  MAELGFRDQAS--------GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHD  274
            M ELGF +Q+S        G RARD SPDSVIFT +SNLSLFSSASASVDRCSFASDAHD
Sbjct  1    MPELGFPEQSSLLPAAARSGLRARDASPDSVIFTLESNLSLFSSASASVDRCSFASDAHD  60

Query  275  HEDSSFSDTSQPHLAGH--EFHDASHGRASDRKTPAVHLSRKEKAK-VQIADNSEIETED  445
            H DS  S+ S  H A    E  ++S G   D   PA+H++R  K K V++    + E  D
Sbjct  61   H-DSIVSEISL-HFAAQDSEQQESSSGPDPDPNKPAIHINRNRKGKKVKV----QKEESD  114

Query  446  ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGV  625
              +A+DSAR+SFS ALKECQ+RRSRS    KK DRRRPASLDLNN+  ++     P+   
Sbjct  115  GEVALDSARSSFSLALKECQERRSRSEALSKKQDRRRPASLDLNNATASS-----PRLVT  169

Query  626  MKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            +KK  +T+ R G FPSPGTPNYR++S+G+QKGWSSERVPLHS+
Sbjct  170  IKKASLTSRRSGNFPSPGTPNYRHASVGMQKGWSSERVPLHSN  212



>ref|XP_012071648.1| PREDICTED: uncharacterized protein LOC105633635 [Jatropha curcas]
 ref|XP_012071649.1| PREDICTED: uncharacterized protein LOC105633635 [Jatropha curcas]
 gb|KDP38327.1| hypothetical protein JCGZ_04252 [Jatropha curcas]
Length=593

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 163/242 (67%), Gaps = 36/242 (15%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M E+GF+DQ+S   GFRARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MPEIGFQDQSSTRSGFRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDR-DSL  59

Query  290  FSDTSQPHLAGHE-----------FHDASHG-------------RASDRKTPA-VHLSRK  394
             S+ S  HLAG E            H+ S G              ++++  PA   L RK
Sbjct  60   ASEISL-HLAGRETPIGGGIGGNDLHETSSGPDRDPGPNKLITVYSNNKNAPAHSRLFRK  118

Query  395  -EKAKVQIADN-SEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASL  568
             EKAK +  DN + IE EDE+   DSARNSFS ALKECQ+RRSRS    KKPDRRRPASL
Sbjct  119  GEKAKAEKEDNKATIEVEDESHLPDSARNSFSLALKECQERRSRSEAISKKPDRRRPASL  178

Query  569  DLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            DLNN +  ++    P+ G MKK   ++ + G FPSPGTPNYR++S+G+QKGWSSERVPLH
Sbjct  179  DLNNVIAASS----PRLGAMKKSSTSSRKSGTFPSPGTPNYRHASVGMQKGWSSERVPLH  234

Query  749  SS  754
            ++
Sbjct  235  TN  236



>ref|XP_004142866.1| PREDICTED: uncharacterized protein LOC101202771 [Cucumis sativus]
 gb|KGN62497.1| hypothetical protein Csa_2G357200 [Cucumis sativus]
Length=589

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 155/223 (70%), Gaps = 19/223 (9%)
 Frame = +2

Query  125  ELGFRDQAS----GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSF  292
            E+GF+DQ +    GFRARD SPDSVI+  +S+ SLFSSASASV+RCSFAS+AHD  DS  
Sbjct  11   EMGFQDQTASSRPGFRARDSSPDSVIYALESSFSLFSSASASVERCSFASEAHD-RDSLI  69

Query  293  SDTSQPHLAGHE--FHDASHGRASDRKTPAVH------LSRKEKAKVQIADNSEIETEDE  448
            S+ S  HLAGH+   H++  G   D   PA+        ++ EKAK    D+S ++ EDE
Sbjct  70   SEISL-HLAGHDEGNHESCGGPDPDPNKPALSNKHSRLYTKGEKAKANQKDDSNVDLEDE  128

Query  449  NLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVM  628
            N  VDSARNSFS ALKECQD RSRS    +K DRRRPASLDL     NA  +SSP+   +
Sbjct  129  NRTVDSARNSFSLALKECQDHRSRSEAQSRKLDRRRPASLDL----NNATTTSSPRLAAV  184

Query  629  KKV-YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            KK   V+T + G FPSPGTPNYR++S G+QKGWSSERVPLH++
Sbjct  185  KKNPVVSTRKTGTFPSPGTPNYRHNSFGMQKGWSSERVPLHNN  227



>ref|XP_008444612.1| PREDICTED: uncharacterized protein LOC103487882 [Cucumis melo]
Length=589

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 155/223 (70%), Gaps = 19/223 (9%)
 Frame = +2

Query  125  ELGFRDQAS----GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSF  292
            E+GF++Q +    GFRARD SPDSVI+  +S+ SLFSSASASV+RCSFAS+AHD  DS  
Sbjct  11   EMGFQEQTASSRPGFRARDSSPDSVIYALESSFSLFSSASASVERCSFASEAHD-RDSLI  69

Query  293  SDTSQPHLAGHE--FHDASHGRASDRKTPAVH------LSRKEKAKVQIADNSEIETEDE  448
            S+ S  HLAGH+   H++  G   D   PA+        ++ EKAK    D+S ++ EDE
Sbjct  70   SEISL-HLAGHDEGNHESFGGPDPDPNKPALSNKHSRLYTKGEKAKANQKDDSNVDLEDE  128

Query  449  NLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVM  628
            N  VDSARNSFS ALKECQD RSRS    +K DRRRPASLDL     NA  +SSP+   +
Sbjct  129  NRTVDSARNSFSLALKECQDHRSRSEAQSRKLDRRRPASLDL----NNATTTSSPRLAAV  184

Query  629  KK-VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            KK   V+T + G FPSPGTPNYR++S G+QKGWSSERVPLH++
Sbjct  185  KKNPVVSTRKTGTFPSPGTPNYRHNSFGMQKGWSSERVPLHNN  227



>gb|KJB58494.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=501

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 149/227 (66%), Gaps = 22/227 (10%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +         P           + LSRK EK KV+  +N    
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGEKVKVKTEENGPAH  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  119  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  174  LGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  220



>gb|KJB58491.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
 gb|KJB58496.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=578

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 149/227 (66%), Gaps = 22/227 (10%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +         P           + LSRK EK KV+  +N    
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGEKVKVKTEENGPAH  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  119  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  174  LGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  220



>gb|KJB58495.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=576

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 149/227 (66%), Gaps = 22/227 (10%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +         P           + LSRK EK KV+  +N    
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGEKVKVKTEENGPAH  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  119  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  174  LGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  220



>gb|KJB58492.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=497

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 149/227 (66%), Gaps = 22/227 (10%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +         P           + LSRK EK KV+  +N    
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGEKVKVKTEENGPAH  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  119  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  174  LGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  220



>gb|KHG13345.1| hypothetical protein F383_04792 [Gossypium arboreum]
Length=578

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 150/227 (66%), Gaps = 22/227 (10%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +   +     P           + LSRK EK KV+  ++    
Sbjct  60   ASELSL-HMAGQESGDQNESSSGPDPDPDPNKAITVPKHIRLSRKGEKVKVKTEESGPAH  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  119  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  173

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNY-RYSSMGIQKGWSSERVPLHSS  754
             G +KK  V   + GAFPSPGTPNY  +SS+G+QKGWSSERVPLHS+
Sbjct  174  LGTVKKSSVVPRKLGAFPSPGTPNYHHHSSVGMQKGWSSERVPLHSN  220



>emb|CAN66979.1| hypothetical protein VITISV_004452 [Vitis vinifera]
Length=556

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 158/262 (60%), Gaps = 56/262 (21%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHE---  280
            MAELGF+DQ+    G  ARD SPDSVIFT +SN SLFSSASASVDRCSFASD HDH+   
Sbjct  1    MAELGFQDQSLLRFGLGARDASPDSVIFTQESNFSLFSSASASVDRCSFASDVHDHDSLA  60

Query  281  ------------------DSSFSDTS---------------------QPHLAGHEFHDAS  343
                              D  FS+ +                       HLAGH+  + S
Sbjct  61   SEVSLDRIIGGALVLKIMDLIFSNPTGDGMRRIQLVRRFRRVEIFDLMQHLAGHDLQETS  120

Query  344  HGRASDRKTPAVH-----LSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQD  508
             G         VH     + ++EKAKV + ++ ++E E+ENL +DSARNSFS ALKECQD
Sbjct  121  SGPDLIPNKATVHKHSRLIRKEEKAKV-LKEDKQVEAEEENLVLDSARNSFSLALKECQD  179

Query  509  RRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPN  688
            RRSRS    KK DRRRPASLDL     N A SSSP+ G MKK   ++ R G FPSPGTPN
Sbjct  180  RRSRSEALSKKHDRRRPASLDL-----NNATSSSPRLGGMKKSSASSRRSGTFPSPGTPN  234

Query  689  YRYSSMGIQKGWSSERVPLHSS  754
            YR+S+ GIQKGWSSERVP H++
Sbjct  235  YRHSNFGIQKGWSSERVPSHTN  256



>gb|KJB58493.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=575

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 147/227 (65%), Gaps = 25/227 (11%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP----------AVHLSRK-EKAKVQIADNSEIE  436
             S+ S  H+AG E  D +         P           + LSRK EK K    +N    
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGEKVK---EENGPAH  115

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            TEDE    DSARNSFS ALKECQDR++RS   LK PDRRRPASLDL     N  +  SP+
Sbjct  116  TEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPR  170

Query  617  FGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  171  LGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  217



>gb|ACP27605.1| remorin-like protein [Dimocarpus longan]
Length=361

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 147/219 (67%), Gaps = 21/219 (10%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R   SG+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS  S+ S  HL
Sbjct  6    RSMRSGYRARDTSPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSLASEISL-HL  63

Query  317  AG-----HEFHDASHGRASDRKTPAVH--------LSRKEKAKVQIADNSEIETEDENLA  457
            AG     H+   +S G   D ++            L + EK KVQ  DN +   +DEN  
Sbjct  64   AGQDRENHQQESSSGGPDRDPESNKHSNNNNHSRLLRKAEKVKVQKEDN-DATIDDENRP  122

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
            +DSARNSFS +LKECQ+RRSR+ +  KK DRRRPASLDL     N A+ SSP+ G MKK 
Sbjct  123  LDSARNSFSLSLKECQERRSRADILSKKLDRRRPASLDL-----NNASISSPRLGNMKKS  177

Query  638  YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               + +   FPSPGTPNYR +++G+QKGWSSERVPL ++
Sbjct  178  SNLSRKSSTFPSPGTPNYRQANVGMQKGWSSERVPLQTA  216



>gb|AGC39092.2| remorin-1 protein [Dimocarpus longan]
Length=572

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 147/219 (67%), Gaps = 21/219 (10%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R   SG+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS  S+ S  HL
Sbjct  6    RSMRSGYRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSLASEISL-HL  63

Query  317  AG-----HEFHDASHGRASDRKTPAVH--------LSRKEKAKVQIADNSEIETEDENLA  457
            AG     H+   +S G   D ++            L + EK KVQ  DN +   +DEN  
Sbjct  64   AGQDRENHQQESSSGGPDRDPESNKHSNNNNHSRLLRKAEKVKVQKEDN-DATIDDENRP  122

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
            +DSARNSFS +LKECQ+RRSR+ +  KK DRRRPASLDL     N A+ SSP+ G MKK 
Sbjct  123  LDSARNSFSLSLKECQERRSRADILSKKLDRRRPASLDL-----NNASISSPRLGNMKKS  177

Query  638  YVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               + +   FPSPGTPNYR +++G+QKGWSSERVPL ++
Sbjct  178  SNLSRKSSTFPSPGTPNYRQANVGMQKGWSSERVPLQTA  216



>gb|KCW68729.1| hypothetical protein EUGRSUZ_F02334 [Eucalyptus grandis]
Length=523

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 151/221 (68%), Gaps = 22/221 (10%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELG    A G   RD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS  S+
Sbjct  1    MVELG----AFGAAPRDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDR-DSLASE  55

Query  299  TSQPHLAGHEFHDASHGR----ASDRKTPAVH----LSRK-EKAKVQIADNSEIETEDEN  451
             S  HLAG E  D+S G      S+   PAVH    LSRK +KAKV+I D  + + ED N
Sbjct  56   ISL-HLAGRE-RDSSSGPDPDPNSNPNKPAVHKHSRLSRKADKAKVRIQDE-DGDVEDNN  112

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
              +DSAR+SFS ALKECQ+RRSRS    +K D+RRPAS+D NN   ++     P+   +K
Sbjct  113  HTIDSARSSFSLALKECQERRSRSEALSRKSDKRRPASVDFNNPTASS-----PRLEAVK  167

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  + T + G FPSPGTPNYR++++G+QKGWSSERVPL SS
Sbjct  168  KSSMATRQSGTFPSPGTPNYRHANVGLQKGWSSERVPLQSS  208



>gb|AGN88925.1| remorin-1 protein [Dimocarpus longan]
Length=565

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 146/215 (68%), Gaps = 21/215 (10%)
 Frame = +2

Query  149  SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLAG--  322
            SG+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS  S+ S  HLAG  
Sbjct  3    SGYRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSLASEISL-HLAGQD  60

Query  323  ---HEFHDASHGRASDRKTPAVH--------LSRKEKAKVQIADNSEIETEDENLAVDSA  469
               H+   +S G   D ++            L + EK KVQ  DN +   +DEN  +DSA
Sbjct  61   RENHQQESSSGGPDRDPESNKHSNNNNHSRLLRKAEKVKVQKEDN-DATIDDENRPLDSA  119

Query  470  RNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTT  649
            RNSFS +LKECQ+RRSR+ +  KK DRRRPASLDL     N A+ SSP+ G MKK    +
Sbjct  120  RNSFSLSLKECQERRSRADILSKKLDRRRPASLDL-----NNASISSPRLGNMKKSSNLS  174

Query  650  SRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
             +   FPSPGTPNYR +++G+QKGWSSERVPL ++
Sbjct  175  RKSSTFPSPGTPNYRQANVGMQKGWSSERVPLQTA  209



>ref|XP_010061739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104449320 
[Eucalyptus grandis]
Length=564

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 151/221 (68%), Gaps = 22/221 (10%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELG    A G   RD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS  S+
Sbjct  1    MVELG----AFGAAPRDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDR-DSLASE  55

Query  299  TSQPHLAGHEFHDASHGR----ASDRKTPAVH----LSRK-EKAKVQIADNSEIETEDEN  451
             S  HLAG E  D+S G      S+   PAVH    LSRK +KAKV+I D  + + ED N
Sbjct  56   ISL-HLAGRE-RDSSSGPDPDPNSNPNKPAVHKHSRLSRKADKAKVRIQDE-DGDVEDNN  112

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
              +DSAR+SFS ALKECQ+RRSRS    +K D+RRPAS+D NN   ++     P+   +K
Sbjct  113  HTIDSARSSFSLALKECQERRSRSEALSRKSDKRRPASVDFNNPTASS-----PRLEAVK  167

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  + T + G FPSPGTPNYR++++G+QKGWSSERVPL SS
Sbjct  168  KSSMATRQSGTFPSPGTPNYRHANVGLQKGWSSERVPLQSS  208



>ref|XP_002510204.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF52391.1| DNA binding protein, putative [Ricinus communis]
Length=601

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 152/245 (62%), Gaps = 40/245 (16%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAEL +++++S   G+RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELVYQERSSSRSGYRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDR-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKT---------PAVHLSRKEKAKVQIA--------  418
             S+ S  HLAGHE      G    R+T         P   +      K Q A        
Sbjct  60   ASEISL-HLAGHEVGSGVGGGNELRETLSGPDRDPDPNKLVIHSSNTKQQHAHAHSRLFK  118

Query  419  ----------DNS----EIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRR  556
                      D+S    E+  ED +  +DSARNSFS ALKECQ+RRSRS    KK DRRR
Sbjct  119  KVEKVKVQKEDSSKAAIELLEEDSSNLIDSARNSFSLALKECQERRSRSEAVTKKADRRR  178

Query  557  PASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSER  736
            PASLDLNN +  ++    P+   MKK   ++ + G FPSPGTPNYR++S+G+QKGWSSER
Sbjct  179  PASLDLNNVIAASS----PRLSGMKKSTTSSRKSGTFPSPGTPNYRHASVGMQKGWSSER  234

Query  737  VPLHS  751
            VPLH+
Sbjct  235  VPLHN  239



>ref|XP_006374925.1| hypothetical protein POPTR_0014s02780g [Populus trichocarpa]
 gb|ERP52722.1| hypothetical protein POPTR_0014s02780g [Populus trichocarpa]
Length=584

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 149/223 (67%), Gaps = 19/223 (9%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M EL +++Q+S   GFRARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MPELVYQEQSSSRSGFRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHG---RASDRKTPAVH--LSRKEKAKVQIA--DNSEIETEDE  448
             S+ S    AGH+  + S     R ++++    H  LSRK +    +   DN     ED+
Sbjct  60   ASEISLHLAAGHDQQENSSSGPDRNNNKQKQHTHTRLSRKAEKVKAVKKEDNRISSVEDD  119

Query  449  NLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVM  628
               +DSAR+SFS ALKECQ+RR RS    KKPDRRRPASLDL     N   SSSP+ G M
Sbjct  120  IHLLDSARSSFSLALKECQERRPRSEAITKKPDRRRPASLDL----NNVVTSSSPRLGNM  175

Query  629  KKVYVTTSR-GGAFPSPGTPNY---RYSSMGIQKGWSSERVPL  745
            KK    +SR  G FPSPGTPNY    +SS+G+QKGWSSERVPL
Sbjct  176  KKSIACSSRKSGTFPSPGTPNYLNQYHSSVGMQKGWSSERVPL  218



>ref|XP_006374924.1| hypothetical protein POPTR_0014s02780g [Populus trichocarpa]
 gb|ERP52721.1| hypothetical protein POPTR_0014s02780g [Populus trichocarpa]
Length=529

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 149/223 (67%), Gaps = 19/223 (9%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M EL +++Q+S   GFRARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MPELVYQEQSSSRSGFRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHG---RASDRKTPAVH--LSRKEKAKVQIA--DNSEIETEDE  448
             S+ S    AGH+  + S     R ++++    H  LSRK +    +   DN     ED+
Sbjct  60   ASEISLHLAAGHDQQENSSSGPDRNNNKQKQHTHTRLSRKAEKVKAVKKEDNRISSVEDD  119

Query  449  NLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVM  628
               +DSAR+SFS ALKECQ+RR RS    KKPDRRRPASLDL     N   SSSP+ G M
Sbjct  120  IHLLDSARSSFSLALKECQERRPRSEAITKKPDRRRPASLDL----NNVVTSSSPRLGNM  175

Query  629  KKVYVTTSR-GGAFPSPGTPNY---RYSSMGIQKGWSSERVPL  745
            KK    +SR  G FPSPGTPNY    +SS+G+QKGWSSERVPL
Sbjct  176  KKSIACSSRKSGTFPSPGTPNYLNQYHSSVGMQKGWSSERVPL  218



>ref|XP_006473309.1| PREDICTED: uncharacterized protein LOC102607337 isoform X2 [Citrus 
sinensis]
Length=577

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 143/230 (62%), Gaps = 28/230 (12%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSS SASVDRCSFASDAHDH DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSTSASVDRCSFASDAHDH-DSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQI------ADN  424
             S  HL   E  ++  G     + P              H+ R  K   Q+       ++
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKASRAQKED  118

Query  425  SEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaans  604
            S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDL     NA   
Sbjct  119  SVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDL----NNATFI  170

Query  605  ssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            SSP+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  171  SSPRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  220



>ref|XP_002302434.2| hypothetical protein POPTR_0002s12690g [Populus trichocarpa]
 gb|EEE81707.2| hypothetical protein POPTR_0002s12690g [Populus trichocarpa]
Length=595

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 142/229 (62%), Gaps = 32/229 (14%)
 Frame = +2

Query  113  SAMAELG-FRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHE  280
            S M EL   RDQ S   GFRARD SPDSVIFT +SN SLFSS SASVDRCSFASDA+DHE
Sbjct  16   SRMPELVRHRDQISSRSGFRARDASPDSVIFTLESNFSLFSSTSASVDRCSFASDAYDHE  75

Query  281  DSSFSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRK-------------EKAKVQIAD  421
                +     HLA H+  ++        K   V  + K             EKAKVQ   
Sbjct  76   --YLASEISLHLAAHDQQESYWSGPDPNKLNTVGNNNKQHTHTHTRPSRKAEKAKVQ---  130

Query  422  NSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaan  601
                + ED+N  +DSAR+SFS ALKECQ+ RSRS    KKPDRRRPASLDL     N   
Sbjct  131  ----KEEDDNNLLDSARSSFSLALKECQESRSRSDAITKKPDRRRPASLDL----NNVVT  182

Query  602  sssPQFGVMKKVYVTTSR-GGAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
            S SP+ G MKK  V +SR  G FPSPGTPNY +SS G+QKGWSSERVPL
Sbjct  183  SPSPRLGNMKKSIVYSSRKSGTFPSPGTPNY-HSSAGMQKGWSSERVPL  230



>ref|XP_006473308.1| PREDICTED: uncharacterized protein LOC102607337 isoform X1 [Citrus 
sinensis]
Length=579

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 143/232 (62%), Gaps = 30/232 (13%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSS SASVDRCSFASDAHDH DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSTSASVDRCSFASDAHDH-DSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQI--------A  418
             S  HL   E  ++  G     + P              H+ R  K   Q+         
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKGTASRAQK  118

Query  419  DNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaa  598
            ++S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDL     NA 
Sbjct  119  EDSVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDL----NNAT  170

Query  599  nsssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              SSP+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  171  FISSPRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  222



>ref|XP_011029757.1| PREDICTED: uncharacterized protein LOC105129411 [Populus euphratica]
 ref|XP_011029766.1| PREDICTED: uncharacterized protein LOC105129411 [Populus euphratica]
 ref|XP_011029774.1| PREDICTED: uncharacterized protein LOC105129411 [Populus euphratica]
Length=587

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 146/227 (64%), Gaps = 24/227 (11%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M EL +++Q+S   GFRARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MPELVYQEQSSSRSGFRARDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAV---------HLSRKEKAKVQIA--DNSEIE  436
             S+ S    AGH+  + S     DR               LSRK +    +   DN    
Sbjct  60   ASEISLHLAAGHDQQENSSS-GPDRNNSKQKQQQQHTHTRLSRKAEKVKAVKKEDNRISS  118

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
             ED+   +DSAR+SFS ALKECQ+RRSRS    KKPDRRRPASLDL     N   SSSP+
Sbjct  119  VEDDIHLLDSARSSFSLALKECQERRSRSEAITKKPDRRRPASLDL----NNVVTSSSPR  174

Query  617  FGVMKKVYVTTSR-GGAFPSPGTPNY---RYSSMGIQKGWSSERVPL  745
             G MKK    +SR  G FPSPGTPNY    +SS+G+QKGWSSERVPL
Sbjct  175  LGNMKKSIACSSRKSGTFPSPGTPNYLNQYHSSVGMQKGWSSERVPL  221



>gb|KJB63843.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
 gb|KJB63854.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=562

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 149/227 (66%), Gaps = 28/227 (12%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K+C+DR+ RS         R P SLDL     N  ++SSP+ G
Sbjct  119  DENQLIDSARNSFSLATKDCKDRKIRSEA------SRIPTSLDL-----NNVSASSPRLG  167

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  168  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  214



>gb|KJB63852.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=568

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 149/227 (66%), Gaps = 28/227 (12%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K+C+DR+ RS         R P SLDL     N  ++SSP+ G
Sbjct  119  DENQLIDSARNSFSLATKDCKDRKIRSEA------SRIPTSLDL-----NNVSASSPRLG  167

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  168  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  214



>gb|KJB63844.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
 gb|KJB63845.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
 gb|KJB63846.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
 gb|KJB63853.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=566

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 149/227 (66%), Gaps = 28/227 (12%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K+C+DR+ RS         R P SLDL     N  ++SSP+ G
Sbjct  119  DENQLIDSARNSFSLATKDCKDRKIRSEA------SRIPTSLDL-----NNVSASSPRLG  167

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  168  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  214



>gb|KJB63851.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=564

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 149/227 (66%), Gaps = 28/227 (12%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K+C+DR+ RS         R P SLDL     N  ++SSP+ G
Sbjct  119  DENQLIDSARNSFSLATKDCKDRKIRSEA------SRIPTSLDL-----NNVSASSPRLG  167

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  168  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  214



>ref|XP_006434750.1| hypothetical protein CICLE_v10000692mg [Citrus clementina]
 gb|ESR47990.1| hypothetical protein CICLE_v10000692mg [Citrus clementina]
Length=577

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 145/230 (63%), Gaps = 28/230 (12%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD +DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-QDSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQIA------DN  424
             S  HL   E  ++  G     + P              H+ R  K   Q+       ++
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKASRAQKED  118

Query  425  SEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaans  604
            S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDLNN+   ++  
Sbjct  119  SVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDLNNATFISS--  172

Query  605  ssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              P+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  173  --PRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  220



>gb|KHN35684.1| Hypothetical protein glysoja_037594 [Glycine soja]
Length=593

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 153/230 (67%), Gaps = 20/230 (9%)
 Frame = +2

Query  119  MAELGFRDQASGFR-ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELGF+++ S  R   D SPDSVIFT +SNLSLFSSASASVDRCSFASDAHDH DS  S
Sbjct  1    MRELGFQERRSWRRRGGDTSPDSVIFTLESNLSLFSSASASVDRCSFASDAHDH-DSLAS  59

Query  296  DTSQPHLAGHE--FHDASHGRASDRKTPAVHL--------SRKEKAKVQIADNSEI-ETE  442
            + S   LA  +   +     R +D  + A H          + EKAKVQ  ++S+  +TE
Sbjct  60   EISLRKLADPDPDLNKRQQQRHADTDSDAAHTKHRRNRFSGKGEKAKVQKEEDSDGGDTE  119

Query  443  DEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
            D N  L  DSARNSFS ALKECQDRRSRS    KK DRRRPASLDL N+     N SSP 
Sbjct  120  DGNQHLEFDSARNSFSLALKECQDRRSRSEALFKKHDRRRPASLDL-NNAIGNGNVSSPH  178

Query  617  FGV--MKKVYVTTSRGGA--FPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
             G+  MKK  + + R G+  FPSPGTPNY ++++ +QKGWSSERVPLH+S
Sbjct  179  LGLSAMKKSTLCSRRSGSGTFPSPGTPNYLHATVAMQKGWSSERVPLHTS  228



>gb|KDO84140.1| hypothetical protein CISIN_1g008047mg [Citrus sinensis]
Length=579

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 145/232 (63%), Gaps = 30/232 (13%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD +DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-QDSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQIA--------  418
             S  HL   E  ++  G     + P              H+ R  K   Q+         
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKGTASRAQK  118

Query  419  DNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaa  598
            ++S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDLNN+   ++
Sbjct  119  EDSVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDLNNATFISS  174

Query  599  nsssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
                P+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  175  ----PRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  222



>ref|XP_006434749.1| hypothetical protein CICLE_v10000692mg [Citrus clementina]
 gb|ESR47989.1| hypothetical protein CICLE_v10000692mg [Citrus clementina]
Length=579

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 145/232 (63%), Gaps = 30/232 (13%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD +DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-QDSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQIA--------  418
             S  HL   E  ++  G     + P              H+ R  K   Q+         
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKGTASRAQK  118

Query  419  DNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaa  598
            ++S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDLNN+   ++
Sbjct  119  EDSVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDLNNATFISS  174

Query  599  nsssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
                P+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  175  ----PRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  222



>gb|KDO84141.1| hypothetical protein CISIN_1g008047mg [Citrus sinensis]
Length=532

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 145/232 (63%), Gaps = 30/232 (13%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELGF++Q S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD +DS  S+
Sbjct  1    MPELGFQEQRSAYRARDSSPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-QDSLASE  59

Query  299  TSQPHLAGHEFHDASHGRASDRKTP------------AVHLSRKEKAKVQIA--------  418
             S  HL   E  ++  G     + P              H+ R  K   Q+         
Sbjct  60   ISL-HLGERERQESLSGSGGPDRDPDPNKVVTTTQQRNKHIRRLSKKAEQVKGTASRAQK  118

Query  419  DNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaa  598
            ++S    ED+N  +DSARNSFSQ+LKECQ+RR R+    +   RRRPASLDLNN+   ++
Sbjct  119  EDSVATAEDDNRTLDSARNSFSQSLKECQERRLRA----EALSRRRPASLDLNNATFISS  174

Query  599  nsssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
                P+ G MKK    + + G FPSPGTPNYR +S+G+ KGWSSERVPL ++
Sbjct  175  ----PRLGAMKKSSNLSRKTGTFPSPGTPNYRNASVGMHKGWSSERVPLQTT  222



>ref|XP_006601287.1| PREDICTED: uncharacterized protein LOC100792609 isoform X2 [Glycine 
max]
Length=599

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 159/254 (63%), Gaps = 45/254 (18%)
 Frame = +2

Query  119  MAELGFRDQASGFR-ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELGF+++ S  R   D SPDSVIFT +SNLSLFSSASASVDRCSFASDAHDH DS  S
Sbjct  1    MPELGFQERRSWRRRGGDTSPDSVIFTLESNLSLFSSASASVDRCSFASDAHDH-DSLAS  59

Query  296  DTSQPHLAGHEFHDASHGRA-----------------------SDRKTPAVH--------  382
            + S  HLA  + HD    R+                       +D  + AVH        
Sbjct  60   EISL-HLAVQD-HDGDFARSESWSGQDPDPDLNKRQQQQQQRHADTDSDAVHGKHRRNRF  117

Query  383  LSRKEKAKVQIADNSEI-ETEDEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRR  553
              ++EKAKVQ  ++S+  +TED N  L  DSARNSFS ALKECQDRRSRS    KK DRR
Sbjct  118  SGKREKAKVQKEEDSDGGDTEDGNQHLEFDSARNSFSLALKECQDRRSRSETLYKKHDRR  177

Query  554  RPASLDLnnsvtnaanss-sPQFGVMKKVYVTTSRGGA------FPSPGTPNYRYSSMGI  712
            RPASLDLNN++ N   SS   + G MKK  + T R G+      FPSPGTPNY ++S+ +
Sbjct  178  RPASLDLNNAIGNGNVSSPRLELGAMKKSTLCTRRSGSGSGNGNFPSPGTPNYLHASVAM  237

Query  713  QKGWSSERVPLHSS  754
            QKGWSSERVPLH+S
Sbjct  238  QKGWSSERVPLHTS  251



>ref|XP_006601286.1| PREDICTED: uncharacterized protein LOC100792609 isoform X1 [Glycine 
max]
Length=609

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 159/254 (63%), Gaps = 45/254 (18%)
 Frame = +2

Query  119  MAELGFRDQASGFR-ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELGF+++ S  R   D SPDSVIFT +SNLSLFSSASASVDRCSFASDAHDH DS  S
Sbjct  1    MPELGFQERRSWRRRGGDTSPDSVIFTLESNLSLFSSASASVDRCSFASDAHDH-DSLAS  59

Query  296  DTSQPHLAGHEFHDASHGRA-----------------------SDRKTPAVH--------  382
            + S  HLA  + HD    R+                       +D  + AVH        
Sbjct  60   EISL-HLAVQD-HDGDFARSESWSGQDPDPDLNKRQQQQQQRHADTDSDAVHGKHRRNRF  117

Query  383  LSRKEKAKVQIADNSEI-ETEDEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRR  553
              ++EKAKVQ  ++S+  +TED N  L  DSARNSFS ALKECQDRRSRS    KK DRR
Sbjct  118  SGKREKAKVQKEEDSDGGDTEDGNQHLEFDSARNSFSLALKECQDRRSRSETLYKKHDRR  177

Query  554  RPASLDLnnsvtnaanss-sPQFGVMKKVYVTTSRGGA------FPSPGTPNYRYSSMGI  712
            RPASLDLNN++ N   SS   + G MKK  + T R G+      FPSPGTPNY ++S+ +
Sbjct  178  RPASLDLNNAIGNGNVSSPRLELGAMKKSTLCTRRSGSGSGNGNFPSPGTPNYLHASVAM  237

Query  713  QKGWSSERVPLHSS  754
            QKGWSSERVPLH+S
Sbjct  238  QKGWSSERVPLHTS  251



>gb|KHG12312.1| hypothetical protein F383_19939 [Gossypium arboreum]
Length=566

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 147/227 (65%), Gaps = 28/227 (12%)
 Frame = +2

Query  119  MAELGFRDQ---ASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q    S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQISIGSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGRA----SDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +   +    +  K  AV      SRK EK K +  +N  +  +
Sbjct  60   ASEISL-HLAGHERGDQNESLSGPDPNTNKANAVLNHSRFSRKGEKVKAEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS ALK+C+DR+ RS         R P SLDL     N  ++SSP+ G
Sbjct  119  DENQLIDSARNSFSLALKDCKDRKIRSEA------SRIPTSLDL-----NNVSASSPRLG  167

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY      + G+QKG SSERVPLH++
Sbjct  168  TMKKGSVSTRKSGAFPSPGTPNYHQHNNLTAGMQKGSSSERVPLHNN  214



>ref|XP_007160859.1| hypothetical protein PHAVU_001G022700g [Phaseolus vulgaris]
 gb|ESW32853.1| hypothetical protein PHAVU_001G022700g [Phaseolus vulgaris]
Length=613

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 155/253 (61%), Gaps = 44/253 (17%)
 Frame = +2

Query  119  MAELGFRDQASGFRAR-----DVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHED  283
            M ELGF+++ S  RA      D SPDSVIFT +SNLSLFSSASASVDRCSFASDAHDH D
Sbjct  1    MRELGFQERRSWRRAGSRRGGDTSPDSVIFTLESNLSLFSSASASVDRCSFASDAHDH-D  59

Query  284  SSFSDTSQPHLAGHE-------------------FHDASHGRASDRKTPAVHL-------  385
            S  S+ S  HLA  E                    ++    R +D    A+H        
Sbjct  60   SLASEISL-HLAAQEHDGDFAHSESWSGPDPDLDLNNRQQQRRADADLDALHRKHHRNRF  118

Query  386  -SRKEKAKVQIADNSEI-ETEDEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRR  553
              + EKAKVQ  ++S+  +TED N  L  DSARNSFS ALKECQDRRSRS   LKK DRR
Sbjct  119  SGKGEKAKVQKEEDSDGGDTEDGNQLLEFDSARNSFSLALKECQDRRSRSEALLKKHDRR  178

Query  554  RPASLDLnnsvtnaansssPQFGV--MKKVYVTTSRGGA----FPSPGTPNYRYSSMGIQ  715
            RPASLDL N+     N SSP+ G+  MKK  V + R G+    FPSPGTPNY ++   +Q
Sbjct  179  RPASLDL-NNAVGNGNVSSPRLGLGAMKKSTVCSRRSGSGSANFPSPGTPNYLHAGAAMQ  237

Query  716  KGWSSERVPLHSS  754
            KGW SERVPLH+S
Sbjct  238  KGWCSERVPLHTS  250



>ref|XP_004292813.1| PREDICTED: uncharacterized protein LOC101314344 [Fragaria vesca 
subsp. vesca]
Length=570

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 140/216 (65%), Gaps = 27/216 (13%)
 Frame = +2

Query  140  DQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA  319
            +Q SG R RD SPDSVI+T +S+L   S++++ VDRCSFAS+A DH+ S+ S+ S P+ A
Sbjct  3    EQRSGLRIRDASPDSVIYTLESSLFSSSASAS-VDRCSFASEALDHDSSTASEIS-PNSA  60

Query  320  GHEFHD----ASHG--RASDRKTPAVH--------LSRK-EKAKVQIADNSEIETEDENL  454
             HE       +S G  R  D     +H         SRK EKAKVQ  D+     ++ +L
Sbjct  61   AHELRHQLEVSSSGADRDPDPNKSGLHSHHHHDVRRSRKGEKAKVQNQDH-----DNADL  115

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
            A+DSAR+SFS ALKECQDRRSRS    KK DR RPASLDLNN    +     P+ G +KK
Sbjct  116  AIDSARSSFSLALKECQDRRSRSEALTKKLDRPRPASLDLNNVTALS-----PRLGTLKK  170

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVP  742
              + + + G FPSPGTP YR++S+G+QKGWSSERVP
Sbjct  171  SSMASRKSGTFPSPGTPTYRHTSLGVQKGWSSERVP  206



>ref|XP_003544462.1| PREDICTED: uncharacterized protein LOC100782306 [Glycine max]
Length=611

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 155/248 (63%), Gaps = 40/248 (16%)
 Frame = +2

Query  119  MAELGFRDQASGFR-ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELGF+++ S  R   D SPDSVIFT +SNLSLFSSASASVDRCSFASDAHDH DS  S
Sbjct  3    MRELGFQERRSWRRRGGDTSPDSVIFTLESNLSLFSSASASVDRCSFASDAHDH-DSLAS  61

Query  296  DTSQPHLAGHEFHDA--------------------SHGRASDRKTPAVHL--------SR  391
            + S  HLA  + HD                        R +D  + A H          +
Sbjct  62   EISL-HLAAQD-HDGDFAHSESWSGPDPDLDPNKRQQQRHADTDSDAAHTKHRRNRFSGK  119

Query  392  KEKAKVQIADNSEI-ETEDEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPA  562
             EKAKVQ  ++S+  +TED N  L  DSARNSFS ALKECQDRRSRS    KK DRRRPA
Sbjct  120  GEKAKVQKEEDSDGGDTEDGNQHLEFDSARNSFSLALKECQDRRSRSEALFKKHDRRRPA  179

Query  563  SLDLnnsvtnaansssPQFGV--MKKVYVTTSRGGA--FPSPGTPNYRYSSMGIQKGWSS  730
            SLDL N+     N SSP  G+  MKK  + + R G+  FPSPGTPNY ++++ +QKGWSS
Sbjct  180  SLDL-NNAIGNGNVSSPHLGLSAMKKSTLCSRRSGSGTFPSPGTPNYLHATVAMQKGWSS  238

Query  731  ERVPLHSS  754
            ERVPLH+S
Sbjct  239  ERVPLHTS  246



>ref|XP_009795222.1| PREDICTED: uncharacterized protein LOC104241949 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009795223.1| PREDICTED: uncharacterized protein LOC104241949 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009795224.1| PREDICTED: uncharacterized protein LOC104241949 isoform X1 [Nicotiana 
sylvestris]
Length=515

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 132/221 (60%), Gaps = 45/221 (20%)
 Frame = +2

Query  119  MAELGFRDQ--ASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSF  292
            M+EL F+DQ  +  F  RDVSPDSVIFTAD + S        +DRCSF S +H       
Sbjct  1    MSELRFQDQRLSLIFGGRDVSPDSVIFTADFSASPS------LDRCSFTSLSH-------  47

Query  293  SDTSQPH---LAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIADNSEIETEDEN  451
                 PH   L G+EFH+A  G + D     VH    L RKEK K         + E++N
Sbjct  48   ----HPHFHHLTGYEFHEALGGPSPDLSKAMVHKNSHLRRKEKTK---------DREEKN  94

Query  452  LAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMK  631
            L +DSAR SFSQALKECQDRRS++G   KK DR++P   DL N+    A  SSP+FGVMK
Sbjct  95   LTLDSARKSFSQALKECQDRRSKAG---KKLDRQKP---DL-NNAIIKATHSSPRFGVMK  147

Query  632  KVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            K  VT S    FPSPGTPNY++    IQKGWSSE VPL S+
Sbjct  148  KTTVTASGACMFPSPGTPNYKHY---IQKGWSSEHVPLRSA  185



>ref|XP_004499051.1| PREDICTED: uncharacterized protein LOC101504376 isoform X1 [Cicer 
arietinum]
 ref|XP_004499052.1| PREDICTED: uncharacterized protein LOC101504376 isoform X2 [Cicer 
arietinum]
Length=614

 Score =   155 bits (392),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 152/259 (59%), Gaps = 50/259 (19%)
 Frame = +2

Query  119  MAELGFRDQASGFR-------------ARDVSPDSVIFTADsnlslfssasasVDRCSFA  259
            M ELGF +Q   +R               D SPDSVIFT +SNLSLFSS SASVDRCSFA
Sbjct  1    MRELGFNEQRRSWRRAGSRRGNAGVGGGGDTSPDSVIFTLESNLSLFSSNSASVDRCSFA  60

Query  260  SDAHDHEDSSFSDTSQPHLAGH-EF-----------------HDASHGRASDRKTPAVHL  385
            SDAHDH DS  S+ S  HLAG+ +F                     H  +   +   +H 
Sbjct  61   SDAHDH-DSLTSEISL-HLAGNVDFAPSESWSGPDPDPDPNRKQQQHADSDSVQKKKLHR  118

Query  386  S----RKEKAKVQIADNSEIETEDENLA--VDSARNSFSQALKECQDRRSRSGVPLKKPD  547
            +    ++EK KVQ  ++S+++TED N    +DSARNSFS ALKECQDRRSR     KK D
Sbjct  119  TLFSGKEEKTKVQKEEDSDVDTEDGNQLSELDSARNSFSLALKECQDRRSRCEALFKKQD  178

Query  548  RRRPASLDLnnsvtnaansssPQFGV--MKKVYVTTSRG------GAFPSPGTPNYRYSS  703
            RRRPASLDL N+       SSP+ G+  MKK  + + R       G FPSPGTPNYR+  
Sbjct  179  RRRPASLDL-NNANAIGTVSSPRLGIGAMKKSSLPSRRSGTGTGTGTFPSPGTPNYRHCQ  237

Query  704  MGI--QKGWSSERVPLHSS  754
             G+  QKGWSSERVPLH+S
Sbjct  238  GGVAMQKGWSSERVPLHTS  256



>ref|XP_008220239.1| PREDICTED: uncharacterized protein LOC103320346 [Prunus mume]
Length=564

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 134/210 (64%), Gaps = 30/210 (14%)
 Frame = +2

Query  155  FRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLAGHEFH  334
            F  RD SPDSVIFT +SN SLFSSASASVDRCSFASDA DH DS  S    P+ A HE H
Sbjct  6    FGVRDASPDSVIFTLESNFSLFSSASASVDRCSFASDALDH-DSEIS----PNSAAHEHH  60

Query  335  DASHGRASDRK----------TPAVHLSR----KEKAKVQIADNSEIETEDENLAVDSAR  472
                   +DR           T ++  SR     EKAKVQ  D       D +L +DSAR
Sbjct  61   VEESSSGTDRDPDPSRRLTFHTSSIKHSRLSTKAEKAKVQKEDT------DSDLVLDSAR  114

Query  473  NSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTS  652
            +SFS A+KECQDRRSRS    KK DR RPASLDLNN+  ++     P+ G +KK  + + 
Sbjct  115  SSFSLAIKECQDRRSRSEAFSKKLDRPRPASLDLNNASVSS-----PRLGNIKKSSMASR  169

Query  653  RGGAFPSPGTPNYRYSSMGIQKGWSSERVP  742
            + G FPSPGTP+YR +S+G+QKGWSSERVP
Sbjct  170  KSGNFPSPGTPSYRNTSLGVQKGWSSERVP  199



>ref|XP_011017191.1| PREDICTED: uncharacterized protein LOC105120619 isoform X1 [Populus 
euphratica]
 ref|XP_011017192.1| PREDICTED: uncharacterized protein LOC105120619 isoform X1 [Populus 
euphratica]
Length=607

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 141/226 (62%), Gaps = 21/226 (9%)
 Frame = +2

Query  113  SAMAEL-GFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHE  280
            S M EL   RDQ S   GFRARD SPDS IFT +SN SLFSS SASVDRCSFASDA+DHE
Sbjct  16   SRMPELVCHRDQISSRSGFRARDASPDSGIFTLESNFSLFSSTSASVDRCSFASDAYDHE  75

Query  281  --DSSFSDTSQPHLAGHEFHDASH-GRASDRKTPAVHLSRKEK-------AKVQIADNSE  430
               S  S  +  HLA H+  ++   G   ++    V  + K+        ++       +
Sbjct  76   YLASEISLCAMQHLAAHDQQESYWSGPDPNKLNNTVGNNNKQHTHTHTRPSRKAEKAKVK  135

Query  431  IETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansss  610
             E  D NL +DSAR+SFS ALKECQ+ RSRS    KK DRRRPASLDL     N   S S
Sbjct  136  KEEGDNNL-LDSARSSFSLALKECQESRSRSNAITKKGDRRRPASLDL----NNVVTSPS  190

Query  611  PQFGVMKKVYVTTSR-GGAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
            P+ G MKK  V +SR  G FPSPGTPNY +SS GIQKGWSSERVPL
Sbjct  191  PRLGNMKKSIVYSSRKSGTFPSPGTPNY-HSSAGIQKGWSSERVPL  235



>ref|XP_009605374.1| PREDICTED: uncharacterized protein LOC104099944 [Nicotiana tomentosiformis]
 ref|XP_009605375.1| PREDICTED: uncharacterized protein LOC104099944 [Nicotiana tomentosiformis]
Length=515

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 131/218 (60%), Gaps = 39/218 (18%)
 Frame = +2

Query  119  MAELGFRDQ--ASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSF  292
            M+EL F+DQ  +  F  RDVSPDSVIFTADS+ S        +DRCSF S +H H  S  
Sbjct  1    MSELRFQDQRLSLIFGGRDVSPDSVIFTADSSASPS------LDRCSFTSLSH-HPLSH-  52

Query  293  SDTSQPHLAGHEFHDASHGRASDRKTPAVH----LSRKEKAKVQIADNSEIETEDENLAV  460
                  HL G+EFH+A  G   D     VH    L RKEK KV+         E++NL +
Sbjct  53   ------HLTGYEFHEALGGPPPDLSKAMVHKNSHLRRKEKTKVR---------EEKNLTL  97

Query  461  DSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVY  640
            DSAR SFSQALKECQDRRS++     K DR++P   DL N+    A  SSP+ GVMKK  
Sbjct  98   DSARKSFSQALKECQDRRSKAE---NKLDRQKP---DL-NNAIIKATHSSPRIGVMKKTI  150

Query  641  VTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            VT S    FPSPGTPNYR+    IQKGWSSE VPL S+
Sbjct  151  VTASGTCMFPSPGTPNYRHY---IQKGWSSEHVPLRSA  185



>ref|XP_011017193.1| PREDICTED: uncharacterized protein LOC105120619 isoform X2 [Populus 
euphratica]
Length=603

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 139/224 (62%), Gaps = 21/224 (9%)
 Frame = +2

Query  113  SAMAEL-GFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHE  280
            S M EL   RDQ S   GFRARD SPDS IFT +SN SLFSS SASVDRCSFASDA+DHE
Sbjct  16   SRMPELVCHRDQISSRSGFRARDASPDSGIFTLESNFSLFSSTSASVDRCSFASDAYDHE  75

Query  281  DSSFSDTSQPHLAGHEFHDASH-GRASDRKTPAVHLSRKEK-------AKVQIADNSEIE  436
                +     HLA H+  ++   G   ++    V  + K+        ++       + E
Sbjct  76   --YLASEISLHLAAHDQQESYWSGPDPNKLNNTVGNNNKQHTHTHTRPSRKAEKAKVKKE  133

Query  437  TEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQ  616
              D NL +DSAR+SFS ALKECQ+ RSRS    KK DRRRPASLDL     N   S SP+
Sbjct  134  EGDNNL-LDSARSSFSLALKECQESRSRSNAITKKGDRRRPASLDL----NNVVTSPSPR  188

Query  617  FGVMKKVYVTTSR-GGAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
             G MKK  V +SR  G FPSPGTPNY +SS GIQKGWSSERVPL
Sbjct  189  LGNMKKSIVYSSRKSGTFPSPGTPNY-HSSAGIQKGWSSERVPL  231



>ref|XP_008378037.1| PREDICTED: uncharacterized protein LOC103441113 isoform X2 [Malus 
domestica]
Length=561

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 135/213 (63%), Gaps = 22/213 (10%)
 Frame = +2

Query  140  DQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA  319
            +Q  GFR RD SPDSVI   +SN SLFSSASASVDRCSF  D  D   S  S  S  H  
Sbjct  3    EQRPGFRVRDPSPDSVILALESNFSLFSSASASVDRCSF--DRDDSTASEISPNSAXHXR  60

Query  320  GHEFHDASHGRASDRKTPAVHL--------SRKEKAKVQIADNSEIETEDENLAVDSARN  475
             HE  ++S G   D     +H         ++ EKAKVQ  D+      D +L +DSAR+
Sbjct  61   RHE--ESSSGPDRDPDPNRIHAFQHTRRLXAKGEKAKVQKKDS------DSDLVLDSARS  112

Query  476  SFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSR  655
            SFS ALKECQDRRSRS    KK DR RPASLDLNN+ + ++    P+ G +KK  + + +
Sbjct  113  SFSLALKECQDRRSRSEALSKKLDRPRPASLDLNNNASVSS----PRLGAIKKGSMASRK  168

Query  656  GGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
               FPSPGTP+YR++S+G+QKGWSSERVP H+S
Sbjct  169  SANFPSPGTPSYRHTSLGVQKGWSSERVPSHAS  201



>ref|XP_008378035.1| PREDICTED: uncharacterized protein LOC103441113 isoform X1 [Malus 
domestica]
 ref|XP_008378036.1| PREDICTED: uncharacterized protein LOC103441113 isoform X1 [Malus 
domestica]
Length=562

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 138/215 (64%), Gaps = 25/215 (12%)
 Frame = +2

Query  140  DQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA  319
            +Q  GFR RD SPDSVI   +SN SLFSSASASVDRCSF     D +DS+ S+ S  + A
Sbjct  3    EQRPGFRVRDPSPDSVILALESNFSLFSSASASVDRCSF-----DRDDSTASEISPQNSA  57

Query  320  GH--EFHDASHGRASDRKTPAVHL--------SRKEKAKVQIADNSEIETEDENLAVDSA  469
             H     ++S G   D     +H         ++ EKAKVQ  D+      D +L +DSA
Sbjct  58   XHXRRHEESSSGPDRDPDPNRIHAFQHTRRLXAKGEKAKVQKKDS------DSDLVLDSA  111

Query  470  RNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTT  649
            R+SFS ALKECQDRRSRS    KK DR RPASLDLNN+ + ++    P+ G +KK  + +
Sbjct  112  RSSFSLALKECQDRRSRSEALSKKLDRPRPASLDLNNNASVSS----PRLGAIKKGSMAS  167

Query  650  SRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
             +   FPSPGTP+YR++S+G+QKGWSSERVP H+S
Sbjct  168  RKSANFPSPGTPSYRHTSLGVQKGWSSERVPSHAS  202



>ref|XP_008367665.1| PREDICTED: uncharacterized protein LOC103431302 [Malus domestica]
Length=559

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 141/218 (65%), Gaps = 28/218 (13%)
 Frame = +2

Query  134  FRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD---TS  304
             ++Q  GFR RD SPDSVIF  +SN SLFSSASASVD CSF     DH+DS+ S+    S
Sbjct  1    MQEQRPGFRVRDPSPDSVIFALESNFSLFSSASASVDLCSF-----DHDDSTASEISPNS  55

Query  305  QPHLAGHEFHDASHGRASDRKTPAVH-------LSRK-EKAKVQIADNSEIETEDENLAV  460
             P    HE  ++S G   D     +H       LS K EKAKVQ  D+      D +  +
Sbjct  56   APRDRRHE--ESSSGPDRDPDPNRIHAFQHTRRLSGKGEKAKVQKEDS------DSDFVL  107

Query  461  DSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVY  640
            DSAR+SFS ALKECQDRRSRS    KK DR RPASLDLNN+ + ++    P+ G +KK  
Sbjct  108  DSARSSFSLALKECQDRRSRSEALSKKLDRPRPASLDLNNNASVSS----PRLGAIKKGS  163

Query  641  VTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            + + + G FPSPGTP+YR++S+G+QKGWSSERVP H++
Sbjct  164  MASRKSGNFPSPGTPSYRHASLGVQKGWSSERVPSHTN  201



>gb|KHN12790.1| hypothetical protein glysoja_008753 [Glycine soja]
Length=608

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 154/255 (60%), Gaps = 50/255 (20%)
 Frame = +2

Query  119  MAELGFRDQASGFR-ARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            M ELGF+++ S  R   D SPDSVIFT +SNLSLFSSASA+VD     SDAHDH DS  S
Sbjct  1    MPELGFQERRSWRRRGGDTSPDSVIFTLESNLSLFSSASAAVD----PSDAHDH-DSLAS  55

Query  296  DTSQPHLAGHEFHDASHGRA------------------------SDRKTPAVHL------  385
            + S  HLA  + HD    R+                        +D  + AVH       
Sbjct  56   EISL-HLAVQD-HDGDFARSESWSGQDPDPDLNKRQQQQQQQRHADTDSDAVHRKHRRNR  113

Query  386  --SRKEKAKVQIADNSEI-ETEDEN--LAVDSARNSFSQALKECQDRRSRSGVPLKKPDR  550
               ++EKAKVQ  ++S+  +TED N  L  DSARNSFS ALKECQDRRSRS    KK DR
Sbjct  114  FSGKREKAKVQKEEDSDGGDTEDGNQHLEFDSARNSFSLALKECQDRRSRSETLYKKHDR  173

Query  551  RRPASLDLnnsvtnaanss-sPQFGVMKKVYVTTSRGGA------FPSPGTPNYRYSSMG  709
            RRPASLDLNN++ N   SS   + G MKK  + T R G+      FPSPGTPNY ++S+ 
Sbjct  174  RRPASLDLNNAIGNGNVSSPRLELGAMKKSTLCTRRSGSGCGNGNFPSPGTPNYLHASVA  233

Query  710  IQKGWSSERVPLHSS  754
            +QKGWSSERVPLH+S
Sbjct  234  MQKGWSSERVPLHTS  248



>ref|XP_009359706.1| PREDICTED: uncharacterized protein LOC103950236 isoform X2 [Pyrus 
x bretschneideri]
Length=559

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 136/216 (63%), Gaps = 24/216 (11%)
 Frame = +2

Query  134  FRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPH  313
             ++Q  GFR RD S DSVIF  +SN SLFSSASASVD CSF     DH+DS+ S+ S   
Sbjct  1    MQEQRPGFRVRDPSTDSVIFALESNFSLFSSASASVDLCSF-----DHDDSTASEISPNS  55

Query  314  LAGHEFHDASH-GRASDRKTPAVHL--------SRKEKAKVQIADNSEIETEDENLAVDS  466
                  H+ S  G   D     +H         +R EKAKVQ  D+      D +  +DS
Sbjct  56   APRDRRHEESWSGPDRDPDPNRIHAFQHTRRLSARGEKAKVQKEDS------DSDFVLDS  109

Query  467  ARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVT  646
            AR+SFS ALKECQDRRSRS    KK DR RPASLDLNN+ + ++    P+ G +KK  + 
Sbjct  110  ARSSFSLALKECQDRRSRSEALSKKLDRPRPASLDLNNNASVSS----PRLGAIKKGSMA  165

Query  647  TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            + + G FPSPGTP+YR++S+G+QKGWSSERVP H++
Sbjct  166  SRKSGNFPSPGTPSYRHASLGVQKGWSSERVPSHTN  201



>ref|XP_009359703.1| PREDICTED: uncharacterized protein LOC103950236 isoform X1 [Pyrus 
x bretschneideri]
Length=560

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 135/217 (62%), Gaps = 25/217 (12%)
 Frame = +2

Query  134  FRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPH  313
             ++Q  GFR RD S DSVIF  +SN SLFSSASASVD CSF     DH+DS+ S+ S  +
Sbjct  1    MQEQRPGFRVRDPSTDSVIFALESNFSLFSSASASVDLCSF-----DHDDSTASEISPQN  55

Query  314  LAGHEFHDASHGRASDRKTPAVHL----------SRKEKAKVQIADNSEIETEDENLAVD  463
             A  +          DR      +          +R EKAKVQ  D+      D +  +D
Sbjct  56   SAPRDRRHEESWSGPDRDPDPNRIHAFQHTRRLSARGEKAKVQKEDS------DSDFVLD  109

Query  464  SARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYV  643
            SAR+SFS ALKECQDRRSRS    KK DR RPASLDLNN+ + ++    P+ G +KK  +
Sbjct  110  SARSSFSLALKECQDRRSRSEALSKKLDRPRPASLDLNNNASVSS----PRLGAIKKGSM  165

Query  644  TTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
             + + G FPSPGTP+YR++S+G+QKGWSSERVP H++
Sbjct  166  ASRKSGNFPSPGTPSYRHASLGVQKGWSSERVPSHTN  202



>gb|KJB58498.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=548

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 131/216 (61%), Gaps = 30/216 (14%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAELG +D+    SG+RA   SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS 
Sbjct  1    MAELGLQDRNTVRSGYRAGAASPDSVIFTLESNFSLFSSASASVDRCSFASDAHD-RDSI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSA  469
             S+ S  H+AG E  D +         P  + +      ++++   E             
Sbjct  60   ASELSL-HMAGQESGDQNESFGGPDPDPDPNKAITVPKHIRLSRKGE-------------  105

Query  470  RNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTT  649
                   +KECQDR++RS   LK PDRRRPASLDL     N  +  SP+ G +KK  V T
Sbjct  106  ------KVKECQDRKTRSDALLKNPDRRRPASLDL-----NNISGLSPRLGTVKKSSVVT  154

Query  650  SRGGAFPSPGTPNYRY-SSMGIQKGWSSERVPLHSS  754
             + GAFPSPGTPNY + SS+G+QKGWSSERV LHS+
Sbjct  155  RKLGAFPSPGTPNYHHNSSVGMQKGWSSERVALHSN  190



>ref|XP_010269599.1| PREDICTED: uncharacterized protein LOC104606189 isoform X3 [Nelumbo 
nucifera]
Length=529

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 143/225 (64%), Gaps = 18/225 (8%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M  LGF++      G R RD SPDSVIFT +SN SLFSSAS SV RCSFASD HD E S 
Sbjct  1    MLGLGFQETKPAKLGCRDRDDSPDSVIFTQESNFSLFSSASGSVGRCSFASDVHDRE-SI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP-AVH-----LSRKEKAK----VQIADNSEIET  439
             S+ S+ HLAG + H+ S G   D K P AV      + + EKAK     +     EIET
Sbjct  60   VSEFSK-HLAGRDLHECSRGPDLDPKRPFAVQRSSHTVKKGEKAKDREEEEEEQQEEIET  118

Query  440  EDENLAVDSARNSFSQALKECQDRRSRSGV--PLKKPDRRRPASLDLnnsvtnaansssP  613
            ED+   +D A++SFS AL+ECQ RR +S +    K   ++RP SLDLN   ++A  SS P
Sbjct  119  EDDTQTLDPAKDSFSIALRECQIRRLKSDLLTAAKIQGKQRPTSLDLNGQGSDATGSS-P  177

Query  614  QFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            + G M+K   ++ R G FPSPGTPNYR  ++G+QKGWSSERVPLH
Sbjct  178  RLGGMRKNSGSSRRSGTFPSPGTPNYRPGNIGVQKGWSSERVPLH  222



>ref|XP_010269583.1| PREDICTED: uncharacterized protein LOC104606189 isoform X1 [Nelumbo 
nucifera]
Length=588

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 143/225 (64%), Gaps = 18/225 (8%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M  LGF++      G R RD SPDSVIFT +SN SLFSSAS SV RCSFASD HD E S 
Sbjct  1    MLGLGFQETKPAKLGCRDRDDSPDSVIFTQESNFSLFSSASGSVGRCSFASDVHDRE-SI  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP-AVH-----LSRKEKAK----VQIADNSEIET  439
             S+ S+ HLAG + H+ S G   D K P AV      + + EKAK     +     EIET
Sbjct  60   VSEFSK-HLAGRDLHECSRGPDLDPKRPFAVQRSSHTVKKGEKAKDREEEEEEQQEEIET  118

Query  440  EDENLAVDSARNSFSQALKECQDRRSRSGV--PLKKPDRRRPASLDLnnsvtnaansssP  613
            ED+   +D A++SFS AL+ECQ RR +S +    K   ++RP SLDLN   ++A  SS P
Sbjct  119  EDDTQTLDPAKDSFSIALRECQIRRLKSDLLTAAKIQGKQRPTSLDLNGQGSDATGSS-P  177

Query  614  QFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            + G M+K   ++ R G FPSPGTPNYR  ++G+QKGWSSERVPLH
Sbjct  178  RLGGMRKNSGSSRRSGTFPSPGTPNYRPGNIGVQKGWSSERVPLH  222



>gb|KJB63849.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=542

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 133/227 (59%), Gaps = 52/227 (23%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K                                   +SSP+ G
Sbjct  119  DENQLIDSARNSFSLATK-----------------------------------ASSPRLG  143

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  144  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  190



>gb|KJB63848.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=538

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 133/227 (59%), Gaps = 52/227 (23%)
 Frame = +2

Query  119  MAELGFRDQA---SGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE GF++Q+   S +RARD SPDSVIFT +SN SLFSSASASVDRCSFASDAHDH DS 
Sbjct  1    MAEQGFQEQSTIRSSYRARDASPDSVIFTPESNFSLFSSASASVDRCSFASDAHDH-DSL  59

Query  290  FSDTSQPHLAGHEFHDASHGR----ASDRKTPAV----HLSRK-EKAKVQIADNSEIETE  442
             S+ S  HLAGHE  D +       ++  K  AV      SRK EK KV+  +N  +  +
Sbjct  60   ASELSL-HLAGHETGDQNESLSGPDSNTNKANAVLNHSRFSRKGEKVKVEKDENDTVHVK  118

Query  443  DENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFG  622
            DEN  +DSARNSFS A K                                   +SSP+ G
Sbjct  119  DENQLIDSARNSFSLATK-----------------------------------ASSPRLG  143

Query  623  VMKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
             MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  144  TMKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  190



>gb|KJB58497.1| hypothetical protein B456_009G212800 [Gossypium raimondii]
Length=512

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +2

Query  377  VHLSRK-EKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRR  553
            + LSRK EK KV+  +N    TEDE    DSARNSFS ALKECQDR++RS   LK PDRR
Sbjct  32   IRLSRKGEKVKVKTEENGPAHTEDETQLRDSARNSFSLALKECQDRKTRSDALLKNPDRR  91

Query  554  RPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRY-SSMGIQKGWSS  730
            RPASLDL     N  +  SP+ G +KK  V T + GAFPSPGTPNY + SS+G+QKGWSS
Sbjct  92   RPASLDL-----NNISGLSPRLGTVKKSSVVTRKLGAFPSPGTPNYHHNSSVGMQKGWSS  146

Query  731  ERVPLHSS  754
            ERV LHS+
Sbjct  147  ERVALHSN  154



>ref|XP_010540365.1| PREDICTED: uncharacterized protein LOC104814166 [Tarenaya hassleriana]
 ref|XP_010540366.1| PREDICTED: uncharacterized protein LOC104814166 [Tarenaya hassleriana]
Length=558

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 132/208 (63%), Gaps = 11/208 (5%)
 Frame = +2

Query  143  QASGFRARDVSPDSVIFT--ADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPH-  313
            +A G   RD SPDS+IFT  ++ ++   +SASASV RCSFASDA D  DS  SD S    
Sbjct  18   EACGGDRRDASPDSLIFTPESNLSIFSSASASASVGRCSFASDAQDR-DSLVSDLSMDRD  76

Query  314  LAGHE-FHDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQA  490
            L G+    D+   + S  +  + +  + +K KVQ  DN E+ TEDEN  +DSAR+SFS A
Sbjct  77   LRGNSSCTDSDPNKLSTGRKHSRNSRKTDKVKVQKEDN-EVNTEDENQHLDSARSSFSLA  135

Query  491  LKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFP  670
            +KECQDRRSRS   +KK  R+R  SLDL     N   SSSP+   +++  V+T +  AFP
Sbjct  136  IKECQDRRSRSEALVKKLHRQRTPSLDL-----NNVTSSSPRLVTVQRNSVSTKKSSAFP  190

Query  671  SPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            SPGTP Y + S+ + KGWSSERVP HS+
Sbjct  191  SPGTPTYLHGSIAMPKGWSSERVPSHSN  218



>ref|XP_010552520.1| PREDICTED: uncharacterized protein LOC104822856 [Tarenaya hassleriana]
Length=558

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 129/209 (62%), Gaps = 21/209 (10%)
 Frame = +2

Query  152  GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQ-------P  310
            G   RD SPDS+IFT +SNLSLFSSASASVDRCSFASDA D  DS  SD S         
Sbjct  21   GVARRDASPDSLIFTPESNLSLFSSASASVDRCSFASDAQDR-DSLVSDLSMERDPRGIS  79

Query  311  HLAGHEFHDASHGRASDRKTPAVHLSRK-EKAKVQIADNSEIETEDENLAVDSARNSFSQ  487
            + A  + +  S GR           SRK +K KVQ  DN ++  EDE+  +DSARNSFS 
Sbjct  80   NCANLDPNKLSTGRKHSWN------SRKADKVKVQKEDN-KVNAEDESQHLDSARNSFSL  132

Query  488  ALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAF  667
            ALKECQDRRSRS    KK D +R  SLDL         S SP+   +K+  V+T++  AF
Sbjct  133  ALKECQDRRSRSEALAKKLDMQRTPSLDL-----KNVTSFSPRLLTVKRNSVSTNKSSAF  187

Query  668  PSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            PSPGTP Y + S+ + KGWSSERVP  S+
Sbjct  188  PSPGTPTYLHGSIAMPKGWSSERVPSRSN  216



>ref|XP_010538113.1| PREDICTED: uncharacterized protein LOC104812570 [Tarenaya hassleriana]
Length=553

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 129/202 (64%), Gaps = 10/202 (5%)
 Frame = +2

Query  143  QASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTS--QPHL  316
            +ASG   RD SPDS+I T +SNLSLFSSASASVDRCSFASD+HD  DS  SD S  + H 
Sbjct  17   EASGGGIRDASPDSLILTPESNLSLFSSASASVDRCSFASDSHDR-DSLVSDFSMDRDHR  75

Query  317  AGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQALK  496
                  D    + S  +  + +  + +K KVQ  DN  IE E ++L  DSAR+SFS ALK
Sbjct  76   GISSCTDLDPNKLSTGRRHSRNSRKADKVKVQKEDNEVIEEESQHL--DSARSSFSLALK  133

Query  497  ECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSP  676
            ECQ RRSR G  +K+ DR++  SLDL     N   SSSP+   +K+  V T +  AFPSP
Sbjct  134  ECQARRSRPGALVKRLDRQKSPSLDL-----NNVTSSSPRLVTVKRNSVLTKKSSAFPSP  188

Query  677  GTPNYRYSSMGIQKGWSSERVP  742
            GTP Y + S+ + KGWSSERVP
Sbjct  189  GTPTYLHGSIAMPKGWSSERVP  210



>gb|KCW68728.1| hypothetical protein EUGRSUZ_F02334 [Eucalyptus grandis]
Length=494

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 130/220 (59%), Gaps = 49/220 (22%)
 Frame = +2

Query  119  MAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSD  298
            M ELG    A G   RD SPDSVIFT +SN SLFSSASASVDRCSFASDAHD  DS  S+
Sbjct  1    MVELG----AFGAAPRDASPDSVIFTLESNFSLFSSASASVDRCSFASDAHDR-DSLASE  55

Query  299  TSQPHLAGHEFHDASHGR----ASDRKTPAVH----LSRKEKAKVQIADNSEIETEDENL  454
             S  HLAG E  D+S G      S+   PAVH    LSRK       AD +         
Sbjct  56   ISL-HLAGRE-RDSSSGPDPDPNSNPNKPAVHKHSRLSRK-------ADKA---------  97

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
                         KECQ+RRSRS    +K D+RRPAS+D NN   ++     P+   +KK
Sbjct  98   -------------KECQERRSRSEALSRKSDKRRPASVDFNNPTASS-----PRLEAVKK  139

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              + T + G FPSPGTPNYR++++G+QKGWSSERVPL SS
Sbjct  140  SSMATRQSGTFPSPGTPNYRHANVGLQKGWSSERVPLQSS  179



>ref|XP_003589173.1| Remorin [Medicago truncatula]
 gb|AES59424.1| carboxy-terminal region remorin [Medicago truncatula]
Length=620

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 124/261 (48%), Positives = 145/261 (56%), Gaps = 57/261 (22%)
 Frame = +2

Query  119  MAELGFRDQ------ASGFRAR-----------DVSPDSVIFTADsnlslfssasasVDR  247
            M +LGF +Q       +G R R           D SPDSVIFT +SNLSLFSSASASVDR
Sbjct  1    MRDLGFHEQRRSWRRNTGSRTRNTTANTVTGGGDTSPDSVIFTLESNLSLFSSASASVDR  60

Query  248  CSFASDAHDHEDSSFSDTSQPHLAGH--EFH--------------DASHGRASDRKTPAV  379
            CSFASDAHD  DS  S+ S  HLAGH  +F               + +H R     + +V
Sbjct  61   CSFASDAHDR-DSLNSEISL-HLAGHGGDFAPSESWSGPDPDPDPNQNHNRKQHADSDSV  118

Query  380  HL---------SRKEKAKVQIADNSEIETEDENLA--VDSARNSFSQALKECQDRRSRSG  526
                        + EK KVQ  D S+I+++D N     DSARNSFS ALKECQDRRSR  
Sbjct  119  QKKKLGETLFSGKAEKTKVQKED-SDIDSKDGNQLSEFDSARNSFSLALKECQDRRSRCE  177

Query  527  VPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRG--------GAFPSPGT  682
               KK DRRRPASLDLNN+      SS    G +KK  V + +         G FPSPGT
Sbjct  178  SLFKKQDRRRPASLDLNNANATGTGSSPRLVGAVKKSMVQSRKSGTGTATGTGTFPSPGT  237

Query  683  PNYRYSSMGI--QKGWSSERV  739
            PNYR+   G+  QKGWSSERV
Sbjct  238  PNYRHCQGGVAMQKGWSSERV  258



>ref|XP_010688867.1| PREDICTED: uncharacterized protein LOC104902690 [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = +2

Query  167  DVSPDSVIFTADsnlslf-ssasasVDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDAS  343
            D+SPDSVI T +SN     SSASASVDRCSF SD HD + + F+ +    L   +   A 
Sbjct  22   DMSPDSVILTFESNFRSLFSSASASVDRCSFTSD-HDPDSNKFAVS----LCSKKVDKAK  76

Query  344  HGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRS  523
              +  + K       ++++      D+ EIE       +DSAR SFSQALKECQ+RRSRS
Sbjct  77   VHQEENNKIVQQQQQQQQQQHHHHVDH-EIE------PLDSARTSFSQALKECQERRSRS  129

Query  524  GVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSR-GGAFPSPGTPNYRYS  700
                 K DR RPASLDLNNS      +SSP+ GVMKK    + +  G FPSPGTPNYR+ 
Sbjct  130  EAFNNKLDRPRPASLDLNNSSVANVVTSSPKLGVMKKASAISRKSSGNFPSPGTPNYRHG  189

Query  701  SMGIQKGWSSERVPLHSS  754
            S+GI KGWSSERVPL S+
Sbjct  190  SVGITKGWSSERVPLPSN  207



>ref|XP_011654112.1| PREDICTED: uncharacterized protein LOC101215278 isoform X2 [Cucumis 
sativus]
Length=559

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 131/223 (59%), Gaps = 21/223 (9%)
 Frame = +2

Query  116  AMAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            AM E GF    S  R RD SP+SV+FT +SN S+FSS SASV+RCSFASDAHD+ D   S
Sbjct  2    AMVEAGF-SVGSRIRTRDSSPESVVFTLESNYSVFSSTSASVERCSFASDAHDY-DCRNS  59

Query  296  DTSQPHLAGH--EFHDASHGRASDRKTPAVHLSR--------KEKAKVQIADNSEIETED  445
            + S  HL G+  E  + ++G  SD K     + R        +EK KV+  +NS I+  D
Sbjct  60   EISL-HLEGNIEECKEENNGSDSDPKAIDSSVGRELNRLPGKREKMKVE-KENSYIDAMD  117

Query  446  ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGV  625
                ++ ARNSFS ALKEC+DRR+RS   L K DR+R ASLDL     N    SSP   +
Sbjct  118  GCQPLNMARNSFSLALKECRDRRTRSEALLNKVDRQRAASLDL-----NTVTVSSPHLAI  172

Query  626  MKKVYVT--TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            M+K   +   S      SP   + R ++  IQKGWSSERVPLH
Sbjct  173  MRKSSFSPIMSDTSMLQSPAVTSCRPANAEIQKGWSSERVPLH  215



>ref|XP_004141261.1| PREDICTED: uncharacterized protein LOC101215278 isoform X1 [Cucumis 
sativus]
 ref|XP_011654111.1| PREDICTED: uncharacterized protein LOC101215278 isoform X1 [Cucumis 
sativus]
 gb|KGN55197.1| hypothetical protein Csa_4G639850 [Cucumis sativus]
Length=568

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 131/223 (59%), Gaps = 21/223 (9%)
 Frame = +2

Query  116  AMAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            AM E GF    S  R RD SP+SV+FT +SN S+FSS SASV+RCSFASDAHD+ D   S
Sbjct  2    AMVEAGF-SVGSRIRTRDSSPESVVFTLESNYSVFSSTSASVERCSFASDAHDY-DCRNS  59

Query  296  DTSQPHLAGH--EFHDASHGRASDRKTPAVHLSR--------KEKAKVQIADNSEIETED  445
            + S  HL G+  E  + ++G  SD K     + R        +EK KV+  +NS I+  D
Sbjct  60   EISL-HLEGNIEECKEENNGSDSDPKAIDSSVGRELNRLPGKREKMKVE-KENSYIDAMD  117

Query  446  ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGV  625
                ++ ARNSFS ALKEC+DRR+RS   L K DR+R ASLDL     N    SSP   +
Sbjct  118  GCQPLNMARNSFSLALKECRDRRTRSEALLNKVDRQRAASLDL-----NTVTVSSPHLAI  172

Query  626  MKKVYVT--TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            M+K   +   S      SP   + R ++  IQKGWSSERVPLH
Sbjct  173  MRKSSFSPIMSDTSMLQSPAVTSCRPANAEIQKGWSSERVPLH  215



>ref|NP_973976.1| remorin-like protein [Arabidopsis thaliana]
 gb|AEE32097.1| remorin-like protein [Arabidopsis thaliana]
Length=555

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 124/208 (60%), Gaps = 10/208 (5%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTS--QP  310
            R   SG   RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +DS  S  S  + 
Sbjct  11   RPAKSGGSRRDSSPDSIIFTPESNLSLFSSASVSVDRCSSTSDAHDRDDSLISGPSLERD  70

Query  311  HLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQA  490
                    D    +       + +  +  K K    +  E++ +DE+  +DSAR+SFS A
Sbjct  71   QRVSSSCKDLDLDKRGTGWKNSCNSRKSNKVKAAWKEEFEVKKDDESQNLDSARSSFSVA  130

Query  491  LKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFP  670
            L+ECQ+RRSRS    KK D +R  SLDL     +   S+SP+   +K+  V+T++   FP
Sbjct  131  LRECQERRSRSEALAKKLDYQRTVSLDL-----SNVTSTSPRVVNVKRASVSTNKSSVFP  185

Query  671  SPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            SPGTP Y +S   +QKGWSSERVPL S+
Sbjct  186  SPGTPTYLHS---MQKGWSSERVPLRSN  210



>ref|XP_008452561.1| PREDICTED: uncharacterized protein LOC103493546 isoform X2 [Cucumis 
melo]
Length=554

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 135/223 (61%), Gaps = 21/223 (9%)
 Frame = +2

Query  116  AMAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            AMAE GF    S  RARD SP+SV+FT +SN S+FSS SASV+RCSFASDAHD+ D   S
Sbjct  2    AMAEAGF-SVGSRLRARDSSPESVVFTLESNYSVFSSTSASVERCSFASDAHDY-DCRNS  59

Query  296  DTSQPHLAGH--EFHDASHGRASDRK----TPAVHLSR----KEKAKVQIADNSEIETED  445
            + S  HL G+  E  + ++G  SD +    +  + L+R    +EK KV+  +NS I+  +
Sbjct  60   EISL-HLEGNIEECKEENNGSDSDPEATDSSVGMELNRLPGKREKMKVE-KENSYIDAMN  117

Query  446  ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGV  625
                ++ ARNSFS ALKEC+DRR+RS     K DR+R ASLDL     N+   SSP   +
Sbjct  118  GCQPLNMARNSFSLALKECRDRRTRSEALSNKVDRQRAASLDL-----NSVTVSSPHLAI  172

Query  626  MKKVYVT--TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
             +K   +   S      SP   + R ++  IQKGW+SERVPLH
Sbjct  173  TRKSSFSPIMSDTSMLQSPAVTSCRPANAEIQKGWNSERVPLH  215



>ref|XP_008452559.1| PREDICTED: uncharacterized protein LOC103493546 isoform X1 [Cucumis 
melo]
 ref|XP_008452560.1| PREDICTED: uncharacterized protein LOC103493546 isoform X1 [Cucumis 
melo]
Length=563

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 135/223 (61%), Gaps = 21/223 (9%)
 Frame = +2

Query  116  AMAELGFRDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFS  295
            AMAE GF    S  RARD SP+SV+FT +SN S+FSS SASV+RCSFASDAHD+ D   S
Sbjct  2    AMAEAGF-SVGSRLRARDSSPESVVFTLESNYSVFSSTSASVERCSFASDAHDY-DCRNS  59

Query  296  DTSQPHLAGH--EFHDASHGRASDRK----TPAVHLSR----KEKAKVQIADNSEIETED  445
            + S  HL G+  E  + ++G  SD +    +  + L+R    +EK KV+  +NS I+  +
Sbjct  60   EISL-HLEGNIEECKEENNGSDSDPEATDSSVGMELNRLPGKREKMKVE-KENSYIDAMN  117

Query  446  ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGV  625
                ++ ARNSFS ALKEC+DRR+RS     K DR+R ASLDL     N+   SSP   +
Sbjct  118  GCQPLNMARNSFSLALKECRDRRTRSEALSNKVDRQRAASLDL-----NSVTVSSPHLAI  172

Query  626  MKKVYVT--TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
             +K   +   S      SP   + R ++  IQKGW+SERVPLH
Sbjct  173  TRKSSFSPIMSDTSMLQSPAVTSCRPANAEIQKGWNSERVPLH  215



>ref|XP_002894013.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70272.1| remorin family protein [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 130/220 (59%), Gaps = 22/220 (10%)
 Frame = +2

Query  122  AELGF---RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSF  292
            +EL +   R   SG   RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    
Sbjct  3    SELSYKVHRPAKSGVCRRDSSPDSIIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----  58

Query  293  SDTSQPHLAGHEFHDAS------HGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENL  454
            S  S P L   +   +S        R +  K  + +  +  K K    +  E+  +DE+ 
Sbjct  59   SLISAPSLERDQRVSSSCKDLDLDKRGTGWKN-SCNSRKSNKVKAAWKEEFEVNKDDESQ  117

Query  455  AVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKK  634
             +DSAR+SFS AL+ECQ+RRSRS    KK D +R  SLDL     +   SSSP+   +K+
Sbjct  118  NLDSARSSFSVALRECQERRSRSEALAKKLDYQRTVSLDL-----SNVTSSSPRVVNVKR  172

Query  635  VYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
              V+T++   FPSPGTP Y +S   +QKGWSSERVPL S+
Sbjct  173  ASVSTNKSSVFPSPGTPTYLHS---MQKGWSSERVPLRSN  209



>ref|XP_010479085.1| PREDICTED: uncharacterized protein LOC104757990 [Camelina sativa]
Length=549

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 122/200 (61%), Gaps = 16/200 (8%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA-GHEFHDA  340
            RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L        +
Sbjct  20   RDSSPDSIIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----SLVSGPSLERDQRVSSS  75

Query  341  SHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQALKECQDR  511
                  D++      SR  +   ++    +  E++ +DE+  +DSAR+SFS AL+ECQ+R
Sbjct  76   CKDLDLDKRGTGWKNSRNSRKSNKVKAWKEEFEVKKDDESQNLDSARSSFSVALRECQER  135

Query  512  RSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNY  691
            RSRS    KK D +R ASLDL     +   SSSP+   +K+  V+T++   FPSPGTP Y
Sbjct  136  RSRSEALAKKLDYQRTASLDL-----SNVISSSPRVVNVKRTSVSTNKSSVFPSPGTPTY  190

Query  692  RYSSMGIQKGWSSERVPLHS  751
             +S   +QKGWSSERVPL S
Sbjct  191  LHS---MQKGWSSERVPLRS  207



>ref|XP_010500198.1| PREDICTED: uncharacterized protein LOC104777615 [Camelina sativa]
Length=549

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 120/200 (60%), Gaps = 16/200 (8%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA-GHEFHDA  340
            RD SPDS+IFT + +LSLFSSAS SVDRCS  SD HD +    S  S P L        +
Sbjct  20   RDSSPDSIIFTPEYSLSLFSSASVSVDRCSSTSDVHDRD----SLVSGPSLERDQRVSSS  75

Query  341  SHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQALKECQDR  511
                  D++      SR  +   ++    +  E++ +DE+  +DSAR+SFS AL+ECQ+R
Sbjct  76   CKDLDLDKRGTGWKNSRNSRKSNKVKAWKEEFEVKKDDESQNLDSARSSFSVALRECQER  135

Query  512  RSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNY  691
            RSRS    KK D +R ASLDL     +   SSSP+   +K+  V+T++   FPSPGTP Y
Sbjct  136  RSRSEALAKKLDYQRTASLDL-----SNVISSSPRVVNVKRTSVSTNKSSVFPSPGTPTY  190

Query  692  RYSSMGIQKGWSSERVPLHS  751
             +S   IQKGWSSERVPL S
Sbjct  191  LHS---IQKGWSSERVPLRS  207



>ref|XP_010461485.1| PREDICTED: uncharacterized protein LOC104742214 isoform X1 [Camelina 
sativa]
Length=550

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 119/201 (59%), Gaps = 17/201 (8%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA-GHEFHDA  340
            RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L        +
Sbjct  20   RDSSPDSIIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----SLVSGPSLERDQRVSSS  75

Query  341  SHGRASDRKTPAVHLSRK----EKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQD  508
                  D++      SR      K K    +  E++ +DE+  +DSAR+SFS AL+ECQ+
Sbjct  76   CKDLDLDKRGTGWKNSRNSRKSNKVKAAWKEEFEVKKDDESQNLDSARSSFSVALRECQE  135

Query  509  RRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPN  688
            RRSR     KK D +R ASLDL     +   SSSP+   +K+  V+T++   FPSPGTP 
Sbjct  136  RRSRCEALAKKLDYQRTASLDL-----SNVISSSPRVVNVKRTSVSTNKSSVFPSPGTPT  190

Query  689  YRYSSMGIQKGWSSERVPLHS  751
            Y  S   +QKGWSSERVPL S
Sbjct  191  YLQS---MQKGWSSERVPLRS  208



>ref|XP_010461486.1| PREDICTED: uncharacterized protein LOC104742214 isoform X2 [Camelina 
sativa]
Length=549

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 120/200 (60%), Gaps = 16/200 (8%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLA-GHEFHDA  340
            RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L        +
Sbjct  20   RDSSPDSIIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----SLVSGPSLERDQRVSSS  75

Query  341  SHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQALKECQDR  511
                  D++      SR  +   ++    +  E++ +DE+  +DSAR+SFS AL+ECQ+R
Sbjct  76   CKDLDLDKRGTGWKNSRNSRKSNKVKAWKEEFEVKKDDESQNLDSARSSFSVALRECQER  135

Query  512  RSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNY  691
            RSR     KK D +R ASLDL     +   SSSP+   +K+  V+T++   FPSPGTP Y
Sbjct  136  RSRCEALAKKLDYQRTASLDL-----SNVISSSPRVVNVKRTSVSTNKSSVFPSPGTPTY  190

Query  692  RYSSMGIQKGWSSERVPLHS  751
              S   +QKGWSSERVPL S
Sbjct  191  LQS---MQKGWSSERVPLRS  207



>gb|KFK36165.1| hypothetical protein AALP_AA4G086500 [Arabis alpina]
Length=549

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 124/216 (57%), Gaps = 28/216 (13%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R  ASG   R+ SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L
Sbjct  8    RPTASGGSRRNSSPDSLIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----SLVSAPSL  63

Query  317  -----AGHEFHDASHGRASDRKTPAVHLSR--KEKAKVQIADNSEIET---EDENLAVDS  466
                       D   G   D++      SR  ++  KV+ A   E E    EDEN  +DS
Sbjct  64   ERDQRVSSSCKDVDPG---DKRGTGWKQSRSSRKANKVKAAWKEEFEVNNKEDENQNLDS  120

Query  467  ARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVT  646
            AR+SFS AL+ECQ+R+SRS    KK D  R  SLD+     +   S+SP+   +K+  V+
Sbjct  121  ARSSFSVALRECQERKSRSEAIAKKLDYERNVSLDI-----SNVTSTSPRVVNVKRTSVS  175

Query  647  TSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            T++   FPSPGTP Y      +QKGWSSERV L S+
Sbjct  176  TNKSSVFPSPGTPTY------MQKGWSSERVALRSN  205



>ref|XP_006393653.1| hypothetical protein EUTSA_v10011395mg [Eutrema salsugineum]
 ref|XP_006393654.1| hypothetical protein EUTSA_v10011395mg [Eutrema salsugineum]
 gb|ESQ30939.1| hypothetical protein EUTSA_v10011395mg [Eutrema salsugineum]
 gb|ESQ30940.1| hypothetical protein EUTSA_v10011395mg [Eutrema salsugineum]
Length=517

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 118/201 (59%), Gaps = 39/201 (19%)
 Frame = +2

Query  152  GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLAGHEF  331
            G+R RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L     
Sbjct  17   GYR-RDFSPDSLIFTPESNLSLFSSASVSVDRCSSTSDAHDRD----SLVSAPSLV----  67

Query  332  HDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDR  511
                            H + KE+         E+  EDE   +DSAR+SFS AL+ECQ+R
Sbjct  68   --------------LPHSAWKEEF--------EVNKEDEIQNLDSARSSFSIALRECQER  105

Query  512  RSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNY  691
            +SRS    KK D +R ASLDL     +   SSSP+   +K+  V+T++   FPSPGTP Y
Sbjct  106  KSRSEALAKKLDYQRTASLDL-----SNVTSSSPRVVTVKRASVSTNKSSVFPSPGTPTY  160

Query  692  RYSSMGIQKGWSSERVPLHSS  754
             +S   +QKGWSSERV L S+
Sbjct  161  LHS---MQKGWSSERVALRSN  178



>ref|XP_006307067.1| hypothetical protein CARUB_v10008653mg, partial [Capsella rubella]
 gb|EOA39965.1| hypothetical protein CARUB_v10008653mg, partial [Capsella rubella]
Length=593

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 120/205 (59%), Gaps = 22/205 (11%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDAS  343
            RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L   +   +S
Sbjct  60   RDSSPDSIIFTPESNLSLFSSASVSVDRCSTTSDAHDRD----SLVSGPSLERDQRVGSS  115

Query  344  HGRASDRKTPAVHL-----SRKEKAKVQIADNSEIET----EDENLAVDSARNSFSQALK  496
              +  D             +RK   KV+ A   E E     E +NL  DSAR+SFS AL+
Sbjct  116  SCKDLDLDKRGTGWKNSRNARKNSNKVKAAWKEEFEVNKDDESQNLD-DSARSSFSVALR  174

Query  497  ECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSP  676
            ECQ+RRSRS    KK D +R  SLDL     +   SSSP+   +K+  V+T++   FPSP
Sbjct  175  ECQERRSRSEALAKKLDYQRTTSLDL-----SNVVSSSPRVVNVKRTSVSTNKSSVFPSP  229

Query  677  GTPNYRYSSMGIQKGWSSERVPLHS  751
            GTP Y +    +QKGWSSERVPL S
Sbjct  230  GTPTYLH---NMQKGWSSERVPLRS  251



>ref|XP_009795225.1| PREDICTED: uncharacterized protein LOC104241949 isoform X2 [Nicotiana 
sylvestris]
Length=442

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 84/125 (67%), Gaps = 19/125 (15%)
 Frame = +2

Query  380  HLSRKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRP  559
            HL RKEK K         + E++NL +DSAR SFSQALKECQDRRS++G   KK DR++P
Sbjct  7    HLRRKEKTK---------DREEKNLTLDSARKSFSQALKECQDRRSKAG---KKLDRQKP  54

Query  560  ASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERV  739
               DL N+    A  SSP+FGVMKK  VT S    FPSPGTPNY++    IQKGWSSE V
Sbjct  55   ---DL-NNAIIKATHSSPRFGVMKKTTVTASGACMFPSPGTPNYKHY---IQKGWSSEHV  107

Query  740  PLHSS  754
            PL S+
Sbjct  108  PLRSA  112



>ref|XP_006307066.1| hypothetical protein CARUB_v10008653mg, partial [Capsella rubella]
 gb|EOA39964.1| hypothetical protein CARUB_v10008653mg, partial [Capsella rubella]
Length=593

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 121/203 (60%), Gaps = 19/203 (9%)
 Frame = +2

Query  164  RDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDAS  343
            RD SPDS+IFT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L   +   +S
Sbjct  60   RDSSPDSIIFTPESNLSLFSSASVSVDRCSTTSDAHDRD----SLVSGPSLERDQRVGSS  115

Query  344  HGRASDRKTPAVHL-----SRKEKAKVQI-ADNSEIETEDENLAVD-SARNSFSQALKEC  502
              +  D             +RK   KV+   +  E+  +DE+  +D SAR+SFS AL+EC
Sbjct  116  SCKDLDLDKRGTGWKNSRNARKNSNKVKAWKEEFEVNKDDESQNLDDSARSSFSVALREC  175

Query  503  QDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGT  682
            Q+RRSRS    KK D +R  SLDL     +   SSSP+   +K+  V+T++   FPSPGT
Sbjct  176  QERRSRSEALAKKLDYQRTTSLDL-----SNVVSSSPRVVNVKRTSVSTNKSSVFPSPGT  230

Query  683  PNYRYSSMGIQKGWSSERVPLHS  751
            P Y +    +QKGWSSERVPL S
Sbjct  231  PTYLH---NMQKGWSSERVPLRS  250



>ref|XP_010269591.1| PREDICTED: uncharacterized protein LOC104606189 isoform X2 [Nelumbo 
nucifera]
Length=539

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 100/165 (61%), Gaps = 13/165 (8%)
 Frame = +2

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTP-AVH-----LSRKEKAK----VQIADNSEIET  439
            FS     HLAG + H+ S G   D K P AV      + + EKAK     +     EIET
Sbjct  10   FSALKLEHLAGRDLHECSRGPDLDPKRPFAVQRSSHTVKKGEKAKDREEEEEEQQEEIET  69

Query  440  EDENLAVDSARNSFSQALKECQDRRSRSGV--PLKKPDRRRPASLDLnnsvtnaansssP  613
            ED+   +D A++SFS AL+ECQ RR +S +    K   ++RP SLDLN   ++A  SS P
Sbjct  70   EDDTQTLDPAKDSFSIALRECQIRRLKSDLLTAAKIQGKQRPTSLDLNGQGSDATGSS-P  128

Query  614  QFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLH  748
            + G M+K   ++ R G FPSPGTPNYR  ++G+QKGWSSERVPLH
Sbjct  129  RLGGMRKNSGSSRRSGTFPSPGTPNYRPGNIGVQKGWSSERVPLH  173



>gb|ABC47866.1| remorin [Glycine max]
Length=526

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 122/216 (56%), Gaps = 44/216 (20%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE+GF++++S   G RAR  SPDSV+FT +SNLSLFS ASASVDRCSF+SD+HDH+  S
Sbjct  1    MAEVGFQERSSWRVGLRARYSSPDSVVFTLESNLSLFSYASASVDRCSFSSDSHDHD--S  58

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIADNSEIETEDENLAVDSA  469
            F       +     ++ ++G+     T A +  + + A +Q           E + +DSA
Sbjct  59   FVSEISLDMRWWWHNNNNNGKDYKHATRAFNFGKID-ADIQ-----------EPVELDSA  106

Query  470  RNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTT  649
            RNSFS ALKE                    ASLDL      + + S P+   +KK  +++
Sbjct  107  RNSFSLALKEA-------------------ASLDL---NNASGSGSLPRLQTLKKTSISS  144

Query  650  SRGG--AFPSPGTPNYRYSSMGIQKGWSSERVPLHS  751
             R G   FPSPGT NYR   + + KGWSSERVPLH+
Sbjct  145  RRSGTATFPSPGTLNYR---VAMHKGWSSERVPLHA  177



>gb|KEH40032.1| carboxy-terminal region remorin [Medicago truncatula]
Length=558

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 81/129 (63%), Gaps = 13/129 (10%)
 Frame = +2

Query  389  RKEKAKVQIADNSEIETEDENLA--VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPA  562
            + EK KVQ  D S+I+++D N     DSARNSFS ALKECQDRRSR     KK DRRRPA
Sbjct  69   KAEKTKVQKED-SDIDSKDGNQLSEFDSARNSFSLALKECQDRRSRCESLFKKQDRRRPA  127

Query  563  SLDLnnsvtnaansssPQFGVMKKVYVTTSRG--------GAFPSPGTPNYRYSSMGI--  712
            SLDLNN+      SS    G +KK  V + +         G FPSPGTPNYR+   G+  
Sbjct  128  SLDLNNANATGTGSSPRLVGAVKKSMVQSRKSGTGTATGTGTFPSPGTPNYRHCQGGVAM  187

Query  713  QKGWSSERV  739
            QKGWSSERV
Sbjct  188  QKGWSSERV  196



>ref|XP_009107448.1| PREDICTED: uncharacterized protein LOC103833110 [Brassica rapa]
Length=515

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 110/207 (53%), Gaps = 35/207 (17%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R  ASG   RD SPDS+ FT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L
Sbjct  10   RSTASGGSRRDSSPDSLNFTPESNLSLFSSASVSVDRCSLTSDAHDRD----SLVSAPSL  65

Query  317  AGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQ  487
               +  D        R T     SR  +  +++        +  EDE   +DSAR+SFS 
Sbjct  66   ERDQRVDPDK-----RGTGCKKNSRNSRKSIKVKAWKQECVVNKEDEIQNLDSARSSFSV  120

Query  488  ALKECQDRRSRSGVPLKKPDRRR-PASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGA  664
            AL+ECQ+R+SRS    K  D +R   SLDL+                 KK  V+T++   
Sbjct  121  ALRECQERKSRSEAVTKMLDNQRTTTSLDLS-----------------KKTSVSTNKSSV  163

Query  665  FPSPGTPNYRYSSMGIQKGWSSERVPL  745
            FPSPGTP Y      +QKGWSSERV L
Sbjct  164  FPSPGTPTY-----TMQKGWSSERVAL  185



>emb|CDY17058.1| BnaA08g04220D [Brassica napus]
Length=515

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 110/207 (53%), Gaps = 35/207 (17%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R  ASG   RD SPDS+ FT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L
Sbjct  10   RSTASGGSRRDSSPDSLNFTPESNLSLFSSASVSVDRCSLTSDAHDRD----SLVSAPSL  65

Query  317  AGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQ  487
               +  D        R T     SR  +  +++        +  EDE   +DSAR+SFS 
Sbjct  66   ERDQRVDPDK-----RGTGCKKNSRNSRKSIKVKAWKQECVVNKEDEIQNLDSARSSFSV  120

Query  488  ALKECQDRRSRSGVPLKKPDRRR-PASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGA  664
            AL+ECQ+R+SRS    K  D +R   SLDL+                 KK  V+T++   
Sbjct  121  ALRECQERKSRSEAVAKMLDNQRTTTSLDLS-----------------KKTSVSTNKSSV  163

Query  665  FPSPGTPNYRYSSMGIQKGWSSERVPL  745
            FPSPGTP Y      +QKGWSSERV L
Sbjct  164  FPSPGTPTY-----TMQKGWSSERVAL  185



>emb|CDY43217.1| BnaC08g04900D [Brassica napus]
Length=516

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 111/209 (53%), Gaps = 38/209 (18%)
 Frame = +2

Query  137  RDQASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSSFSDTSQPHL  316
            R  ASG   RD SPDS+ FT +SNLSLFSSAS SVDRCS  SDAHD +    S  S P L
Sbjct  10   RSTASGGSQRDSSPDSLNFTPESNLSLFSSASVSVDRCSLTSDAHDRD----SLLSAPSL  65

Query  317  AGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIA---DNSEIETEDENLAVDSARNSFSQ  487
               +  D       D++      SR  +  +++        +  EDE   +DSAR+SFS 
Sbjct  66   ERDQRVDP------DKRETGCKNSRNSRKSIKVKAWKQECVVNKEDEIQNLDSARSSFSV  119

Query  488  ALKECQDRRSRSGVPLKKPDRRRP---ASLDLnnsvtnaansssPQFGVMKKVYVTTSRG  658
            AL+ECQ+R+SRS    K  D +R     SLDL+                 KK  V+T++ 
Sbjct  120  ALRECQERKSRSEAVAKMLDNQRATATTSLDLS-----------------KKTSVSTNKS  162

Query  659  GAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
              FPSPGTP Y      +QKGWSSERV +
Sbjct  163  SVFPSPGTPTY-----TMQKGWSSERVAI  186



>gb|KHN22327.1| Hypothetical protein glysoja_022083 [Glycine soja]
Length=515

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 118/218 (54%), Gaps = 59/218 (27%)
 Frame = +2

Query  119  MAELGFRDQAS---GFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            MAE+GF++++S   G RA   SPDSV+FT +SNLSLFS ASASVDRCSF+SD+HDH DS 
Sbjct  1    MAEVGFQERSSWRVGLRASYSSPDSVVFTLESNLSLFSYASASVDRCSFSSDSHDH-DSF  59

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIADN-SEIETE-DENLAVD  463
             S+ S                          L RK+      A N  +I+ +  E + +D
Sbjct  60   VSEIS--------------------------LDRKDYKHATRAFNFGKIDADIQEPVELD  93

Query  464  SARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYV  643
            SARNSFS ALKE                    ASLDL      + + S P+   +KK  +
Sbjct  94   SARNSFSLALKEA-------------------ASLDL---NNASGSGSLPRLQTLKKTSI  131

Query  644  TTSRGG--AFPSPGTPNYRYSSMGIQKGWSSERVPLHS  751
            ++ R G   FPSPGT NYR   + + KGWSSERVPLH+
Sbjct  132  SSRRSGTATFPSPGTLNYR---VAMHKGWSSERVPLHA  166



>ref|XP_010939408.1| PREDICTED: uncharacterized protein LOC105058235 isoform X1 [Elaeis 
guineensis]
Length=664

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 119/251 (47%), Gaps = 56/251 (22%)
 Frame = +2

Query  149  SGFRARDV-SPDSVIFTAD--------------snlslfssasasVDRCSFASDAHDHED  283
            +G R R V SPDSVIF +               +   L S++ ++  RCSF SD    +D
Sbjct  33   AGGRRRAVESPDSVIFRSSDHHSAGNGNASVRSAGSHLSSASGSAAYRCSFGSD----QD  88

Query  284  SSFSDTSQPHLAGHE------------------------FHDASHGRASDRKTPAVHLSR  391
            ++FS  S  HLAG E                            SH     + +     + 
Sbjct  89   AAFSQLSVLHLAGRERSGGAGPDPEPEKGASLPFPSPDILTAQSHKEDQRKLSSFSGFTD  148

Query  392  KEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGV---PLKKPDRRRPA  562
             E+  VQ  +  E E ++E  + D  ++SFS AL EC++RR RS     P  KP RRRPA
Sbjct  149  LEEDSVQSGEEEEEEEQEEEESPDPPQHSFSHALTECKNRRFRSEAGPFPGSKPRRRRPA  208

Query  563  SLDLnnsvtnaansssPQF------GVMKK--VYVTTSRGGAFPSPGTPNYR--YSSMGI  712
            SLDL NS    A + SP+F      G MKK     + SR G FPSPGTPN+R      G 
Sbjct  209  SLDLGNSQGTDAAALSPRFLVGGLGGGMKKSSTSSSRSRSGTFPSPGTPNFRQGVGPAGY  268

Query  713  QKGWSSERVPL  745
            QKGWSSERV L
Sbjct  269  QKGWSSERVAL  279



>ref|XP_010939409.1| PREDICTED: uncharacterized protein LOC105058235 isoform X2 [Elaeis 
guineensis]
Length=662

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 119/251 (47%), Gaps = 56/251 (22%)
 Frame = +2

Query  149  SGFRARDV-SPDSVIFTAD--------------snlslfssasasVDRCSFASDAHDHED  283
            +G R R V SPDSVIF +               +   L S++ ++  RCSF SD    +D
Sbjct  33   AGGRRRAVESPDSVIFRSSDHHSAGNGNASVRSAGSHLSSASGSAAYRCSFGSD----QD  88

Query  284  SSFSDTSQPHLAGHE------------------------FHDASHGRASDRKTPAVHLSR  391
            ++FS  S  HLAG E                            SH     + +     + 
Sbjct  89   AAFSQLSVLHLAGRERSGGAGPDPEPEKGASLPFPSPDILTAQSHKEDQRKLSSFSGFTD  148

Query  392  KEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGV---PLKKPDRRRPA  562
             E+  VQ  +  E E ++E  + D  ++SFS AL EC++RR RS     P  KP RRRPA
Sbjct  149  LEEDSVQSGEEEEEEEQEEEESPDPPQHSFSHALTECKNRRFRSEAGPFPGSKPRRRRPA  208

Query  563  SLDLnnsvtnaansssPQF------GVMKK--VYVTTSRGGAFPSPGTPNYR--YSSMGI  712
            SLDL NS    A + SP+F      G MKK     + SR G FPSPGTPN+R      G 
Sbjct  209  SLDLGNSQGTDAAALSPRFLVGGLGGGMKKSSTSSSRSRSGTFPSPGTPNFRQGVGPAGY  268

Query  713  QKGWSSERVPL  745
            QKGWSSERV L
Sbjct  269  QKGWSSERVAL  279



>ref|XP_010939410.1| PREDICTED: uncharacterized protein LOC105058235 isoform X3 [Elaeis 
guineensis]
Length=662

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 119/251 (47%), Gaps = 58/251 (23%)
 Frame = +2

Query  149  SGFRARDV-SPDSVIFTAD--------------snlslfssasasVDRCSFASDAHDHED  283
            +G R R V SPDSVIF +               +   L S++ ++  RCSF SD    +D
Sbjct  33   AGGRRRAVESPDSVIFRSSDHHSAGNGNASVRSAGSHLSSASGSAAYRCSFGSD----QD  88

Query  284  SSFSDTSQPHLAGHE------------------------FHDASHGRASDRKTPAVHLSR  391
            ++FS  S  HLAG E                            SH     + +     + 
Sbjct  89   AAFSQLS--HLAGRERSGGAGPDPEPEKGASLPFPSPDILTAQSHKEDQRKLSSFSGFTD  146

Query  392  KEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGV---PLKKPDRRRPA  562
             E+  VQ  +  E E ++E  + D  ++SFS AL EC++RR RS     P  KP RRRPA
Sbjct  147  LEEDSVQSGEEEEEEEQEEEESPDPPQHSFSHALTECKNRRFRSEAGPFPGSKPRRRRPA  206

Query  563  SLDLnnsvtnaansssPQF------GVMKK--VYVTTSRGGAFPSPGTPNYR--YSSMGI  712
            SLDL NS    A + SP+F      G MKK     + SR G FPSPGTPN+R      G 
Sbjct  207  SLDLGNSQGTDAAALSPRFLVGGLGGGMKKSSTSSSRSRSGTFPSPGTPNFRQGVGPAGY  266

Query  713  QKGWSSERVPL  745
            QKGWSSERV L
Sbjct  267  QKGWSSERVAL  277



>ref|XP_008777596.1| PREDICTED: uncharacterized protein LOC103697505 isoform X1 [Phoenix 
dactylifera]
Length=642

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 26/189 (14%)
 Frame = +2

Query  239  VDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDAS-------HGRASDRKTPAVHLSRKE  397
            VDRCSF SD     D  FS  S  HLAG E    +        G +S    P    ++  
Sbjct  80   VDRCSFGSD----HDPFFSQFSALHLAGRERCSGAGPDPNPEKGASSPFPFPGTLTTQPH  135

Query  398  KAKVQIADNSEIETEDENL-AVDSARNSFSQALKECQDRRSRS---GVPLKKPDRRRPAS  565
            K   ++ D+ + E E+E   + D++++SFS AL+EC++RRSRS    +P +KP RRRPAS
Sbjct  136  KGFTELEDSLQAEEEEEEEESQDASQHSFSHALRECKNRRSRSEAVPLPGRKPRRRRPAS  195

Query  566  LDLnnsvtnaansssPQFGV------MKK--VYVTTSRGGAFPSPGTPNYRY--SSMGIQ  715
            LDL NS  + A   SP F V      MK+     + SR G FPSPGTPNYR+   + G Q
Sbjct  196  LDL-NSQGSDAALLSPSFLVGVLGAGMKQSSAASSRSRSGTFPSPGTPNYRHGVGAAGYQ  254

Query  716  KGWSSERVP  742
            KGWSSERVP
Sbjct  255  KGWSSERVP  263



>ref|XP_006576631.1| PREDICTED: uncharacterized protein LOC100306536 isoform X3 [Glycine 
max]
Length=174

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 79/123 (64%), Gaps = 14/123 (11%)
 Frame = +2

Query  389  RKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASL  568
            R++KAKVQ  ++ + + + E + +DSARNSFS ALKECQD+RS+    LKK      ASL
Sbjct  15   REKKAKVQDDEDRDADIQ-EPVELDSARNSFSLALKECQDKRSKFEALLKK-----AASL  68

Query  569  DLnnsvtnaansssPQFGVMKKVYVTTSRGG--AFPSPGTPNYRYSSMGIQKGWSSERVP  742
            DLNN   + ++    +   +KK  +++ R G   FP PGTPN+    + + KGWSSE+VP
Sbjct  69   DLNNDFGSGSSR---RLQTLKKSSISSRRSGTATFPIPGTPNFH---IAMYKGWSSEQVP  122

Query  743  LHS  751
            L++
Sbjct  123  LYA  125



>ref|XP_006576629.1| PREDICTED: uncharacterized protein LOC100306536 isoform X1 [Glycine 
max]
 ref|XP_006576630.1| PREDICTED: uncharacterized protein LOC100306536 isoform X2 [Glycine 
max]
Length=200

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 79/123 (64%), Gaps = 14/123 (11%)
 Frame = +2

Query  389  RKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASL  568
            R++KAKVQ  ++ + + + E + +DSARNSFS ALKECQD+RS+    LKK      ASL
Sbjct  15   REKKAKVQDDEDRDADIQ-EPVELDSARNSFSLALKECQDKRSKFEALLKK-----AASL  68

Query  569  DLnnsvtnaansssPQFGVMKKVYVTTSRGG--AFPSPGTPNYRYSSMGIQKGWSSERVP  742
            DLNN   + ++    +   +KK  +++ R G   FP PGTPN+    + + KGWSSE+VP
Sbjct  69   DLNNDFGSGSSR---RLQTLKKSSISSRRSGTATFPIPGTPNFH---IAMYKGWSSEQVP  122

Query  743  LHS  751
            L++
Sbjct  123  LYA  125



>ref|XP_008777597.1| PREDICTED: uncharacterized protein LOC103697505 isoform X2 [Phoenix 
dactylifera]
Length=639

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 29/189 (15%)
 Frame = +2

Query  239  VDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDAS-------HGRASDRKTPAVHLSRKE  397
            VDRCSF SD     D  FS  S  HLAG E    +        G +S    P    ++  
Sbjct  80   VDRCSFGSD----HDPFFSQFSALHLAGRERCSGAGPDPNPEKGASSPFPFPGTLTTQPH  135

Query  398  KAKVQIADNSEIETEDENL-AVDSARNSFSQALKECQDRRSRS---GVPLKKPDRRRPAS  565
            K   ++ D+ + E E+E   + D++++SFS AL+EC++RRSRS    +P +KP RRRPAS
Sbjct  136  K---ELEDSLQAEEEEEEEESQDASQHSFSHALRECKNRRSRSEAVPLPGRKPRRRRPAS  192

Query  566  LDLnnsvtnaansssPQFGV------MKK--VYVTTSRGGAFPSPGTPNYRY--SSMGIQ  715
            LDL NS  + A   SP F V      MK+     + SR G FPSPGTPNYR+   + G Q
Sbjct  193  LDL-NSQGSDAALLSPSFLVGVLGAGMKQSSAASSRSRSGTFPSPGTPNYRHGVGAAGYQ  251

Query  716  KGWSSERVP  742
            KGWSSERVP
Sbjct  252  KGWSSERVP  260



>gb|KHN28724.1| hypothetical protein glysoja_049021 [Glycine soja]
Length=216

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 70/126 (56%), Gaps = 13/126 (10%)
 Frame = +2

Query  386  SRKEKAKVQIADNSEIETED----ENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRR  553
            S  E  +++IA   + E  D    E + +DSARNSFS ALKECQD+RS+    LKK    
Sbjct  25   STNEVNRLKIAILQDDEDRDADIQEPVELDSARNSFSLALKECQDKRSKFEALLKK----  80

Query  554  RPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSE  733
              ASLDLNN   + ++    Q      +    S    FP PGTPN+    + + KGWSSE
Sbjct  81   -AASLDLNNDFGSGSSRRL-QTLKKSSISSRRSGTATFPIPGTPNFH---IAMYKGWSSE  135

Query  734  RVPLHS  751
            +VPL++
Sbjct  136  QVPLYA  141



>ref|XP_010263528.1| PREDICTED: uncharacterized protein LOC104601769 [Nelumbo nucifera]
Length=139

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = +2

Query  119  MAELGFRD---QASGFRARDVSPDSVIFTADsnlslfssasasVDRCSFASDAHDHEDSS  289
            M  LG ++   + S  + RD SP+SVIFT +SNLSL SSAS SVDRCSFASD HDHE  S
Sbjct  1    MRMLGLQETKPERSACQGRDDSPNSVIFTQESNLSLVSSASGSVDRCSFASDVHDHE--S  58

Query  290  FSDTSQPHLAGHEFHDASHGRASDRKTPAV-----HLSRK-EKAKVQIADNSEIETEDEN  451
            F      HLAG + HD+S G   + K P       H  RK E AK    +  EIET+D+N
Sbjct  59   FVSELSKHLAGSDLHDSSSGPDLNPKRPLTVQKNSHPVRKGESAKDTDREEEEIETDDDN  118

Query  452  LAVDSAR--NSFSQAL  493
              +D  +  +SFS AL
Sbjct  119  QILDRGKDFDSFSTAL  134



>ref|XP_010943079.1| PREDICTED: uncharacterized protein LOC105060910 isoform X1 [Elaeis 
guineensis]
Length=644

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 96/192 (50%), Gaps = 28/192 (15%)
 Frame = +2

Query  239  VDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIA  418
             DRCSF SD     D  FS  S  HLAG E    +       K  +        +   + 
Sbjct  80   ADRCSFGSD----HDPFFSQLSALHLAGRERCGGAGPDPDPEKGVSSPFPSPSPSPGSLT  135

Query  419  DNSEIETEDENLAV----------DSARNSFSQALKECQDRRSRSG---VPLKKPDRRRP  559
                 E E+++L            D +++SFS  L+E ++RRSRS    +P +KP RRRP
Sbjct  136  TQPPKELEEDSLQAEEEEEEEESQDPSQHSFSHGLREGENRRSRSEAAHLPGRKPRRRRP  195

Query  560  ASLDLnnsvtnaansssPQFGV------MKK--VYVTTSRGGAFPSPGTPNYRY--SSMG  709
            ASLDL NS  + A   SP   V      MK+     + SR G FPSPGTPNYR+   + G
Sbjct  196  ASLDL-NSQGSDAAFLSPGILVGGLGAGMKQSSAASSRSRSGTFPSPGTPNYRHGVGAAG  254

Query  710  IQKGWSSERVPL  745
             QKGWSSERVPL
Sbjct  255  YQKGWSSERVPL  266



>gb|KCW68730.1| hypothetical protein EUGRSUZ_F02334 [Eucalyptus grandis]
Length=353

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  641  VTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            + T + G FPSPGTPNYR++++G+QKGWSSERVPL SS
Sbjct  1    MATRQSGTFPSPGTPNYRHANVGLQKGWSSERVPLQSS  38



>dbj|BAK05282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 14/102 (14%)
 Frame = +2

Query  488  ALKECQ-DRRSRS-GVPL--KKPDRRRPASLDLnnsvtnaansssPQF-----GVMKKVY  640
            A++ECQ  RR R+  V L  +K  ++RPASLD  ++  ++    SP F     G + K  
Sbjct  109  AIRECQSQRRCRTDAVYLHGRKGLKQRPASLDFGSAGFSSGTPFSPGFVVGGAGFVSKGL  168

Query  641  VTTS-RGGAFPSPGTPNY----RYSSMGIQKGWSSERVPLHS  751
            V++    G FPSPGTP+Y    R S++G QKGWSSERVPL S
Sbjct  169  VSSQISSGVFPSPGTPSYPRRHRPSALGYQKGWSSERVPLPS  210



>dbj|BAK05507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 62/102 (61%), Gaps = 14/102 (14%)
 Frame = +2

Query  488  ALKECQ-DRRSRS-GVPL--KKPDRRRPASLDLnnsvtnaansssPQF-----GVMKKVY  640
            A++ECQ  RR R+  V L  +K  ++RPASLD  ++  ++    SP F     G + K  
Sbjct  117  AIRECQSQRRCRTDAVYLHGRKGLKQRPASLDFGSAGFSSGTPFSPGFVVGGAGFVSKGL  176

Query  641  VTTS-RGGAFPSPGTPNY----RYSSMGIQKGWSSERVPLHS  751
            V++    G FPSPGTP+Y    R S++G QKGWSSERVPL S
Sbjct  177  VSSQISSGVFPSPGTPSYPRRHRPSALGYQKGWSSERVPLPS  218



>ref|XP_009391360.1| PREDICTED: uncharacterized protein LOC103977539 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=536

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 13/108 (12%)
 Frame = +2

Query  458  VDSARNSFSQALKECQDRRSRS---GVPLKKPDRRRPASLDLnnsvtnaansssPQF--G  622
            +D +++SFS AL+ECQ+RR RS    +P +KP R +   LD  +  +   +  SP+F  G
Sbjct  48   LDPSKHSFSHALRECQNRRCRSEAVDLPGRKPQRPQQLLLDF-HGQSADVSVLSPRFLAG  106

Query  623  VMKKV-----YVTTSRGGAFPSPGTPNYRY--SSMGIQKGWSSERVPL  745
             +  +       + SR G FPSPGTPNY +   +    KGWSSERVPL
Sbjct  107  GLTGMKKSSAASSRSRSGTFPSPGTPNYGHGAGAAAFHKGWSSERVPL  154



>ref|XP_008777598.1| PREDICTED: uncharacterized protein LOC103697505 isoform X3 [Phoenix 
dactylifera]
Length=564

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 14/107 (13%)
 Frame = +2

Query  461  DSARNSFSQALKECQDRRSRS---GVPLKKPDRRRPASLDLnnsvtnaansssPQFGV--  625
            D++++SFS AL+EC++RRSRS    +P +KP RRRPASLDL NS  + A   SP F V  
Sbjct  80   DASQHSFSHALRECKNRRSRSEAVPLPGRKPRRRRPASLDL-NSQGSDAALLSPSFLVGV  138

Query  626  ----MKK--VYVTTSRGGAFPSPGTPNYRY--SSMGIQKGWSSERVP  742
                MK+     + SR G FPSPGTPNYR+   + G QKGWSSERVP
Sbjct  139  LGAGMKQSSAASSRSRSGTFPSPGTPNYRHGVGAAGYQKGWSSERVP  185



>gb|EMS45100.1| hypothetical protein TRIUR3_26924 [Triticum urartu]
Length=606

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 14/102 (14%)
 Frame = +2

Query  488  ALKECQ-DRRSRS-GVPL--KKPDRRRPASLDLnnsvtnaansssPQF-----GVMKKVY  640
            A++ECQ  RR R+  V L  +K  ++RPASLD  ++  N+    SP F     G   K  
Sbjct  130  AIRECQSQRRCRTEAVYLHGRKGLKQRPASLDFGSAGFNSGTPFSPGFVVGGAGFASKGL  189

Query  641  VTTS-RGGAFPSPGTPNY----RYSSMGIQKGWSSERVPLHS  751
            V++    G FPSPGTP+Y    R S++G QKGWSSERVPL S
Sbjct  190  VSSQISSGVFPSPGTPSYPRRHRPSALGYQKGWSSERVPLPS  231



>ref|XP_004957009.1| PREDICTED: uncharacterized protein LOC101758590 [Setaria italica]
Length=606

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 16/116 (14%)
 Frame = +2

Query  431  IETEDENLAVDSARNSFSQALKECQDRR--SRSGVPL--KKPDRRRPASLDLnnsvtnaa  598
            ++ E+     +SA+N   +A  EC + R  + + V L  +K  ++RPASLDL++   + A
Sbjct  110  VKEEEWAKVQESAKNLAGRATPECHNERYGTEAAVLLHGRKGSKQRPASLDLSSPGFHGA  169

Query  599  nsssPQF-----GVMKKVYVTTSRGGAFPSPGTPNY---RYSSMGIQKGWSSERVP  742
              S P F     G+MK  ++   R   F SPGTPNY   R S +G QKGW SERVP
Sbjct  170  TFS-PSFVVGGVGLMKASHI---RSDVFHSPGTPNYPRHRASVLGFQKGWCSERVP  221



>ref|XP_007017209.1| Remorin family protein isoform 3 [Theobroma cacao]
 gb|EOY14434.1| Remorin family protein isoform 3 [Theobroma cacao]
Length=405

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +2

Query  626  MKKVYVTTSRGGAFPSPGTPNYRYSSM---GIQKGWSSERVPLHSS  754
            MKK  V T + GAFPSPGTP+Y +      G+QKGWSSERVPLH++
Sbjct  1    MKKSSVATRKSGAFPSPGTPSYHHHHHSSAGMQKGWSSERVPLHNN  46



>gb|ABK93434.1| unknown [Populus trichocarpa]
Length=203

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +2

Query  626  MKKVYVTTSR-GGAFPSPGTPNYRYSSMGIQKGWSSERVPL  745
            MKK  V +SR  G FPSPGTPNY +SS G+QKGWSSERVPL
Sbjct  1    MKKSIVYSSRKSGTFPSPGTPNY-HSSAGMQKGWSSERVPL  40



>ref|XP_010263530.1| PREDICTED: uncharacterized protein LOC104601770 [Nelumbo nucifera]
Length=409

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  665  FPSPGTPNYRYSSMGIQKGWSSERVPL  745
            FPSPGTPNYR+ S+G+QKGWSSERVPL
Sbjct  14   FPSPGTPNYRHGSVGVQKGWSSERVPL  40



>ref|XP_010943080.1| PREDICTED: uncharacterized protein LOC105060910 isoform X2 [Elaeis 
guineensis]
Length=643

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 95/192 (49%), Gaps = 29/192 (15%)
 Frame = +2

Query  239  VDRCSFASDAHDHEDSSFSDTSQPHLAGHEFHDASHGRASDRKTPAVHLSRKEKAKVQIA  418
             DRCSF SD     D  FS  S  HLAG E    +       K  +        +   + 
Sbjct  80   ADRCSFGSD----HDPFFSQLSALHLAGRERCGGAGPDPDPEKGVSSPFPSPSPSPGSLT  135

Query  419  DNSEIETEDENLAV----------DSARNSFSQALKECQDRRSRSG---VPLKKPDRRRP  559
                 E E+++L            D +++SFS  L+  ++RRSRS    +P +KP RRRP
Sbjct  136  TQPPKELEEDSLQAEEEEEEEESQDPSQHSFSHGLR-GENRRSRSEAAHLPGRKPRRRRP  194

Query  560  ASLDLnnsvtnaansssPQFGV------MKK--VYVTTSRGGAFPSPGTPNYRY--SSMG  709
            ASLDL NS  + A   SP   V      MK+     + SR G FPSPGTPNYR+   + G
Sbjct  195  ASLDL-NSQGSDAAFLSPGILVGGLGAGMKQSSAASSRSRSGTFPSPGTPNYRHGVGAAG  253

Query  710  IQKGWSSERVPL  745
             QKGWSSERVPL
Sbjct  254  YQKGWSSERVPL  265



>gb|EEC83721.1| hypothetical protein OsI_29560 [Oryza sativa Indica Group]
Length=599

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 62/108 (57%), Gaps = 13/108 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +NS ++++ ECQD+R R G  L   K   ++RPAS+D      + +++ SP F     G 
Sbjct  108  KNSAARSIGECQDQRYRLGSVLFHGKNERKQRPASVDFGCPSVDRSSTHSPGFLVNGTGA  167

Query  626  MKKVYVTTSRG--GAFPSPGTPNYR---YSSMGIQKGWSSERVPLHSS  754
            M K    +S+   GA  SPGTP+Y     + +G Q+GWSSERV L S+
Sbjct  168  MNKGLSVSSQNKPGAPTSPGTPSYNRQGATVVGYQQGWSSERVALSSN  215



>gb|EEC84699.1| hypothetical protein OsI_31639 [Oryza sativa Indica Group]
Length=617

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 54/99 (55%), Gaps = 14/99 (14%)
 Frame = +2

Query  497  ECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaans-ssPQF-----GVMKKVYVTT  649
            EC  +R RS   L   +K  ++RPASLD  +       +  SP F     G+M K  V++
Sbjct  143  ECLYQRRRSEAVLLQGRKGLKQRPASLDFGSGSPGFNGAPLSPGFVVGGVGLMNKGLVSS  202

Query  650  S--RGGAFPSPGTPNYRY---SSMGIQKGWSSERVPLHS  751
            S  R   FPSP TPNYR    S  G QKGWSSERVPL S
Sbjct  203  SFIRSDVFPSPRTPNYRRHRSSVFGYQKGWSSERVPLAS  241



>ref|NP_001063361.1| Os09g0456100 [Oryza sativa Japonica Group]
 dbj|BAD38292.1| remorin protein-like [Oryza sativa Japonica Group]
 dbj|BAD38465.1| remorin protein-like [Oryza sativa Japonica Group]
 dbj|BAF25275.1| Os09g0456100 [Oryza sativa Japonica Group]
Length=620

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 54/99 (55%), Gaps = 14/99 (14%)
 Frame = +2

Query  497  ECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaans-ssPQF-----GVMKKVYVTT  649
            EC  +R RS   L   +K  ++RPASLD  +       +  SP F     G+M K  V++
Sbjct  146  ECLYQRRRSEAVLLQGRKGLKQRPASLDFGSGSPGFNGAPLSPGFVVGGVGLMNKGLVSS  205

Query  650  S--RGGAFPSPGTPNYRY---SSMGIQKGWSSERVPLHS  751
            S  R   FPSP TPNYR    S  G QKGWSSERVPL S
Sbjct  206  SFIRSDVFPSPRTPNYRRHRSSVFGYQKGWSSERVPLAS  244



>gb|KJB63847.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
 gb|KJB63850.1| hypothetical protein B456_010G020400 [Gossypium raimondii]
Length=398

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  626  MKKVYVTTSRGGAFPSPGTPNYRYS---SMGIQKGWSSERVPLHSS  754
            MKK  V+T + GAFPSPGTPNY +    S G+QKG SSERVPLH++
Sbjct  1    MKKSSVSTRKSGAFPSPGTPNYHHHNNLSAGMQKGSSSERVPLHNN  46



>gb|EEE69848.1| hypothetical protein OsJ_29623 [Oryza sativa Japonica Group]
Length=579

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 54/99 (55%), Gaps = 14/99 (14%)
 Frame = +2

Query  497  ECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaans-ssPQF-----GVMKKVYVTT  649
            EC  +R RS   L   +K  ++RPASLD  +       +  SP F     G+M K  V++
Sbjct  143  ECLYQRRRSEAVLLQGRKGLKQRPASLDFGSGSPGFNGAPLSPGFVVGGVGLMNKGLVSS  202

Query  650  S--RGGAFPSPGTPNYRY---SSMGIQKGWSSERVPLHS  751
            S  R   FPSP TPNYR    S  G QKGWSSERVPL S
Sbjct  203  SFIRSDVFPSPRTPNYRRHRSSVFGYQKGWSSERVPLAS  241



>ref|XP_006660693.1| PREDICTED: uncharacterized protein LOC102711560 [Oryza brachyantha]
Length=619

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 57/108 (53%), Gaps = 14/108 (13%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaans-ssPQF-----G  622
            +N    A  EC  +R RS   +   KK  ++RPASLD  +       +  SP F     G
Sbjct  133  KNPADSATGECLYQRCRSEAVILQGKKGLKQRPASLDFGSGSPGFNGTPLSPGFVVGGVG  192

Query  623  VMKKVYVTTS--RGGAFPSPGTPNYR---YSSMGIQKGWSSERVPLHS  751
            +M K  V++S  R   FPSP TPN+R    S  G QKGWSSERVPL S
Sbjct  193  LMNKGLVSSSFIRSDVFPSPRTPNFRRHRSSVFGHQKGWSSERVPLPS  240



>ref|NP_001062016.1| Os08g0471800 [Oryza sativa Japonica Group]
 dbj|BAD09354.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD09867.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23930.1| Os08g0471800 [Oryza sativa Japonica Group]
 dbj|BAG97178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=602

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 13/108 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +NS +++  ECQD+R R G  L   K   ++RPAS+D      + +++ SP F     G 
Sbjct  111  KNSAARSTGECQDQRYRLGSVLFHGKNERKQRPASVDFGCPSVDRSSTHSPGFLVNGTGA  170

Query  626  MKKVYVTTSRG--GAFPSPGTPNYR---YSSMGIQKGWSSERVPLHSS  754
            M K    +S+   GA  SPGTP+Y     + +G Q+GWSSERV L S+
Sbjct  171  MNKGLSVSSQNKPGAPTSPGTPSYNRQGATVVGYQQGWSSERVALSSN  218



>ref|XP_010652810.1| PREDICTED: uncharacterized protein LOC100252502 [Vitis vinifera]
Length=430

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 40/75 (53%), Gaps = 11/75 (15%)
 Frame = +2

Query  518  RSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRY  697
            R GV  ++PDR R   L              P   +MKK  VT+   G+FPSPGT NY  
Sbjct  4    RDGVQGRRPDRSRHVWLRFE-----------PSGRIMKKSAVTSHNLGSFPSPGTSNYGD  52

Query  698  SSMGIQKGWSSERVP  742
             S G+ KGWSSERVP
Sbjct  53   GSGGVPKGWSSERVP  67



>gb|EEE68847.1| hypothetical protein OsJ_27640 [Oryza sativa Japonica Group]
Length=602

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 61/108 (56%), Gaps = 13/108 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +NS +++  ECQD+R R G  L   K   ++RPAS+D      + +++ SP F     G 
Sbjct  111  KNSAARSTGECQDQRYRLGSVLFHGKNERKQRPASVDFGCPSVDRSSTHSPGFLVNGTGA  170

Query  626  MKKVYVTTSRG--GAFPSPGTPNYR---YSSMGIQKGWSSERVPLHSS  754
            M K    +S+   GA  SPGTP+Y     + +G Q+GWSSERV L S+
Sbjct  171  MNKGLSVSSQNKPGAPTSPGTPSYNRQGATVVGYQQGWSSERVALSSN  218



>ref|XP_007222845.1| hypothetical protein PRUPE_ppa006694mg [Prunus persica]
 gb|EMJ24044.1| hypothetical protein PRUPE_ppa006694mg [Prunus persica]
Length=399

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  653  RGGAFPSPGTPNYRYSSMGIQKGWSSERVP  742
            + G FPSPGTP+YR +S+G+QKGWSSERVP
Sbjct  5    KSGNFPSPGTPSYRNTSLGVQKGWSSERVP  34



>ref|NP_001169618.1| hypothetical protein [Zea mays]
 gb|ACN34277.1| unknown [Zea mays]
 tpg|DAA61751.1| TPA: hypothetical protein ZEAMMB73_402395 [Zea mays]
Length=612

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +2

Query  431  IETEDENLAVDSARNSFSQALKECQDRRSRSGVPL----KKPDRRRPASLDLnnsvtnaa  598
            ++ E+     + A+N   +A  EC  +R R+   +    +K  ++RPASLDL +   + A
Sbjct  110  VKEEEWAQIQEPAKNPAFRATPECHKQRYRTDAAVLLHGRKGSKQRPASLDLGSPGFHGA  169

Query  599  nsssPQF-----GVMKK-VYVTTSRGGAFPSPGTPNY---RYSSMGIQKGWSSERVP  742
              S P F     G+M K +  +  R   F SPGTPNY   R S +G  KGWSSERVP
Sbjct  170  TFS-PSFVIGGVGLMNKGLGASVIRSDVFHSPGTPNYPRHRASVLGCHKGWSSERVP  225



>ref|XP_008651734.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008651735.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=615

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = +2

Query  431  IETEDENLAVDSARNSFSQALKECQDRRSRSGVPL----KKPDRRRPASLDLnnsvtnaa  598
            ++ E+     + A+N   +A  EC  +R R+   +    +K  ++RPASLDL +   + A
Sbjct  113  VKEEEWAQIQEPAKNPAFRATPECHKQRYRTDAAVLLHGRKGSKQRPASLDLGSPGFHGA  172

Query  599  nsssPQF-----GVMKK-VYVTTSRGGAFPSPGTPNY---RYSSMGIQKGWSSERVP  742
              S P F     G+M K +  +  R   F SPGTPNY   R S +G  KGWSSERVP
Sbjct  173  TFS-PSFVIGGVGLMNKGLGASVIRSDVFHSPGTPNYPRHRASVLGCHKGWSSERVP  228



>emb|CBI21424.3| unnamed protein product [Vitis vinifera]
Length=441

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 40/75 (53%), Gaps = 11/75 (15%)
 Frame = +2

Query  518  RSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKVYVTTSRGGAFPSPGTPNYRY  697
            R GV  ++PDR R   L              P   +MKK  VT+   G+FPSPGT NY  
Sbjct  32   RDGVQGRRPDRSRHVWLRFE-----------PSGRIMKKSAVTSHNLGSFPSPGTSNYGD  80

Query  698  SSMGIQKGWSSERVP  742
             S G+ KGWSSERVP
Sbjct  81   GSGGVPKGWSSERVP  95



>ref|XP_009391362.1| PREDICTED: uncharacterized protein LOC103977539 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=502

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 48/98 (49%), Gaps = 27/98 (28%)
 Frame = +2

Query  458  VDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASLDLnnsvtnaansssPQFGVMKKV  637
            +D +++SFS AL+ECQ+RR RS             ++DL                     
Sbjct  48   LDPSKHSFSHALRECQNRRCRS------------EAVDLPGMK-------------KSSA  82

Query  638  YVTTSRGGAFPSPGTPNYRY--SSMGIQKGWSSERVPL  745
              + SR G FPSPGTPNY +   +    KGWSSERVPL
Sbjct  83   ASSRSRSGTFPSPGTPNYGHGAGAAAFHKGWSSERVPL  120



>ref|XP_010235213.1| PREDICTED: uncharacterized protein LOC100834817 isoform X3 [Brachypodium 
distachyon]
Length=571

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 13/107 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +N   ++  ECQ +R   G  L   +K  ++RP SLD      + +++ SP F     GV
Sbjct  85   KNPVLRSTGECQAQRHPLGAVLFQGRKDRKQRPVSLDFGCPGVDRSSTHSPGFFVSGVGV  144

Query  626  MKKVYVTT--SRGGAFPSPGTPNYR---YSSMGIQKGWSSERVPLHS  751
            M K    +  +R G   SPGTP Y     + +G Q+GWSSERVPL S
Sbjct  145  MNKGLGVSPQNRSGVLTSPGTPGYSRRGTTVVGYQQGWSSERVPLPS  191



>gb|ACU14749.1| unknown [Glycine max]
Length=85

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +2

Query  389  RKEKAKVQIADNSEIETEDENLAVDSARNSFSQALKECQDRRSRSGVPLKKPDRRRPASL  568
            R++KAKVQ  ++ + + + E + +DSARNSFS ALKECQD+RS+    LKK      ASL
Sbjct  15   REKKAKVQDDEDRDADIQ-EPVELDSARNSFSLALKECQDKRSKFEALLKK-----AASL  68

Query  569  DL  574
            DL
Sbjct  69   DL  70



>ref|XP_010235212.1| PREDICTED: uncharacterized protein LOC100834817 isoform X2 [Brachypodium 
distachyon]
Length=575

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 13/107 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +N   ++  ECQ +R   G  L   +K  ++RP SLD      + +++ SP F     GV
Sbjct  89   KNPVLRSTGECQAQRHPLGAVLFQGRKDRKQRPVSLDFGCPGVDRSSTHSPGFFVSGVGV  148

Query  626  MKKVYVTT--SRGGAFPSPGTPNYR---YSSMGIQKGWSSERVPLHS  751
            M K    +  +R G   SPGTP Y     + +G Q+GWSSERVPL S
Sbjct  149  MNKGLGVSPQNRSGVLTSPGTPGYSRRGTTVVGYQQGWSSERVPLPS  195



>ref|XP_003537303.1| PREDICTED: uncharacterized protein LOC100816437 [Glycine max]
 gb|KHN42081.1| hypothetical protein glysoja_003821 [Glycine soja]
Length=408

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  626  MKKVYVTTSRGGAFPSPGTPNYRYSSMGIQKGWSSERVPLHSS  754
            MKK   T+ + G+F SPG PNYR  S+G QKGWSSERV L  S
Sbjct  1    MKKSSGTSQKLGSFLSPGAPNYREKSIGSQKGWSSERVLLQPS  43



>ref|XP_010235209.1| PREDICTED: uncharacterized protein LOC100834817 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235210.1| PREDICTED: uncharacterized protein LOC100834817 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235211.1| PREDICTED: uncharacterized protein LOC100834817 isoform X1 [Brachypodium 
distachyon]
Length=582

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 13/107 (12%)
 Frame = +2

Query  470  RNSFSQALKECQDRRSRSGVPL---KKPDRRRPASLDLnnsvtnaansssPQF-----GV  625
            +N   ++  ECQ +R   G  L   +K  ++RP SLD      + +++ SP F     GV
Sbjct  96   KNPVLRSTGECQAQRHPLGAVLFQGRKDRKQRPVSLDFGCPGVDRSSTHSPGFFVSGVGV  155

Query  626  MKKVYVTT--SRGGAFPSPGTPNYR---YSSMGIQKGWSSERVPLHS  751
            M K    +  +R G   SPGTP Y     + +G Q+GWSSERVPL S
Sbjct  156  MNKGLGVSPQNRSGVLTSPGTPGYSRRGTTVVGYQQGWSSERVPLPS  202



>ref|XP_010232271.1| PREDICTED: uncharacterized protein LOC100839505 [Brachypodium 
distachyon]
 ref|XP_010232272.1| PREDICTED: uncharacterized protein LOC100839505 [Brachypodium 
distachyon]
 ref|XP_010232273.1| PREDICTED: uncharacterized protein LOC100839505 [Brachypodium 
distachyon]
Length=586

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 58/102 (57%), Gaps = 15/102 (15%)
 Frame = +2

Query  488  ALKECQDRR--SRSGVPL--KKPDRRRPASLDLnnsvtnaansssPQF-----GVMKKVY  640
            A++ECQ++R      V L  +K  ++RPASLD  +   N    S P F     G ++K  
Sbjct  109  AIQECQNQRRCQTEAVFLHGRKGLKQRPASLDFGSQGFNGTPFS-PGFVVGGPGFVRKGP  167

Query  641  VTTS-RGGAFPSPGTPNY----RYSSMGIQKGWSSERVPLHS  751
            V++    G F SPGTP+Y    R SS G QKGWSSERVPL S
Sbjct  168  VSSHISSGVFHSPGTPSYPRRHRPSSSGYQKGWSSERVPLRS  209



>ref|XP_010093640.1| hypothetical protein L484_011063 [Morus notabilis]
 gb|EXB54401.1| hypothetical protein L484_011063 [Morus notabilis]
Length=383

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  659  GAFPSPGTPNYRYSSMGIQKGWSSERVP  742
            G FPSPG P YR SS+G QKGW+SERVP
Sbjct  11   GTFPSPGAPQYRGSSIGYQKGWASERVP  38



>ref|XP_010943081.1| PREDICTED: uncharacterized protein LOC105060910 isoform X3 [Elaeis 
guineensis]
Length=422

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = +2

Query  659  GAFPSPGTPNYRY--SSMGIQKGWSSERVPL  745
            G FPSPGTPNYR+   + G QKGWSSERVPL
Sbjct  14   GTFPSPGTPNYRHGVGAAGYQKGWSSERVPL  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1469386858550