BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6281

Length=1071
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007201936.1|  hypothetical protein PRUPE_ppa001850mg             271   4e-80   
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    271   5e-80   Prunus mume [ume]
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    270   1e-79   Populus euphratica
ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           270   2e-79   Solanum lycopersicum
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           270   2e-79   Nicotiana sylvestris
ref|XP_006381053.1|  C2 domain-containing family protein                269   3e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                268   9e-79   Populus euphratica
ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    268   1e-78   Nicotiana tomentosiformis
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    267   1e-78   
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    267   2e-78   Sesamum indicum [beniseed]
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    267   2e-78   Nicotiana tomentosiformis
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    267   3e-78   Glycine max [soybeans]
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    266   4e-78   Glycine soja [wild soybean]
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    266   5e-78   Solanum tuberosum [potatoes]
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    266   5e-78   Solanum lycopersicum
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             266   6e-78   Phaseolus vulgaris [French bean]
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    265   1e-77   Glycine max [soybeans]
ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    265   1e-77   Nicotiana tomentosiformis
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        265   1e-77   Medicago truncatula
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   264   2e-77   Citrus sinensis [apfelsine]
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    265   2e-77   Nicotiana sylvestris
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           265   2e-77   Eucalyptus grandis [rose gum]
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             264   2e-77   Citrus clementina [clementine]
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    264   3e-77   Fragaria vesca subsp. vesca
ref|XP_002532333.1|  synaptotagmin, putative                            262   3e-77   
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                263   5e-77   Cucumis melo [Oriental melon]
ref|XP_012087737.1|  PREDICTED: multiple C2 and transmembrane dom...    263   6e-77   Jatropha curcas
emb|CAN80955.1|  hypothetical protein VITISV_013781                     263   6e-77   Vitis vinifera
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             263   6e-77   
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                263   7e-77   Erythranthe guttata [common monkey flower]
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                263   8e-77   Vitis vinifera
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    263   9e-77   Pyrus x bretschneideri [bai li]
ref|XP_010463385.1|  PREDICTED: multiple C2 and transmembrane dom...    254   9e-77   Camelina sativa [gold-of-pleasure]
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           262   1e-76   Solanum lycopersicum
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    262   1e-76   
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             262   2e-76   Phaseolus vulgaris [French bean]
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    261   3e-76   Cicer arietinum [garbanzo]
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    261   3e-76   Cucumis sativus [cucumbers]
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    261   3e-76   Solanum tuberosum [potatoes]
gb|EPS67145.1|  hypothetical protein M569_07629                         261   4e-76   Genlisea aurea
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    261   4e-76   
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    261   4e-76   Pyrus x bretschneideri [bai li]
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    261   6e-76   Cicer arietinum [garbanzo]
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    260   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    259   1e-75   Cucumis melo [Oriental melon]
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    259   1e-75   
ref|XP_002878177.1|  C2 domain-containing protein                       259   2e-75   
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    258   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             258   3e-75   Capsella rubella
emb|CDP10110.1|  unnamed protein product                                258   3e-75   Coffea canephora [robusta coffee]
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    258   4e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67712.1|  BnaA07g17520D                                          258   5e-75   
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             258   5e-75   Eutrema salsugineum [saltwater cress]
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    258   5e-75   Brassica rapa
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           258   5e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    258   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    258   7e-75   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX98254.1|  BnaC06g16150D                                          257   8e-75   
ref|XP_004144665.1|  PREDICTED: multiple C2 and transmembrane dom...    257   8e-75   Cucumis sativus [cucumbers]
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    257   1e-74   Medicago truncatula
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    256   2e-74   Morus notabilis
emb|CDY47660.1|  BnaC04g23970D                                          256   3e-74   Brassica napus [oilseed rape]
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             255   5e-74   Eutrema salsugineum [saltwater cress]
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    255   8e-74   Arabis alpina [alpine rockcress]
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    255   8e-74   Tarenaya hassleriana [spider flower]
ref|XP_002894324.1|  C2 domain-containing protein                       254   1e-73   
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    254   1e-73   Nicotiana sylvestris
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             254   2e-73   Capsella rubella
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           254   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-73   Glycine max [soybeans]
emb|CDY69710.1|  BnaAnng31280D                                          254   2e-73   Brassica napus [oilseed rape]
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           254   2e-73   Brassica rapa
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    253   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    253   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           253   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           252   7e-73   Elaeis guineensis
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-72   
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    251   1e-72   Phoenix dactylifera
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    251   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             250   3e-72   
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    250   3e-72   Phoenix dactylifera
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           250   4e-72   Phoenix dactylifera
gb|KJB36100.1|  hypothetical protein B456_006G141200                    250   5e-72   Gossypium raimondii
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    248   2e-71   Populus euphratica
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             247   4e-71   Citrus clementina [clementine]
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    247   5e-71   Citrus sinensis [apfelsine]
gb|KJB83485.1|  hypothetical protein B456_013G250100                    246   5e-71   Gossypium raimondii
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    246   8e-71   
ref|XP_002513446.1|  synaptotagmin, putative                            246   1e-70   Ricinus communis
ref|XP_006850074.1|  PREDICTED: extended synaptotagmin-1                246   1e-70   
ref|XP_012092783.1|  PREDICTED: multiple C2 and transmembrane dom...    246   1e-70   Jatropha curcas
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       246   1e-70   Gossypium arboreum [tree cotton]
gb|KJB83481.1|  hypothetical protein B456_013G250100                    246   2e-70   Gossypium raimondii
emb|CBI16433.3|  unnamed protein product                                243   2e-70   Vitis vinifera
ref|XP_002297795.1|  C2 domain-containing family protein                245   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    244   4e-70   Prunus mume [ume]
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             244   6e-70   Prunus persica
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    243   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    243   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    243   2e-69   Vitis vinifera
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    242   5e-69   Populus euphratica
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    241   6e-69   Theobroma cacao [chocolate]
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    241   7e-69   Pyrus x bretschneideri [bai li]
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    241   7e-69   
gb|KJB66120.1|  hypothetical protein B456_010G128400                    241   8e-69   Gossypium raimondii
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    242   9e-69   
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       240   2e-68   Gossypium arboreum [tree cotton]
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        240   3e-68   Medicago truncatula
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    239   3e-68   Fragaria vesca subsp. vesca
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    239   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...    239   3e-68   Glycine max [soybeans]
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    239   5e-68   Oryza brachyantha
ref|NP_001055351.1|  Os05g0370600                                       239   7e-68   
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    238   1e-67   Morus notabilis
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g             237   2e-67   Phaseolus vulgaris [French bean]
gb|EMT24491.1|  Multiple C2 and transmembrane domain-containing p...    235   5e-67   
emb|CDX78498.1|  BnaA03g04100D                                          236   8e-67   
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...    236   8e-67   Brassica rapa
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...    236   8e-67   Triticum urartu
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    235   1e-66   
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200          235   1e-66   Sorghum bicolor [broomcorn]
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg             234   2e-66   Eutrema salsugineum [saltwater cress]
emb|CDX97214.1|  BnaC09g44110D                                          234   3e-66   
ref|XP_004142139.1|  PREDICTED: multiple C2 and transmembrane dom...    234   4e-66   Cucumis sativus [cucumbers]
ref|XP_008449758.1|  PREDICTED: multiple C2 and transmembrane dom...    234   5e-66   Cucumis melo [Oriental melon]
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...    233   6e-66   Eucalyptus grandis [rose gum]
emb|CDY68091.1|  BnaAnng26150D                                          233   6e-66   Brassica napus [oilseed rape]
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    233   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like           232   2e-65   Brassica rapa
emb|CDX70485.1|  BnaC03g05690D                                          232   2e-65   
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...    231   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002871539.1|  C2 domain-containing protein                       231   6e-65   
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...    231   6e-65   
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...    231   6e-65   Glycine soja [wild soybean]
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...    230   9e-65   
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...    230   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003546988.1|  PREDICTED: multiple C2 and transmembrane dom...    229   1e-64   Glycine max [soybeans]
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg             229   2e-64   Capsella rubella
ref|NP_001152102.1|  phosphoribosylanthranilate transferase             228   4e-64   
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...    228   5e-64   
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...    226   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...    226   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...    226   2e-63   Glycine max [soybeans]
ref|XP_007150401.1|  hypothetical protein PHAVU_005G150300g             226   4e-63   Phaseolus vulgaris [French bean]
ref|XP_012083417.1|  PREDICTED: multiple C2 and transmembrane dom...    219   3e-60   Jatropha curcas
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...    219   3e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...    217   1e-59   
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...    216   3e-59   Elaeis guineensis
ref|XP_012092782.1|  PREDICTED: multiple C2 and transmembrane dom...    215   3e-59   Jatropha curcas
emb|CDP14088.1|  unnamed protein product                                214   5e-59   Coffea canephora [robusta coffee]
ref|XP_002511838.1|  synaptotagmin, putative                            216   6e-59   Ricinus communis
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...    215   7e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006349900.1|  PREDICTED: multiple C2 and transmembrane dom...    213   8e-59   Solanum tuberosum [potatoes]
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...    214   2e-58   Morus notabilis
emb|CBI30044.3|  unnamed protein product                                204   5e-58   Vitis vinifera
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973    213   6e-58   Vitis vinifera
ref|XP_010659323.1|  PREDICTED: multiple C2 and transmembrane dom...    211   7e-58   Vitis vinifera
ref|XP_011625449.1|  PREDICTED: uncharacterized protein LOC184398...    212   7e-58   
ref|XP_011625448.1|  PREDICTED: uncharacterized protein LOC184398...    212   8e-58   
ref|XP_011625450.1|  PREDICTED: uncharacterized protein LOC184398...    212   8e-58   
ref|XP_006850085.1|  PREDICTED: extended synaptotagmin-1 isoform X1     212   1e-57   Amborella trichopoda
ref|XP_011625447.1|  PREDICTED: extended synaptotagmin-1 isoform X2     212   1e-57   
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758    210   4e-57   
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...    210   4e-57   Populus euphratica
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...    210   5e-57   Elaeis guineensis
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...    210   6e-57   Populus euphratica
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g             208   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg             207   4e-56   Citrus clementina [clementine]
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                   207   4e-56   Citrus sinensis [apfelsine]
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g             207   4e-56   
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg             205   7e-56   Prunus persica
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...    205   8e-56   Prunus mume [ume]
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707    207   8e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020    207   8e-56   Prunus mume [ume]
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...    207   8e-56   Populus euphratica
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg             206   9e-56   Prunus persica
gb|AFN53655.1|  putative synaptotagmin protein                          205   9e-56   Linum usitatissimum
emb|CDX81021.1|  BnaC03g02750D                                          195   1e-55   
emb|CBI40337.3|  unnamed protein product                                203   1e-55   Vitis vinifera
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg                206   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g             206   1e-55   Populus trichocarpa [western balsam poplar]
ref|XP_012086923.1|  PREDICTED: multiple C2 and transmembrane dom...    206   1e-55   Jatropha curcas
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...    204   1e-55   Solanum tuberosum [potatoes]
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...    206   1e-55   
gb|KJB25055.1|  hypothetical protein B456_004G174500                    204   2e-55   Gossypium raimondii
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1       206   2e-55   Gossypium arboreum [tree cotton]
ref|XP_012087734.1|  PREDICTED: multiple C2 and transmembrane dom...    204   2e-55   Jatropha curcas
gb|KJB25820.1|  hypothetical protein B456_004G210900                    206   2e-55   Gossypium raimondii
ref|XP_010238001.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    204   2e-55   
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892    205   3e-55   Elaeis guineensis
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    205   3e-55   
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...    205   4e-55   Citrus sinensis [apfelsine]
gb|EMT30716.1|  hypothetical protein F775_31640                         204   4e-55   
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg             205   5e-55   
ref|XP_009393442.1|  PREDICTED: uncharacterized protein LOC103979123    205   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    204   5e-55   
ref|XP_004235089.1|  PREDICTED: multiple C2 and transmembrane dom...    203   6e-55   Solanum lycopersicum
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...    204   6e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724    204   8e-55   Phoenix dactylifera
emb|CDY13273.1|  BnaC09g23830D                                          197   9e-55   Brassica napus [oilseed rape]
emb|CAN79812.1|  hypothetical protein VITISV_018822                     204   9e-55   Vitis vinifera
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432    204   9e-55   Vitis vinifera
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...    204   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...    204   1e-54   
dbj|BAK04937.1|  predicted protein                                      204   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004299880.1|  PREDICTED: multiple C2 and transmembrane dom...    204   1e-54   Fragaria vesca subsp. vesca
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...    203   1e-54   
ref|XP_008795741.1|  PREDICTED: multiple C2 and transmembrane dom...    203   1e-54   
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...    202   1e-54   Populus euphratica
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase        202   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897    203   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...    203   2e-54   
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                   201   2e-54   Citrus sinensis [apfelsine]
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...    203   2e-54   Camelina sativa [gold-of-pleasure]
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                   203   2e-54   Citrus sinensis [apfelsine]
ref|XP_012065512.1|  PREDICTED: multiple C2 and transmembrane dom...    202   2e-54   Jatropha curcas
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    201   3e-54   
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...    202   3e-54   
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg             202   3e-54   Capsella rubella
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...    202   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...    202   3e-54   Populus euphratica
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...    202   4e-54   Prunus mume [ume]
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg             202   4e-54   Prunus persica
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg             200   5e-54   Citrus clementina [clementine]
ref|XP_002513191.1|  synaptotagmin, putative                            202   5e-54   Ricinus communis
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268    201   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...    200   7e-54   
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...    199   7e-54   Morus notabilis
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...    200   8e-54   Glycine max [soybeans]
emb|CDP08834.1|  unnamed protein product                                201   8e-54   Coffea canephora [robusta coffee]
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...    201   8e-54   
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...    201   9e-54   Sesamum indicum [beniseed]
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B               199   9e-54   Glycine soja [wild soybean]
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...    199   9e-54   Cicer arietinum [garbanzo]
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g             201   1e-53   Phaseolus vulgaris [French bean]
ref|XP_011025029.1|  PREDICTED: uncharacterized protein LOC105126...    200   1e-53   Populus euphratica
ref|XP_010534658.1|  PREDICTED: multiple C2 and transmembrane dom...    199   1e-53   Tarenaya hassleriana [spider flower]
emb|CAN75086.1|  hypothetical protein VITISV_010815                     199   1e-53   Vitis vinifera
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...    199   1e-53   Vitis vinifera
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187    199   1e-53   Nicotiana sylvestris
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885    199   1e-53   Nicotiana tomentosiformis
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...    199   1e-53   Sesamum indicum [beniseed]
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    201   1e-53   Populus euphratica
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...    199   2e-53   Glycine max [soybeans]
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g             199   2e-53   Phaseolus vulgaris [French bean]
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...    199   2e-53   
ref|XP_002303582.2|  C2 domain-containing family protein                200   2e-53   
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...    199   2e-53   Glycine max [soybeans]
emb|CDY70344.1|  BnaA03g55080D                                          195   2e-53   Brassica napus [oilseed rape]
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...    198   2e-53   Populus euphratica
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962    199   2e-53   Glycine max [soybeans]
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...    198   2e-53   Fragaria vesca subsp. vesca
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B            199   3e-53   
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104    198   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009588959.1|  PREDICTED: multiple C2 and transmembrane dom...    197   3e-53   
gb|KCW51799.1|  hypothetical protein EUGRSUZ_J01251                     197   4e-53   Eucalyptus grandis [rose gum]
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                    199   4e-53   Arabis alpina [alpine rockcress]
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...    197   4e-53   Eucalyptus grandis [rose gum]
ref|XP_008460789.1|  PREDICTED: multiple C2 and transmembrane dom...    197   4e-53   Cucumis melo [Oriental melon]
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                    199   4e-53   Arabis alpina [alpine rockcress]
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...    197   4e-53   Glycine soja [wild soybean]
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...    197   4e-53   Eucalyptus grandis [rose gum]
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...    199   4e-53   Cicer arietinum [garbanzo]
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...    197   4e-53   Cucumis sativus [cucumbers]
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...    197   5e-53   Phoenix dactylifera
gb|KHN26368.1|  Multiple C2 and transmembrane domain-containing p...    197   5e-53   Glycine soja [wild soybean]
ref|XP_002298449.2|  C2 domain-containing family protein                199   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...    197   5e-53   Elaeis guineensis
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...    199   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...    197   6e-53   Cucumis melo [Oriental melon]
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...    199   6e-53   Populus euphratica
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...    199   6e-53   Populus euphratica
ref|XP_006585748.1|  PREDICTED: multiple C2 and transmembrane dom...    199   6e-53   Glycine max [soybeans]
gb|KHM98828.1|  Multiple C2 and transmembrane domain-containing p...    199   6e-53   Glycine soja [wild soybean]
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...    197   6e-53   
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...    199   7e-53   Vitis vinifera
emb|CDP10108.1|  unnamed protein product                                197   7e-53   Coffea canephora [robusta coffee]
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...    198   7e-53   Glycine soja [wild soybean]
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...    198   7e-53   
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g             197   8e-53   
ref|XP_012075480.1|  PREDICTED: multiple C2 and transmembrane dom...    199   8e-53   
ref|XP_006379108.1|  C2 domain-containing family protein                198   8e-53   
ref|XP_007020084.1|  C2 calcium/lipid-binding plant phosphoribosy...    198   8e-53   
ref|XP_002273003.1|  PREDICTED: multiple C2 and transmembrane dom...    198   9e-53   
emb|CBI18160.3|  unnamed protein product                                198   9e-53   
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg             198   9e-53   
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880    198   9e-53   
ref|XP_010244838.1|  PREDICTED: multiple C2 and transmembrane dom...    198   9e-53   
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg                196   9e-53   
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...    196   1e-52   
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...    198   1e-52   
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726    198   1e-52   
gb|KJB36093.1|  hypothetical protein B456_006G140900                    196   1e-52   
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751    198   1e-52   
ref|XP_007051845.1|  C2 calcium/lipid-binding plant phosphoribosy...    197   1e-52   
ref|XP_011656335.1|  PREDICTED: uncharacterized protein LOC101203632    197   1e-52   
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    198   1e-52   
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...    196   1e-52   
ref|XP_002532394.1|  synaptotagmin, putative                            196   2e-52   
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...    197   2e-52   
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg             198   2e-52   
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...    198   2e-52   
ref|XP_007051844.1|  C2 calcium/lipid-binding plant phosphoribosy...    197   2e-52   
ref|XP_009420494.1|  PREDICTED: uncharacterized protein LOC104000227    197   2e-52   
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...    197   2e-52   
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...    197   2e-52   
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...    197   2e-52   
ref|XP_007131292.1|  hypothetical protein PHAVU_011G001600g             197   2e-52   
ref|XP_008368132.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    197   2e-52   
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...    195   2e-52   
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg                195   3e-52   
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...    195   3e-52   
ref|XP_009108158.1|  PREDICTED: uncharacterized protein LOC103833855    197   3e-52   
emb|CDX86768.1|  BnaA09g21580D                                          197   3e-52   
ref|XP_010529565.1|  PREDICTED: multiple C2 and transmembrane dom...    196   3e-52   
ref|XP_002521817.1|  synaptotagmin, putative                            197   4e-52   
ref|XP_007225292.1|  hypothetical protein PRUPE_ppa001339mg             195   4e-52   
ref|XP_010529567.1|  PREDICTED: multiple C2 and transmembrane dom...    196   4e-52   
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    196   4e-52   
ref|XP_010053690.1|  PREDICTED: multiple C2 and transmembrane dom...    196   5e-52   
emb|CAN71789.1|  hypothetical protein VITISV_004288                     195   6e-52   
gb|EMS48196.1|  Multiple C2 and transmembrane domain-containing p...    194   6e-52   
ref|XP_011468807.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    196   6e-52   
ref|XP_011092017.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   6e-52   
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like           194   6e-52   
ref|XP_009773349.1|  PREDICTED: multiple C2 and transmembrane dom...    194   7e-52   
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g             194   8e-52   
ref|XP_010908865.1|  PREDICTED: uncharacterized protein LOC105035134    196   8e-52   
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...    196   9e-52   
ref|NP_001054305.1|  Os04g0683800                                       195   9e-52   
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...    196   9e-52   
emb|CAJ86177.1|  H0306F12.8                                             196   9e-52   
gb|KHN32471.1|  Multiple C2 and transmembrane domain-containing p...    195   1e-51   
gb|EEC78281.1|  hypothetical protein OsI_17979                          196   1e-51   
gb|KJB60077.1|  hypothetical protein B456_009G288400                    194   1e-51   
ref|XP_003539945.1|  PREDICTED: multiple C2 and transmembrane dom...    195   1e-51   
gb|KJB41306.1|  hypothetical protein B456_007G098200                    195   1e-51   
gb|EEE61934.1|  hypothetical protein OsJ_16678                          196   1e-51   
emb|CDP07723.1|  unnamed protein product                                195   1e-51   
ref|XP_003611102.1|  Glutathione peroxidase                             195   1e-51   
ref|XP_008219001.1|  PREDICTED: multiple C2 and transmembrane dom...    195   1e-51   
ref|XP_009362439.1|  PREDICTED: uncharacterized protein LOC103952559    195   1e-51   
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...    193   1e-51   
gb|EMT11702.1|  hypothetical protein F775_07618                         193   1e-51   
ref|XP_004228622.1|  PREDICTED: multiple C2 and transmembrane dom...    193   1e-51   
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg             194   2e-51   
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                   194   2e-51   
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...    194   2e-51   
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166    194   2e-51   
ref|XP_006483675.1|  PREDICTED: multiple C2 and transmembrane dom...    192   2e-51   
ref|XP_006439066.1|  hypothetical protein CICLE_v10033918mg             192   2e-51   
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg             192   2e-51   
gb|EYU46304.1|  hypothetical protein MIMGU_mgv1a001691mg                192   2e-51   
gb|KDO83486.1|  hypothetical protein CISIN_1g004208mg                   192   3e-51   
ref|XP_008649064.1|  PREDICTED: uncharacterized protein LOC103629...    192   3e-51   
gb|KDO38276.1|  hypothetical protein CISIN_1g045512mg                   192   3e-51   
ref|XP_010104492.1|  Multiple C2 and transmembrane domain-contain...    194   4e-51   
gb|AAC25524.1|  Strong similarity to phosphoribosylanthranilate t...    192   4e-51   
ref|XP_010672179.1|  PREDICTED: multiple C2 and transmembrane dom...    193   4e-51   
ref|XP_009379435.1|  PREDICTED: multiple C2 and transmembrane dom...    194   4e-51   
ref|XP_006348415.1|  PREDICTED: multiple C2 and transmembrane dom...    192   4e-51   
emb|CDP09751.1|  unnamed protein product                                193   4e-51   
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...    192   5e-51   
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...    193   5e-51   
emb|CDY01973.1|  BnaC02g27540D                                          193   5e-51   
gb|EPS65173.1|  hypothetical protein M569_09603                         193   5e-51   
gb|KFK44354.1|  hypothetical protein AALP_AA1G246600                    193   6e-51   
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...    191   6e-51   
ref|NP_001168012.1|  uncharacterized protein LOC100381735               192   8e-51   
ref|XP_008799189.1|  PREDICTED: uncharacterized protein LOC103713915    192   9e-51   
ref|XP_006304546.1|  hypothetical protein CARUB_v10011531mg             192   9e-51   
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616             191   9e-51   
ref|NP_568175.2|  FT-interacting protein 1                              191   1e-50   
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...    191   1e-50   
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...    191   1e-50   
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg             191   1e-50   
ref|XP_006473257.1|  PREDICTED: multiple C2 and transmembrane dom...    192   1e-50   
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...    190   1e-50   
ref|NP_173675.1|  C2 calcium/lipid-binding plant phosphoribosyltr...    192   1e-50   
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656    192   1e-50   
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...    192   1e-50   
gb|EYU32100.1|  hypothetical protein MIMGU_mgv1a000762mg                192   2e-50   
ref|XP_003635987.1|  Multiple C2 and transmembrane domain-contain...    193   2e-50   
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...    190   2e-50   
gb|EYU35083.1|  hypothetical protein MIMGU_mgv1a025230mg                192   2e-50   
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209    191   2e-50   
ref|XP_006416181.1|  hypothetical protein EUTSA_v10006627mg             192   2e-50   
gb|ADT92187.1|  unknown                                                 192   2e-50   
ref|XP_002890521.1|  C2 domain-containing protein                       192   2e-50   
gb|AES80126.2|  calcium-dependent lipid-binding (CaLB domain) fam...    191   2e-50   
ref|XP_010460017.1|  PREDICTED: multiple C2 and transmembrane dom...    191   2e-50   
ref|XP_010477520.1|  PREDICTED: multiple C2 and transmembrane dom...    191   3e-50   
ref|XP_010557779.1|  PREDICTED: extended synaptotagmin-1                191   3e-50   
gb|ABD33426.2|  C2                                                      191   3e-50   
ref|XP_003623908.1|  Extended synaptotagmin-2                           191   3e-50   
ref|XP_006434685.1|  hypothetical protein CICLE_v10000346mg             189   3e-50   
ref|XP_006434690.1|  hypothetical protein CICLE_v10000127mg             191   4e-50   
ref|XP_010498740.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    191   4e-50   
emb|CDY54062.1|  BnaA02g36480D                                          190   5e-50   
ref|XP_009399655.1|  PREDICTED: multiple C2 and transmembrane dom...    189   6e-50   
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...    190   8e-50   
emb|CDY21373.1|  BnaA09g30540D                                          190   9e-50   
ref|XP_010910862.1|  PREDICTED: uncharacterized protein LOC105036827    190   9e-50   
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...    189   1e-49   
ref|XP_009115621.1|  PREDICTED: multiple C2 and transmembrane dom...    189   1e-49   
emb|CDP07720.1|  unnamed protein product                                187   1e-49   
ref|XP_006366499.1|  PREDICTED: multiple C2 and transmembrane dom...    189   1e-49   
gb|EPS70383.1|  hypothetical protein M569_04376                         187   1e-49   
ref|XP_003580895.1|  PREDICTED: multiple C2 and transmembrane dom...    189   1e-49   
ref|XP_004250430.1|  PREDICTED: multiple C2 and transmembrane dom...    189   2e-49   
ref|XP_010062431.1|  PREDICTED: uncharacterized protein LOC104449847    189   2e-49   
gb|EPS58331.1|  hypothetical protein M569_16484                         188   2e-49   
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...    187   2e-49   
ref|XP_009128492.1|  PREDICTED: uncharacterized protein LOC103853319    189   2e-49   
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368    187   2e-49   
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1       188   3e-49   
emb|CDP10669.1|  unnamed protein product                                188   3e-49   
ref|XP_009623389.1|  PREDICTED: uncharacterized protein LOC104114611    188   4e-49   
ref|XP_006827676.1|  PREDICTED: uncharacterized protein LOC18423046     188   4e-49   
ref|XP_009781014.1|  PREDICTED: uncharacterized protein LOC104229981    187   5e-49   
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...    188   5e-49   
ref|XP_007052573.1|  Calcium-dependent lipid-binding (CaLB domain...    185   5e-49   
ref|XP_010682327.1|  PREDICTED: multiple C2 and transmembrane dom...    187   6e-49   
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479    188   6e-49   
ref|XP_009399173.1|  PREDICTED: multiple C2 and transmembrane dom...    187   7e-49   
gb|ABR16393.1|  unknown                                                 185   7e-49   
gb|KHN28751.1|  Multiple C2 and transmembrane domain-containing p...    185   7e-49   
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g             186   7e-49   
ref|XP_010063756.1|  PREDICTED: multiple C2 and transmembrane dom...    187   8e-49   
gb|KJB24704.1|  hypothetical protein B456_004G157900                    186   8e-49   
ref|XP_009779007.1|  PREDICTED: multiple C2 and transmembrane dom...    187   9e-49   
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681    187   1e-48   
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257    187   1e-48   
ref|XP_011080971.1|  PREDICTED: uncharacterized protein LOC105164103    186   1e-48   
ref|XP_008378754.1|  PREDICTED: uncharacterized protein LOC103441820    186   1e-48   
ref|XP_009587334.1|  PREDICTED: uncharacterized protein LOC104085087    186   1e-48   
gb|KHN29203.1|  Putative Ras GTPase-activating protein 4B               184   1e-48   
ref|XP_010535240.1|  PREDICTED: multiple C2 and transmembrane dom...    186   2e-48   
ref|XP_004244612.1|  PREDICTED: multiple C2 and transmembrane dom...    186   2e-48   
ref|XP_008781559.1|  PREDICTED: multiple C2 and transmembrane dom...    186   2e-48   
ref|XP_011001083.1|  PREDICTED: multiple C2 and transmembrane dom...    186   2e-48   
ref|XP_006352275.1|  PREDICTED: uncharacterized protein LOC102594579    186   2e-48   
gb|KJB24703.1|  hypothetical protein B456_004G157900                    186   2e-48   
ref|XP_010534142.1|  PREDICTED: multiple C2 and transmembrane dom...    186   2e-48   
emb|CDY04800.1|  BnaC05g17890D                                          185   3e-48   
ref|XP_008782890.1|  PREDICTED: multiple C2 and transmembrane dom...    183   5e-48   
ref|XP_009626688.1|  PREDICTED: multiple C2 and transmembrane dom...    184   6e-48   
ref|XP_011074957.1|  PREDICTED: multiple C2 and transmembrane dom...    184   6e-48   
ref|XP_011628870.1|  PREDICTED: extended synaptotagmin-1-like           184   7e-48   
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...    185   7e-48   
ref|XP_003563626.1|  PREDICTED: uncharacterized protein LOC100829273    182   8e-48   
ref|XP_006376235.1|  hypothetical protein POPTR_0013s11220g             184   9e-48   
ref|XP_003599053.1|  Glutathione peroxidase                             182   1e-47   
ref|XP_004141565.1|  PREDICTED: multiple C2 and transmembrane dom...    184   1e-47   
ref|XP_004965887.1|  PREDICTED: uncharacterized protein LOC101774861    182   1e-47   
ref|XP_004231110.1|  PREDICTED: multiple C2 and transmembrane dom...    182   1e-47   
ref|XP_008783369.1|  PREDICTED: uncharacterized protein LOC103702639    183   2e-47   
gb|ACN88792.1|  putative C2 domain-containing protein                   171   2e-47   
ref|XP_006350321.1|  PREDICTED: extended synaptotagmin-1-like           183   2e-47   
ref|XP_003607066.1|  Anthranilate phosphoribosyltransferase-like ...    181   2e-47   
ref|XP_009795430.1|  PREDICTED: multiple C2 and transmembrane dom...    183   3e-47   
ref|XP_009134537.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    182   3e-47   
ref|XP_004506399.1|  PREDICTED: uncharacterized protein LOC101494825    183   3e-47   
ref|XP_006592975.1|  PREDICTED: multiple C2 and transmembrane dom...    181   4e-47   
gb|EYU22793.1|  hypothetical protein MIMGU_mgv1a000783mg                182   4e-47   
gb|KEH29293.1|  calcium-dependent lipid-binding (CaLB domain) fam...    182   4e-47   
ref|XP_008459677.1|  PREDICTED: multiple C2 and transmembrane dom...    182   5e-47   
ref|XP_006366512.1|  PREDICTED: multiple C2 and transmembrane dom...    180   5e-47   
emb|CDX91899.1|  BnaC03g32010D                                          182   5e-47   
dbj|BAJ93730.1|  predicted protein                                      180   6e-47   
ref|XP_010544470.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    181   8e-47   
emb|CBI34680.3|  unnamed protein product                                181   1e-46   
ref|XP_003539651.1|  PREDICTED: multiple C2 and transmembrane dom...    181   1e-46   
gb|EAZ01666.1|  hypothetical protein OsI_23701                          179   1e-46   
gb|EAZ37635.1|  hypothetical protein OsJ_21968                          179   1e-46   
ref|XP_007033953.1|  Calcium-dependent lipid-binding (CaLB domain...    179   1e-46   
gb|EYU28228.1|  hypothetical protein MIMGU_mgv1a000659mg                181   2e-46   
ref|XP_010521156.1|  PREDICTED: multiple C2 and transmembrane dom...    180   2e-46   
ref|XP_009607021.1|  PREDICTED: multiple C2 and transmembrane dom...    179   2e-46   
ref|XP_004486232.1|  PREDICTED: uncharacterized protein LOC101498310    179   2e-46   
emb|CDX74344.1|  BnaA03g27030D                                          180   2e-46   
ref|XP_011080250.1|  PREDICTED: multiple C2 and transmembrane dom...    178   2e-46   
ref|XP_007139881.1|  hypothetical protein PHAVU_008G066300g             180   2e-46   
ref|XP_011096361.1|  PREDICTED: multiple C2 and transmembrane dom...    180   3e-46   
gb|AES87259.2|  calcium-dependent lipid-binding (CaLB domain) fam...    180   3e-46   
ref|XP_003605062.1|  Phosphoribosyltransferase                          180   3e-46   
ref|XP_010439267.1|  PREDICTED: uncharacterized protein LOC104722742    180   3e-46   
gb|EMS62772.1|  Multiple C2 and transmembrane domain-containing p...    177   4e-46   
ref|XP_010930774.1|  PREDICTED: multiple C2 and transmembrane dom...    179   4e-46   
ref|XP_002447382.1|  hypothetical protein SORBIDRAFT_06g034070          179   4e-46   
ref|XP_011031493.1|  PREDICTED: multiple C2 and transmembrane dom...    179   5e-46   
ref|XP_010482053.1|  PREDICTED: uncharacterized protein LOC104760786    179   5e-46   
ref|XP_011003982.1|  PREDICTED: multiple C2 and transmembrane dom...    179   5e-46   
ref|XP_010442223.1|  PREDICTED: uncharacterized protein LOC104725290    179   7e-46   
gb|KEH29978.1|  anthranilate phosphoribosyltransferase-like protein     177   7e-46   
ref|XP_006279938.1|  hypothetical protein CARUB_v10025796mg             179   8e-46   
ref|XP_002863853.1|  C2 domain-containing protein                       178   1e-45   
ref|XP_009798416.1|  PREDICTED: multiple C2 and transmembrane dom...    177   2e-45   
ref|XP_009596255.1|  PREDICTED: multiple C2 and transmembrane dom...    177   2e-45   
gb|EAY96165.1|  hypothetical protein OsI_18047                          176   3e-45   



>ref|XP_007201936.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
 gb|EMJ03135.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
Length=756

 Score =   271 bits (693),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD VKDDF+GRV
Sbjct  61    DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKVR  GELMLAVWMGT
Sbjct  121   SFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVR--GELMLAVWMGT  164



>ref|XP_008240960.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=774

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD VKDDF+GRV
Sbjct  61    DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKVR  GELMLAVWMGT
Sbjct  121   SFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVR--GELMLAVWMGT  164



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2     MQKPPQDDFLLKETYPHLGGGKITGDKLTSTYDLVEQMHYLYVRVVKAKDLPAKDVTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV VKDKD VKDDF+GRV
Sbjct  62    DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVTVKDKDLVKDDFIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FD++EIPKRVPPDSPLAPQWYRLEDRKGDK R  GELMLAVWMGT
Sbjct  122   LFDMNEIPKRVPPDSPLAPQWYRLEDRKGDKSR--GELMLAVWMGT  165



>ref|XP_004249277.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=775

 Score =   270 bits (690),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 160/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKDF+KDDFVGRV
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVNVKDKDFIKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNEIPKRVPPDSPLAPQWYRLEDRSGNKVK--GELMLAVWMGT  164



>ref|XP_009799235.1| PREDICTED: extended synaptotagmin-1-like [Nicotiana sylvestris]
Length=776

 Score =   270 bits (690),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDFVGR 
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRY  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNEIPKRVPPDSPLAPQWYRLEDRNGNKVK--GELMLAVWMGT  164



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQ+PPQ+DF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2     MQKPPQDDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQASMLEV VKDKD VKDDF+GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASMLEVTVKDKDLVKDDFIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FD++EIPKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  122   LFDMNEIPKRVPPDSPLAPQWYRLEDRKGDKFK--GELMLAVWMGT  165



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   268 bits (685),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQASMLEV VKDKDFVKDDF+GR+
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASMLEVTVKDKDFVKDDFMGRI  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRKGDKVR  GELMLAVWMGT
Sbjct  121   LFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVR--GELMLAVWMGT  164



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD VKDDFVGRV
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNEIPKRVPPDSPLAPQWYRLEDRNGNKVK--GELMLAVWMGT  164



>ref|XP_006351337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=774

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKDF+KDDFVGRV
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVNVKDKDFIKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL++IPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNDIPKRVPPDSPLAPQWYRLEDRSGNKVK--GELMLAVWMGT  164



>ref|XP_011078851.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=772

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPQEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASVLEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDRK +K +  GELMLAVWMGT
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLEDRKNEKAK--GELMLAVWMGT  164



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDFVKDDFVGRV
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   TFDLNEIPKRVPPDSPLAPQWYRLEDRNGNKVK--GELMLAVWMGT  164



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   266 bits (681),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_006351338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=773

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF+KDDFVG V
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFIKDDFVGCV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL++IPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNDIPKRVPPDSPLAPQWYRLEDRHGNKVK--GELMLAVWMGT  164



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 160/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF+LKETKPHLGGGK+ GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFLLKETKPHLGGGKVMGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDF+KDDFVGRV
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVNVKDKDFIKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   MFDLNEIPKRVPPDSPLAPQWYRLEDRHGNKVK--GELMLAVWMGT  164



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   266 bits (679),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD V+DDF+GRV
Sbjct  61    DPYTEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVRDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   LFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   265 bits (678),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHF+KKSNPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYTEVKLGNYKGTTRHFDKKSNPEWNQVFAFSKDRIQASILEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_009587222.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
 ref|XP_009587223.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=773

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD VKDDFVGRV
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMG 
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLEERNGSKVK--GELMLAVWMGN  164



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   WFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  164



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 2/164 (1%)
 Frame = +2

Query  578   RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  757
             RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2     RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  758   YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvf  937
             YVEV++GNYKGTTRHFEKK+NPEWNQVFAFSK+RIQ+S+LEV VKDKDFVKDDF+GRV+F
Sbjct  62    YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLF  121

Query  938   dLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DL+EIPKRVPPDSPLAPQWYRLEDRKGDKVR  GELMLAVWMGT
Sbjct  122   DLNEIPKRVPPDSPLAPQWYRLEDRKGDKVR--GELMLAVWMGT  163



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPQEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+GTTRHFEKKSNPEW QVFAFSK+RIQAS+LEV VKDKD VKDDFVG V
Sbjct  61    DPYVEVRLGNYRGTTRHFEKKSNPEWRQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGCV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLEDR  +KV+  GELMLAVWMGT
Sbjct  121   MFDLNEIPKRVPPDSPLAPQWYRLEDRNRNKVK--GELMLAVWMGT  164



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 158/167 (95%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             M RPP  EDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  2     MHRPPHLEDFALKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGS  61

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             LDPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QASMLE+IVKDKD  KDDFVGR
Sbjct  62    LDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRLQASMLEIIVKDKDLAKDDFVGR  121

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VVFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKVR  GE+MLAVWMGT
Sbjct  122   VVFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVR--GEVMLAVWMGT  166



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 158/164 (96%), Gaps = 2/164 (1%)
 Frame = +2

Query  578   RPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  757
             RPP E+F LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS DP
Sbjct  2     RPPLEEFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDP  61

Query  758   YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvf  937
             YVEV++GNYKGTTRHFEKK+NPEWNQVFAFSK+RIQ+S+LEV VKDKDFVKDDF+GRV+F
Sbjct  62    YVEVKMGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRVLF  121

Query  938   dLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DL+EIPKRVPPDSPLAPQWYRLEDRKGDKVR  GELMLAVWMGT
Sbjct  122   DLNEIPKRVPPDSPLAPQWYRLEDRKGDKVR--GELMLAVWMGT  163



>ref|XP_004304385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011468070.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=774

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDK TSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFALKETKPHLGGGRISGDKHTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQAS LEVIVKDKD +KDD +G V
Sbjct  61    DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQASALEVIVKDKDLMKDDLIGYV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK R  GELMLAVWMGT
Sbjct  121   IFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKAR--GELMLAVWMGT  164



>ref|XP_002532333.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF30035.1| synaptotagmin, putative [Ricinus communis]
Length=681

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP E+F+LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEEFVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   LFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  164



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   263 bits (673),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQ+S+LEV VKDKDFVKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FD++EIPKRVPPDSPLAPQWYRLED+KGDK++  GELMLAVWMGT
Sbjct  121   LFDMNEIPKRVPPDSPLAPQWYRLEDKKGDKLK--GELMLAVWMGT  164



>ref|XP_012087737.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Jatropha curcas]
 gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   263 bits (673),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 159/167 (95%), Gaps = 2/167 (1%)
 Frame = +2

Query  569   KMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             +MQRPP E+++LKET PHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2     QMQRPPPEEYVLKETNPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  61

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEVRLGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDF+GR
Sbjct  62    CDPYVEVRLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVTVKDKDVVKDDFIGR  121

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK++  GELMLAVWMGT
Sbjct  122   VLFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKLK--GELMLAVWMGT  166



>emb|CAN80955.1| hypothetical protein VITISV_013781 [Vitis vinifera]
Length=752

 Score =   263 bits (671),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDFVKDD++GRV
Sbjct  61    DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+ GGELMLAVWMGT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK-GGELMLAVWMGT  165



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   263 bits (672),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRP  EDF+LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPLHEDFLLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QASMLEV VKDKDFVKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRMQASMLEVTVKDKDFVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   LFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKFK--GELMLAVWMGT  164



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   263 bits (672),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDV GS 
Sbjct  1     MQRPPHEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVAGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV +KDKDFVKDDF+GRV
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVNIKDKDFVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRK +K +  GELMLAVWMGT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKNEKAK--GELMLAVWMGT  164



>ref|XP_002278165.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653909.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653910.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
Length=777

 Score =   263 bits (672),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 158/166 (95%), Gaps = 1/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDFVKDD++GRV
Sbjct  61    DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+ GGELMLAVWMGT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK-GGELMLAVWMGT  165



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   263 bits (671),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKARDLP KD TGS 
Sbjct  1     MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKARDLPAKDATGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEVIVKDKD +KDDF+GRV
Sbjct  61    DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVIVKDKDLMKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLED KG+K R  GELMLAVWMGT
Sbjct  121   SFDLNEVPKRVPPDSPLAPQWYRLEDHKGNKAR--GELMLAVWMGT  164



>ref|XP_010463385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=431

 Score =   254 bits (649),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_004249163.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=772

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEVIVKDKDFVKDDFVGRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVIVKDKDFVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL++IPKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMG 
Sbjct  121   LFDLNDIPKRVPPDSPLAPQWYRLEERNGTKVK--GELMLAVWMGN  164



>ref|XP_008387239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387240.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387241.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387242.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPXKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEVIVKDKD +KDDF+GRV
Sbjct  61    DPYVEVKLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVIVKDKDLMKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLED KG+K R  GELMLAVWMGT
Sbjct  121   SFDLNEVPKRVPPDSPLAPQWYRLEDHKGNKAR--GELMLAVWMGT  164



>ref|XP_007145661.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 ref|XP_007145662.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17655.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17656.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
Length=774

 Score =   262 bits (670),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   WFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  164



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   261 bits (668),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKK+NPEW+QVFAFSK+RIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKTNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   WFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Cucumis sativus]
 gb|KGN59322.1| hypothetical protein Csa_3G809980 [Cucumis sativus]
Length=774

 Score =   261 bits (668),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 159/166 (96%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQ+S+LEV VKDKDFVKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQSSVLEVTVKDKDFVKDDFMGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FD++EIPKRVPPDSPLAPQWYRLED+KGDK++  GELMLAVWMGT
Sbjct  121   LFDMNEIPKRVPPDSPLAPQWYRLEDKKGDKLK--GELMLAVWMGT  164



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRP QEDF LKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPHQEDFSLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKDFVKDDFVGRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDFVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL++IPKRVPPDSPLAPQWYRLE+R G+KV+  GELMLAVWMG 
Sbjct  121   LFDLNDIPKRVPPDSPLAPQWYRLEERNGNKVK--GELMLAVWMGN  164



>gb|EPS67145.1| hypothetical protein M569_07629 [Genlisea aurea]
Length=772

 Score =   261 bits (667),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET P LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGSL
Sbjct  1     MQRPPPEDFALKETNPRLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSL  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKK NPEWNQVFAFSK+RIQAS+LEV VKDKD VKDDFVGRV
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKLNPEWNQVFAFSKDRIQASVLEVTVKDKDLVKDDFVGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDRK DK +  GELMLAVWMGT
Sbjct  121   FFDLNEIPKRVPPDSPLAPQWYRLEDRKNDKAK--GELMLAVWMGT  164



>ref|XP_010554852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554855.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
Length=773

 Score =   261 bits (667),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKD VKDDF+G V
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDVVKDDFIGHV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRL DRKGDKV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLADRKGDKVK--GELMLAVWFGT  164



>ref|XP_009376104.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=771

 Score =   261 bits (666),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY+G TRHFEKK+NPEWNQVFAFSK+RIQA++LEVIVKDKD VKDD +GRV
Sbjct  61    DPYVEVRLGNYRGATRHFEKKTNPEWNQVFAFSKDRIQATVLEVIVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLED + +K R  GELMLAVWMGT
Sbjct  121   SFDLNEVPKRVPPDSPLAPQWYRLEDHRANKAR--GELMLAVWMGT  164



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   261 bits (666),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP +DF+LKETKPHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPPPDDFLLKETKPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPY EV+LGNYKGTTRHFEKK+NPEWNQ+FAFSK+R+QAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYAEVKLGNYKGTTRHFEKKTNPEWNQIFAFSKDRLQASVLEVTVKDKDMVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   WFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_010516424.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010516425.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Camelina sativa]
 ref|XP_010516426.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010427678.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427679.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427680.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427681.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   260 bits (665),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRK DKVR  GELMLAVW GT
Sbjct  121   IFDLNEVPKRVPPDSPLAPQWYRLEDRKSDKVR--GELMLAVWFGT  164



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQ+PP EDF+LKET PHLGGGK+TGDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2     MQKPPPEDFLLKETNPHLGGGKVTGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKDFVKDDF+GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVTVKDKDFVKDDFMGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+P+RVPPDSPLAPQWYRL+DRKGDKV+  GELMLAVWMGT
Sbjct  122   LFDLNEVPRRVPPDSPLAPQWYRLDDRKGDKVK--GELMLAVWMGT  165



>ref|XP_008360635.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGG+I+GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1     MQRPPSEDFALKETKPHLGGGRISGDKLTSTYDLVEQMQYLYVRVVKAKDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKG TRHFEKKSNPEWNQVFAFSK+RIQA++LEV+VKDKD VKDD +GRV
Sbjct  61    DPYVEVRLGNYKGATRHFEKKSNPEWNQVFAFSKDRIQATVLEVVVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+E+PKRVPPDSPLAPQWYRLED K +K R  GELMLAVWMGT
Sbjct  121   SFDLNEVPKRVPPDSPLAPQWYRLEDHKANKAR--GELMLAVWMGT  164



>ref|XP_002878177.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54436.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=773

 Score =   259 bits (662),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWFGT  164



>ref|XP_010504727.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   258 bits (660),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRK DKVR  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKSDKVR--GELMLAVWFGT  164



>ref|XP_006290627.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 ref|XP_006290628.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23525.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23526.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
Length=773

 Score =   258 bits (660),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGKI+GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKISGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDMIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRK DKVR  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKSDKVR--GELMLAVWFGT  164



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   258 bits (660),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF LKETKPHLGG KITGDKLTST+DLVEQMQYLYVRVVKARDLP KDVTGS 
Sbjct  1     MQRPPQEDFQLKETKPHLGGVKITGDKLTSTHDLVEQMQYLYVRVVKARDLPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKK+NPEWNQVFAFSK+R+Q+S LEV VKDKDFVKDDF+GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKTNPEWNQVFAFSKDRLQSSNLEVTVKDKDFVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDR+ +KV+  GELMLAVWMGT
Sbjct  121   MFDLNEVPKRVPPDSPLAPQWYRLEDRQANKVK--GELMLAVWMGT  164



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   258 bits (659),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDFVKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWFGT  164



>emb|CDX67712.1| BnaA07g17520D [Brassica napus]
Length=774

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2     MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKG+KV+  GELMLAVW GT
Sbjct  122   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWFGT  165



>ref|XP_006393033.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
 gb|ESQ30319.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
Length=778

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QAS+LE  VKDKDFVKDD +G V
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRLQASVLEATVKDKDFVKDDLIGHV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLEDRKG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDRKGQKVK--GELMLAVWFGT  164



>ref|XP_009104078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
 ref|XP_009104079.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
Length=774

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2     MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEAAVKDKDVVKDDLIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKG+KV+  GELMLAVW GT
Sbjct  122   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWFGT  165



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   258 bits (659),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDFVKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWFGT  164



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   258 bits (658),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKLSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKDFVKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDFVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWFGT  164



>ref|XP_010672701.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=775

 Score =   258 bits (658),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQ+PP EDF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTG  
Sbjct  1     MQKPPHEDFSLKETNPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSMDVTGGC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNYKGTTRHFEKKSNPEW+QVFAFSKERIQAS+LEV VKDKD +KDDF+GRV
Sbjct  61    DPYVEVRLGNYKGTTRHFEKKSNPEWSQVFAFSKERIQASVLEVNVKDKDAIKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+PKRVPPDSPLAPQWYRLEDRK DK R  GELMLAVW GT
Sbjct  121   LFDLNEVPKRVPPDSPLAPQWYRLEDRKSDKAR--GELMLAVWWGT  164



>emb|CDX98254.1| BnaC06g16150D [Brassica napus]
Length=774

 Score =   257 bits (657),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2     MQRPPPEDFSLKETRPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL E+PKRVPPDSPLAPQWYRLEDRKG+KV+  GELMLAVW GT
Sbjct  122   VFDLSEVPKRVPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWFGT  165



>ref|XP_004144665.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis sativus]
 ref|XP_004144666.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   257 bits (657),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQ+PP EDF+LKET PHLGGGK+ GDKL STYDLVEQM YLYVRVVKA+DLP KDVTGS 
Sbjct  2     MQKPPPEDFLLKETNPHLGGGKVAGDKLASTYDLVEQMYYLYVRVVKAKDLPGKDVTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKDFVKDDF+GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASVLEVSVKDKDFVKDDFMGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+E+P+RVPPDSPLAPQWYRL+DRKGDKV+  GELMLAVWMGT
Sbjct  122   LFDLNEVPRRVPPDSPLAPQWYRLDDRKGDKVK--GELMLAVWMGT  165



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   257 bits (656),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 157/166 (95%), Gaps = 3/166 (2%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGG K++GDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGG-KVSGDKLTSTYDLVEQMQYLYVRVVKAKELPSKDVTGSC  59

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEV VKDKDFVKDDF+GRV
Sbjct  60    DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVFVKDKDFVKDDFIGRV  119

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDRK DKV+  GELMLAVWMGT
Sbjct  120   WFDLNEIPKRVPPDSPLAPQWYRLEDRKSDKVK--GELMLAVWMGT  163



>ref|XP_010111396.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30874.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=774

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET PHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTGS 
Sbjct  1     MQRPPPEDFSLKETNPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKAKELPAKDVTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTT HFEKKSNPEWN+VFAFSKERIQAS+LEV VKDKD VKDDF+GRV
Sbjct  61    DPYVEVKLGNYKGTTPHFEKKSNPEWNRVFAFSKERIQASVLEVTVKDKDLVKDDFIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRL+DR G KV+  GELMLAVWMGT
Sbjct  121   LFDLNEIPKRVPPDSPLAPQWYRLDDRNGVKVK--GELMLAVWMGT  164



>emb|CDY47660.1| BnaC04g23970D [Brassica napus]
Length=828

 Score =   256 bits (655),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 162/195 (83%), Gaps = 8/195 (4%)
 Frame = +2

Query  503   FNSD*GLEGCLVF---VVLWKK---NNHKMQRPPQEDFMLKETKPHLGGGKITGDKLTST  664
              NS   L+ C  F   V+ W       + MQRPP EDF LKET+PHLGGGKITGDKLTST
Sbjct  25    LNSLILLQWCSCFRSSVLKWSNVFLEANMMQRPPPEDFSLKETRPHLGGGKITGDKLTST  84

Query  665   YDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFA  844
             YDLVEQMQYLYVRVVKA++LP KD+TGS DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFA
Sbjct  85    YDLVEQMQYLYVRVVKAKELPGKDLTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFA  144

Query  845   FSKERIQASMLEVIvkdkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDK  1024
             FSK+RIQAS LE  VKDKD VKDD +GRVVFDL+E+PKRVPPDSPLAPQWYRLE  KG+K
Sbjct  145   FSKDRIQASFLEATVKDKDVVKDDLIGRVVFDLNEVPKRVPPDSPLAPQWYRLEGTKGEK  204

Query  1025  VRGGGELMLAVWMGT  1069
             VR  GELMLAVW GT
Sbjct  205   VR--GELMLAVWFGT  217



>ref|XP_006402831.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 ref|XP_006402832.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44284.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44285.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
Length=774

 Score =   255 bits (652),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETRPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDMTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV VKDKDFVKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEVTVKDKDFVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLEDRK +KV+  GELMLAVW GT
Sbjct  121   VFDLNEVPKRVPPDSPLAPQWYRLEDRKDNKVK--GELMLAVWFGT  164



>gb|KFK35840.1| hypothetical protein AALP_AA4G043900 [Arabis alpina]
Length=775

 Score =   255 bits (651),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKP LGGGKI+GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPFLGGGKISGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAF+K+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFAKDRLQASFLEATVKDKDVVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLEDRKG+KVR  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDRKGEKVR--GELMLAVWFGT  164



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   255 bits (651),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             M RPP EDF LKETKP LGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KDVTG  
Sbjct  2     MHRPPPEDFSLKETKPQLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDVTGGC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKDFVKDDF+GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRVQASFLEVVVKDKDFVKDDFMGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRL+DRK DKV+  GELMLAVW GT
Sbjct  122   VFDLNEIPKRVPPDSPLAPQWYRLDDRKSDKVK--GELMLAVWFGT  165



>ref|XP_002894324.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70583.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   254 bits (650),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_009766493.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   254 bits (649),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 156/167 (93%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRPP QEDF LKETKPHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1     MQRPPPQEDFSLKETKPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             LDPYVEV+LGNYKGTTR FEKKSNPEW+QVFAFSK+RIQAS+LEV VKDKD VKDDFVGR
Sbjct  61    LDPYVEVKLGNYKGTTRRFEKKSNPEWSQVFAFSKDRIQASVLEVTVKDKDVVKDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL++IPKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMG 
Sbjct  121   VLFDLNDIPKRVPPDSPLAPQWYRLEERNGSKVK--GELMLAVWMGN  165



>ref|XP_006306818.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39716.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=774

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1     MQRPPHEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 157/167 (94%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGGG ++GDKLT+TYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  2     MQRPLRPEEYSLKETSPHLGGGGVSGDKLTTTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  61

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS+LEVIVKDKDF+KDDF+GR
Sbjct  62    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVLEVIVKDKDFIKDDFIGR  121

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL E+PKRVPPDSPLAPQWYRLEDRKGDK  G GELMLAVWMGT
Sbjct  122   VLFDLTEVPKRVPPDSPLAPQWYRLEDRKGDK--GKGELMLAVWMGT  166



>ref|XP_003535846.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006588908.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 ref|XP_006588909.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X3 [Glycine max]
Length=773

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF+LKETKPHLGGGK++GD+LTSTYDLVEQMQYLYVRVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFLLKETKPHLGGGKVSGDRLTSTYDLVEQMQYLYVRVVKAKDLPAKDITGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTR+F K ++PEWNQVFAFSK+R+QASMLEV V DKD +KDD +GRV
Sbjct  61    DPYVEVKLGNYKGTTRNFAKNTHPEWNQVFAFSKDRLQASMLEVNVIDKDVLKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDRK DK +  GELMLAVWMGT
Sbjct  121   WFDLNEIPKRVPPDSPLAPQWYRLEDRKSDKAK--GELMLAVWMGT  164



>emb|CDY69710.1| BnaAnng31280D [Brassica napus]
Length=779

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2     MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLE  KG+KVR  GELMLAVW GT
Sbjct  122   VFDLNEVPKRVPPDSPLAPQWYRLEGTKGEKVR--GELMLAVWFGT  165



>ref|XP_009139005.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009139006.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=778

 Score =   254 bits (648),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKET+PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  2     MQRPPPEDFSLKETRPHLGGGKLTGDKLTSTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LE  VKDKD VKDD +GRV
Sbjct  62    DPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASFLEATVKDKDVVKDDLIGRV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+E+PKRVPPDSPLAPQWYRLE  KG+KVR  GELMLAVW GT
Sbjct  122   VFDLNEVPKRVPPDSPLAPQWYRLEGTKGEKVR--GELMLAVWFGT  165



>ref|NP_175568.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
 gb|AAG50882.1|AC025294_20 unknown protein [Arabidopsis thaliana]
 gb|AEE32684.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
Length=776

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYVRVVKAKELPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_010479644.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479645.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Camelina 
sativa]
Length=776

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_010500735.1| PREDICTED: extended synaptotagmin-1-like [Camelina sativa]
Length=776

 Score =   253 bits (645),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPP EDF LKETKPHLGGGK+TGDKLT+TYDLVEQMQYLY RVVKA+DLP KD+TGS 
Sbjct  1     MQRPPPEDFSLKETKPHLGGGKVTGDKLTTTYDLVEQMQYLYARVVKAKDLPGKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY+GTTRHFEKKSNPEWNQVFAFSK+R+QAS LE  VKDKD VKDD +GRV
Sbjct  61    DPYVEVKLGNYRGTTRHFEKKSNPEWNQVFAFSKDRVQASYLEATVKDKDLVKDDLIGRV  120

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             VFDL+EIPKRVPPDSPLAPQWYRLED KG KV+  GELMLAVW GT
Sbjct  121   VFDLNEIPKRVPPDSPLAPQWYRLEDGKGQKVK--GELMLAVWFGT  164



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   252 bits (644),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 154/167 (92%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP Q +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1     MQRPLQPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPTKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEK +NPEWNQVFAFSKERIQAS +EVIVKDKDFVKDDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKTTNPEWNQVFAFSKERIQASSVEVIVKDKDFVKDDFIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   VSFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  165



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   252 bits (643),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 155/168 (92%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2     MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPTKDVTG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS +EVIVKDKDFVKDDF+G
Sbjct  61    SCDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASSVEVIVKDKDFVKDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   RVSFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  166



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   251 bits (642),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRP--PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRP  PQE + LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1     MQRPLHPQE-YSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKARDLPAKDVTG  59

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKGTTR+FEKK+NPEWNQVFAFSKERIQAS +EVIVKDKD VKDD +G
Sbjct  60    SCDPYVEVKLGNYKGTTRYFEKKTNPEWNQVFAFSKERIQASSVEVIVKDKDSVKDDIIG  119

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  120   RVSFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  165



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 156/167 (93%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP P E++ LKET PHLGGG +TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTG+
Sbjct  1     MQRPLPPEEYSLKETSPHLGGGGVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGT  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKKSNPEWNQVFAFSK+RIQAS LEV+VKDKDFVKDDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKSNPEWNQVFAFSKDRIQASALEVVVKDKDFVKDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKR PPDSPLAPQWYRLEDRKG+KV+  GE+MLAVWMGT
Sbjct  121   VIFDLNEVPKRFPPDSPLAPQWYRLEDRKGEKVK--GEVMLAVWMGT  165



>ref|XP_006386096.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
 gb|ERP63893.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
Length=772

 Score =   250 bits (639),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLPPKD+TGS
Sbjct  1     MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPPKDITGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL ++PKRVPPDSPLAPQWYRLEDRKGDK++  GELMLAVWMGT
Sbjct  121   MMFDLIDVPKRVPPDSPLAPQWYRLEDRKGDKIK-AGELMLAVWMGT  166



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   250 bits (639),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP  QED+ LK T PHLGGG I GDKLTSTYDLVEQMQYLYVRVVKA+DLPPKDVTGS
Sbjct  1     MQRPLSQEDYSLKATSPHLGGGGIAGDKLTSTYDLVEQMQYLYVRVVKAKDLPPKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTR+FE+K+NPEWNQVFAFSK+RIQAS +E+ VKDKD VKDD++G 
Sbjct  61    CDPYVEVKLGNYKGTTRYFERKTNPEWNQVFAFSKDRIQASTVEIAVKDKDAVKDDYMGM  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLEDRKG+KV+  GELMLAVWMGT
Sbjct  121   VMFDLNEVPKRVPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWMGT  165



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   250 bits (639),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 155/167 (93%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRP-PQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP P +++ LKET PHLGGG + GDKLT+TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  2     MQRPLPPQEYSLKETSPHLGGGGVAGDKLTTTYDLVEQMQYLYVRVVKAKDLPVKDVTGS  61

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTR+FEKK+NPEWNQVFAFSKERIQAS +EVIVKDKD VKDDF+GR
Sbjct  62    CDPYVEVKLGNYKGTTRYFEKKTNPEWNQVFAFSKERIQASSMEVIVKDKDSVKDDFIGR  121

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+EIPKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  122   VLFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  166



>gb|KJB36100.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36101.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36102.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36103.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
Length=775

 Score =   250 bits (638),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 152/166 (92%), Gaps = 2/166 (1%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             M RPP EDF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  2     MPRPPPEDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSC  61

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEV+LGNY G TR FEKKSNPEWNQVFAFSK+R+QAS+LEV VKDKDFVKDDF+G+V
Sbjct  62    DPYVEVKLGNYLGKTRFFEKKSNPEWNQVFAFSKDRLQASLLEVTVKDKDFVKDDFIGKV  121

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              FDL+EIPKRVPPDSPLAPQWYRLEDR+G KV+  GELMLAVWMGT
Sbjct  122   FFDLNEIPKRVPPDSPLAPQWYRLEDRQGHKVK--GELMLAVWMGT  165



>ref|XP_011025253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=772

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  1     MQKPPQSVDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL E+PKRVPPDSPLAPQWYRLEDRK DK++  GELMLAVWMGT
Sbjct  121   MMFDLSEVPKRVPPDSPLAPQWYRLEDRKADKIK-AGELMLAVWMGT  166



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   247 bits (631),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTT+HFEKKSNPEWNQ FAFSK+RIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGTTKHFEKKSNPEWNQCFAFSKDRIQASVLEVLVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKR+PPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   VMFDLNEVPKRIPPDSPLAPQWYRLEDRKGDKVK-TGELMLAVWMGT  166



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   247 bits (631),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+ PQ  DF LKET P +G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKSPQAIDFALKETSPKIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTT+HFEKKSNPEWNQ FAFSK+RIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGTTKHFEKKSNPEWNQCFAFSKDRIQASVLEVLVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKR+PPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   VMFDLNEVPKRIPPDSPLAPQWYRLEDRKGDKVK-TGELMLAVWMGT  166



>gb|KJB83485.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=737

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+EIPKR+PPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   ALFDLNEIPKRIPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  165



>ref|XP_007014901.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014902.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014903.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014904.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32520.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32521.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32522.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32523.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=771

 Score =   246 bits (629),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 151/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQSVDFALKETSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKTNPEWNQVFAFSKERIQASVLEVLVKDKDVVIDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+EIP+RVPPDSPLAPQWYRLEDRKG+K +  GELMLAVWMGT
Sbjct  121   VMFDLNEIPRRVPPDSPLAPQWYRLEDRKGNKAK--GELMLAVWMGT  165



>ref|XP_002513446.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF48849.1| synaptotagmin, putative [Ricinus communis]
Length=772

 Score =   246 bits (629),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G   +TGDKL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1     MQKPPQAVDFALKETSPNIGAAAVTGDKLSCTYDLVEQMQYLYVRVVKARDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPY+EV++GNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYIEVKMGNYKGVTKHFEKKTNPEWNQVFAFSKERIQASILEVSVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++F+L+EIPKRVPPDSPLAPQWYRLEDRKGDK++  GELMLAVWMGT
Sbjct  121   IIFELNEIPKRVPPDSPLAPQWYRLEDRKGDKIK-HGELMLAVWMGT  166



>ref|XP_006850074.1| PREDICTED: extended synaptotagmin-1 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 151/167 (90%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP Q ED+ LKET PHLGGG + GDKLTSTYDLVEQMQYLYVRVVKA+DLP  DVTGS
Sbjct  1     MQRPLQSEDYSLKETSPHLGGGGVHGDKLTSTYDLVEQMQYLYVRVVKAKDLP-TDVTGS  59

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ S++EV VKDKD VKDDF+GR
Sbjct  60    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQFSVIEVTVKDKDLVKDDFIGR  119

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDL+EIPKRVPPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  120   VTFDLNEIPKRVPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  164



>ref|XP_012092783.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Jatropha curcas]
 ref|XP_012092784.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Jatropha curcas]
 gb|KDP20200.1| hypothetical protein JCGZ_07920 [Jatropha curcas]
Length=773

 Score =   246 bits (628),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 148/167 (89%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G G +T DKL  TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQAIDFALKETSPNIGAGAVTADKLACTYDLVEQMQYLYVRVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTT+HFEKK+NPEWNQVFAFSKERIQAS LEV VKDK  V DD +GR
Sbjct  61    CDPYVEVKLGNYKGTTKHFEKKTNPEWNQVFAFSKERIQASFLEVSVKDKAVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+F+L+++PKRVPPDSPLAPQWYRLEDRKGDK++  GELMLAVWMGT
Sbjct  121   VMFELNDVPKRVPPDSPLAPQWYRLEDRKGDKIK-TGELMLAVWMGT  166



>gb|KHG04257.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=771

 Score =   246 bits (627),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+EIPKR+PPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   ALFDLNEIPKRIPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  165



>gb|KJB83481.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83482.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83483.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83484.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83486.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83487.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83488.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=771

 Score =   246 bits (627),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P +G G +TGDKL+STYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MQKPPQSIDFALKETSPKIGAGAVTGDKLSSTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQAS+LEV VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKNNPEWNQVFAFSKERIQASVLEVYVKDKDVVADDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+EIPKR+PPDSPLAPQWYRLEDRKGDK +  GELMLAVWMGT
Sbjct  121   ALFDLNEIPKRIPPDSPLAPQWYRLEDRKGDKAK--GELMLAVWMGT  165



>emb|CBI16433.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1     MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPY+EV+LGNYKG T+HFEKK+NP WNQVFAFSK+R+QAS+LEV+VKDKDFVKDDF+G+
Sbjct  61    CDPYIEVKLGNYKGVTKHFEKKTNPVWNQVFAFSKDRLQASVLEVVVKDKDFVKDDFMGK  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDLHE+P+RVPPDSPLAPQWYRLEDRKG+K +  GELMLAVWMGT
Sbjct  121   VSFDLHEVPRRVPPDSPLAPQWYRLEDRKGEKAK--GELMLAVWMGT  165



>ref|XP_002297795.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82600.1| C2 domain-containing family protein [Populus trichocarpa]
Length=772

 Score =   245 bits (625),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLPPKDVTGS
Sbjct  1     MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPPKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD V DD +G 
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGW  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+E+PKRVPPDSPLAPQWYRLEDRKG K++  GELMLAVWMGT
Sbjct  121   MMFDLNEVPKRVPPDSPLAPQWYRLEDRKGGKIK-SGELMLAVWMGT  166



>ref|XP_008243596.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Prunus mume]
Length=755

 Score =   244 bits (623),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LE +VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEAVVKDKDVVLDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL +IPKR+PPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  121   VIFDLIDIPKRIPPDSPLAPQWYRLEDRKGVKVK--GELMLAVWMGT  165



>ref|XP_007208351.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
 gb|EMJ09550.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
Length=772

 Score =   244 bits (623),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ +DF LKET P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQPQDFALKETSPNIGAGSVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LE +VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEAVVKDKDVVLDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL +IPKR+PPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  121   VIFDLIDIPKRIPPDSPLAPQWYRLEDRKGVKVK--GELMLAVWMGT  165



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   243 bits (621),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P +G G + GDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQNIDFALKETSPKIGAGAVAGDKLSCTYDLVEQMHYLYVRVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWNQVFAFSKDRIQASILEVIVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+EIPKRVPPDSPLAPQWYRLEDR G+KV+  GELMLAVWMGT
Sbjct  121   ALFDLNEIPKRVPPDSPLAPQWYRLEDRHGNKVK--GELMLAVWMGT  165



>ref|XP_009374817.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   243 bits (620),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PP  +DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPPSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+R+QAS+LEV+VKDKD V DDF+GR
Sbjct  61    SDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRLQASVLEVVVKDKDVVLDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+ DL +IPKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   VMMDLTDIPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  165



>ref|XP_002285588.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
 ref|XP_010651282.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=774

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPP-QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PP   +F LKETKP LGGG + GDKLT  YDLVEQM YLYVRVVKA+DLPPKDVTGS
Sbjct  1     MQKPPPSVEFALKETKPQLGGGSVIGDKLTCAYDLVEQMHYLYVRVVKAKDLPPKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPY+EV+LGNYKG T+HFEKK+NP WNQVFAFSK+R+QAS+LEV+VKDKDFVKDDF+G+
Sbjct  61    CDPYIEVKLGNYKGVTKHFEKKTNPVWNQVFAFSKDRLQASVLEVVVKDKDFVKDDFMGK  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDLHE+P+RVPPDSPLAPQWYRLEDRKG+K +  GELMLAVWMGT
Sbjct  121   VSFDLHEVPRRVPPDSPLAPQWYRLEDRKGEKAK--GELMLAVWMGT  165



>ref|XP_011037883.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
 ref|XP_011037884.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Populus euphratica]
Length=772

 Score =   242 bits (617),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 2/167 (1%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+ PQ  DF LKET P++G G +TG+KL+ TYDLVEQMQYLYVRVVKARDLP KDVTGS
Sbjct  1     MQKLPQSVDFALKETSPNIGAGSVTGNKLSCTYDLVEQMQYLYVRVVKARDLPLKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEV VKDKD V DD +G 
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFAFSKDRIQASVLEVFVKDKDVVLDDLIGW  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+E+PKRVPPDSPLAPQWYRLEDRKG K++  GELMLAVWMGT
Sbjct  121   MMFDLNEVPKRVPPDSPLAPQWYRLEDRKGGKIK-SGELMLAVWMGT  166



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   241 bits (616),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  760
             PP +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  6     PPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPY  65

Query  761   VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvfd  940
             VEV+LGNY G TR FEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD VKDDF+G+V FD
Sbjct  66    VEVKLGNYLGKTRVFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGKVFFD  125

Query  941   LHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             L+E+PKRVPPDSPLAPQWYRLEDR+G+K +  GELMLAVWMGT
Sbjct  126   LNEVPKRVPPDSPLAPQWYRLEDRQGNKAK--GELMLAVWMGT  166



>ref|XP_009364713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   241 bits (616),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEVVVKDKDVVIDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++F+L++IPKR PPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  121   IMFELNDIPKRFPPDSPLAPQWYRLEDRKGVKVK--GELMLAVWMGT  165



>ref|XP_008358865.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=772

 Score =   241 bits (616),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+R+QAS LEV+VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDRLQASFLEVVVKDKDVVLDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++F+L++IPKR PPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  121   IMFELNDIPKRFPPDSPLAPQWYRLEDRKGVKVK--GELMLAVWMGT  165



>gb|KJB66120.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66121.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66122.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
Length=772

 Score =   241 bits (615),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +2

Query  572   MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1     MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG T+HFEKKSNPEWNQVF FSKERIQAS+LEV VKDKD V DD +G
Sbjct  61    SCDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFGFSKERIQASILEVFVKDKDVVVDDLIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RVVFD++EIPKRVPPDSPLAPQWYRLEDRKG+K +  GELMLAVWMGT
Sbjct  121   RVVFDVNEIPKRVPPDSPLAPQWYRLEDRKGNKAK--GELMLAVWMGT  166



>ref|XP_007028941.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY09443.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=877

 Score =   242 bits (618),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  760
             PP +DF LKET PHLGGGK++GDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  6     PPPDDFALKETNPHLGGGKVSGDKLTSTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPY  65

Query  761   VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvfd  940
             VEV+LGNY G TR FEKK+NPEWNQVFAFSK+R+QAS+LEV VKDKD VKDDF+G+V FD
Sbjct  66    VEVKLGNYLGKTRVFEKKTNPEWNQVFAFSKDRLQASVLEVTVKDKDVVKDDFIGKVFFD  125

Query  941   LHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             L+E+PKRVPPDSPLAPQWYRLEDR+G+K +  GELMLAVWMGT
Sbjct  126   LNEVPKRVPPDSPLAPQWYRLEDRQGNKAK--GELMLAVWMGT  166



>gb|KHG19030.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=772

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +2

Query  572   MQRPPQE--DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQ+PP +  DF LK+T P++G G +TGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  1     MQKPPPQSVDFALKQTSPNIGAGAVTGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG T+HFEKKSNPEWNQVF FSKERIQAS+LEV VKDKD V DD +G
Sbjct  61    SCDPYVEVKLGNYKGVTKHFEKKSNPEWNQVFGFSKERIQASILEVFVKDKDVVVDDLIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RVVFD++EIPKRVPPDSPLAPQWYRLEDRKG+K +  GELMLAVWMGT
Sbjct  121   RVVFDVNEIPKRVPPDSPLAPQWYRLEDRKGNKPK--GELMLAVWMGT  166



>gb|KEH30271.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=770

 Score =   240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PP   +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA++LP KDVTGS
Sbjct  1     MQKPPNSHEFALKETTPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKELPTKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             LDPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSK+RIQAS+LEVIVKDKD + DDFVGR
Sbjct  61    LDPYVEVKLGNYKGITKHFEKKSNPQWNQVFAFSKDRIQASVLEVIVKDKDVIADDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDL++IPKR+PPDSPLAPQWYRLEDRKG+KV+  GELMLAVWMGT
Sbjct  121   VWFDLNDIPKRIPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWMGT  165



>ref|XP_004295231.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011461911.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDV+GS
Sbjct  1     MQKPPQSTDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVSGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNP WNQVFAFSK+RIQAS+LE +VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPVWNQVFAFSKDRIQASILEAVVKDKDVVVDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+F+L++IPKR+PPDSPLAPQWYRL+DRKG  VR  GELMLAVWMGT
Sbjct  121   VIFELNDIPKRIPPDSPLAPQWYRLDDRKG--VRVKGELMLAVWMGT  165



>ref|XP_009364728.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ +DF LKET P++G G ITGDKL+ TYDLVEQM YLYVRVVKA+DLP KDVTGS
Sbjct  1     MQKPPQSQDFALKETSPNIGAGSITGDKLSCTYDLVEQMHYLYVRVVKAKDLPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSK+++QAS LEV+VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKDQLQASFLEVVVKDKDVVIDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++F+L++IPKR PPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  121   IMFELNDIPKRFPPDSPLAPQWYRLEDRKGVKVK--GELMLAVWMGT  165



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 149/169 (88%), Gaps = 5/169 (3%)
 Frame = +2

Query  572   MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  742
             MQ+ P     +F LKET P +G G +T DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVT
Sbjct  1     MQKAPLAHSNEFALKETSPKIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAKDLPSKDVT  60

Query  743   GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfv  922
             GSLDPYVEV+LGNYKG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD + DDFV
Sbjct  61    GSLDPYVEVKLGNYKGLTKHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVISDDFV  120

Query  923   grvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             GR+ FDL+EIPKRVPPDSPLAPQWYRLEDRKG+KV+  GE+MLAVWMGT
Sbjct  121   GRMWFDLNEIPKRVPPDSPLAPQWYRLEDRKGEKVK--GEIMLAVWMGT  167



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   239 bits (610),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2     MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S++E+IVKDKDFVKDDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSVVEIIVKDKDFVKDDFIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDL+E+PKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMGT
Sbjct  121   VCFDLNEVPKRVPPDSPLAPQWYRLEERNGHKVK--GELMLAVWMGT  165



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   239 bits (609),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGGG   GDKLT+TYDLVEQMQYLYVRVVKA+DLP KD+TGS
Sbjct  2     MQRPFRPEEYSLKETSPHLGGGA-AGDKLTTTYDLVEQMQYLYVRVVKAKDLPSKDITGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S++E+IVKDKDFVKDDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSVVEIIVKDKDFVKDDFIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMGT
Sbjct  121   VLFDLNEVPKRVPPDSPLAPQWYRLEERNGHKVK--GELMLAVWMGT  165



>ref|XP_010091994.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB48400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=772

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 2/163 (1%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  760
             P Q DF LKET P++G G ITGDKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTGS DPY
Sbjct  5     PQQVDFALKETSPNIGAGSITGDKLSCTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPY  64

Query  761   VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvfd  940
             VEV+LGNYKG T+HFEKKSNP WNQ FAFSK+RIQAS LEV++KDKD V DD +GRV+F+
Sbjct  65    VEVKLGNYKGVTKHFEKKSNPHWNQCFAFSKDRIQASTLEVLLKDKDIVIDDLIGRVLFE  124

Query  941   LHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             L+E+PKRVPPDSPLAPQWYR++DRKG++V+  GE+MLAVWMGT
Sbjct  125   LNEVPKRVPPDSPLAPQWYRMQDRKGERVK--GEIMLAVWMGT  165



>ref|XP_007131979.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
 gb|ESW03973.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
Length=775

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 5/169 (3%)
 Frame = +2

Query  572   MQRPP---QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVT  742
             MQR P     +F LKET P++G G +T DKL+ TYDLVEQMQYLYVRVVKA DLP KDVT
Sbjct  1     MQRAPLAHSHEFALKETSPNIGAGAVTRDKLSCTYDLVEQMQYLYVRVVKAMDLPAKDVT  60

Query  743   GSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfv  922
             GSLDPYVEV+LGN+KG T+HFEKKSNPEWNQVFAFSK+RIQAS+LEVIVKDKD + DDFV
Sbjct  61    GSLDPYVEVKLGNFKGLTKHFEKKSNPEWNQVFAFSKDRIQASVLEVIVKDKDVISDDFV  120

Query  923   grvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             GR+ FDL+EIP+RVPPDSPLAPQWYRLEDRKG K  G GELMLAVWMGT
Sbjct  121   GRLWFDLNEIPRRVPPDSPLAPQWYRLEDRKGAK--GKGELMLAVWMGT  167



>gb|EMT24491.1| Multiple C2 and transmembrane domain-containing protein 1 [Aegilops 
tauschii]
Length=703

 Score =   235 bits (600),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2     MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDFVKDD++GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMGT
Sbjct  121   VMFDLNEVPKRVPPDSPLAPQWYRLEERNGHKVK--GELMLAVWMGT  165



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score =   236 bits (601),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDKD + DDF+G 
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKDVMLDDFIGG  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score =   236 bits (601),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDKD + DDF+G 
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKDVMLDDFIGG  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score =   236 bits (601),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TGS
Sbjct  2     MQRPFRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPAKDLTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDFVKDD++GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMGT
Sbjct  121   VMFDLNEVPKRVPPDSPLAPQWYRLEERNGHKVK--GELMLAVWMGT  165



>ref|XP_010227498.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Brachypodium distachyon]
Length=774

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQRP + E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD++GS
Sbjct  2     MQRPFRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPSKDISGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQAS++E+IVKDKDFVKDD++GR
Sbjct  61    CDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQASVVEIIVKDKDFVKDDYIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FDL+E+PKRVPPDSPLAPQWYRLE+R G KV+  GELMLAVWMGT
Sbjct  121   VLFDLNEVPKRVPPDSPLAPQWYRLEERNGHKVK--GELMLAVWMGT  165



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2     MQRPPLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG TRHFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD VKDDF+G
Sbjct  61    SCDPYVEVKLGNYKGQTRHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV+FDL+E+PKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   RVMFDLNEVPKRVPPDSPLAPQWYRLEDRNGHKVK--GELMLAVWMGT  166



>ref|XP_006399782.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
 gb|ESQ41235.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
Length=769

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KD+TGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDMTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD + DD +GR
Sbjct  61    CDPYVEVKLGNYKGVTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDLMVDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>emb|CDX97214.1| BnaC09g44110D [Brassica napus]
Length=769

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGALTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD + DD +GR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_004142139.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_011653573.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN54116.1| hypothetical protein Csa_4G286400 [Cucumis sativus]
Length=771

 Score =   234 bits (596),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+  Q  DF LKET P +G   ITGDKL+STYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1     MQKILQPHDFALKETYPKIGAVSITGDKLSSTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTT+HFEKKSNPEW QVFAFS+ERIQAS+LEV+VKDKDFV DDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTKHFEKKSNPEWKQVFAFSRERIQASLLEVVVKDKDFVVDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+++PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   AIFDLNDVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  165



>ref|XP_008449758.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=771

 Score =   234 bits (596),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+  Q  DF LKET P +G   ITGDKL+ TYDLVEQMQYLYV VVKA+DLP KDVTGS
Sbjct  1     MQKTLQPHDFALKETYPKIGAVSITGDKLSCTYDLVEQMQYLYVYVVKAKDLPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKGTT+HFEKKSNPEW QVFAFS+ERIQAS+LEV+VKDKDFV DDF+GR
Sbjct  61    CDPYVEVKLGNYKGTTKHFEKKSNPEWKQVFAFSRERIQASLLEVVVKDKDFVVDDFMGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +FDL+++PKRVPPDSPLAPQWYRLEDRKGDKV+  GELMLAVWMGT
Sbjct  121   AIFDLNDVPKRVPPDSPLAPQWYRLEDRKGDKVK--GELMLAVWMGT  165



>ref|XP_010044995.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Eucalyptus grandis]
 gb|KCW87135.1| hypothetical protein EUGRSUZ_B03663 [Eucalyptus grandis]
Length=775

 Score =   233 bits (595),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 4/168 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQ+PPQ +DF L+ET P++G G++T  DKL  TYDLVEQMQYLYVRVVKA++LP KDVTG
Sbjct  1     MQKPPQPQDFALRETSPNIGAGQVTPADKLACTYDLVEQMQYLYVRVVKAKELPGKDVTG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             + DPYVEV+LGNYKG TRHFEKKSNPEWNQVFAFSKERIQAS LEV+VKDKD V DDF+G
Sbjct  61    TCDPYVEVKLGNYKGVTRHFEKKSNPEWNQVFAFSKERIQASSLEVVVKDKDVVLDDFMG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             R +FD++EIPKR PPDSPLAPQWYRLED+KG+KV+  GELMLA+WMGT
Sbjct  121   RSMFDINEIPKRAPPDSPLAPQWYRLEDQKGEKVK--GELMLAIWMGT  166



>emb|CDY68091.1| BnaAnng26150D [Brassica napus]
Length=769

 Score =   233 bits (595),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              +PYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD + DD +GR
Sbjct  61    CNPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|NP_196801.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB88261.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91836.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=769

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL STYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGSVTGDKLCSTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEK+SNPEW QVFAFSKERIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKRSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_009121819.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009121820.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=769

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYV+VVKA++LP KDVTGS
Sbjct  1     MQKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVQVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD + DD +GR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVMMDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDS LAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSSLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>emb|CDX70485.1| BnaC03g05690D [Brassica napus]
Length=769

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             M++P Q  DF LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++L  KDVTGS
Sbjct  1     MEKPGQNIDFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELSGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEVIVKDK+ + DDF+G 
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKKSNPEWRQVFAFSKERIQASILEVIVKDKNVMLDDFIGG  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_010492034.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492035.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492036.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492037.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=769

 Score =   231 bits (588),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1     MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPAKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD V DDF+GR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_002871539.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47798.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score =   231 bits (588),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRVVKA++LP KDVTGS
Sbjct  1     MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVVKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score =   231 bits (588),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRPP   E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP KD+TG
Sbjct  2     MQRPPLRPEEYSLKETTPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNKDITG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG T HFEKK+NPEWNQVFAF+KERIQ+S++E++VKDKD VKDDF+G
Sbjct  61    SCDPYVEVKLGNYKGQTGHFEKKNNPEWNQVFAFAKERIQSSVVEILVKDKDLVKDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV+FDL+E+PKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   RVIFDLNEVPKRVPPDSPLAPQWYRLEDRNGHKVK--GELMLAVWMGT  166



>gb|KHN33324.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=774

 Score =   231 bits (588),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             +DPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSKERIQAS+LE+++KDKD V DDFVGR
Sbjct  61    VDPYVEVKLGNYKGLTKHFEKKSNPQWNQVFAFSKERIQASVLELVIKDKDVVVDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FD++EIPKRVPPDSPLAPQWYRLEDR+GDK +  GELMLAVWMGT
Sbjct  121   VMFDINEIPKRVPPDSPLAPQWYRLEDRRGDKAK--GELMLAVWMGT  165



>ref|XP_010419856.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
 ref|XP_010419858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
Length=769

 Score =   230 bits (586),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1     MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD V DDFVGR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_010419857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Camelina sativa]
Length=769

 Score =   230 bits (586),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  +F LKET P +G G +TGDKL+ TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1     MQKPGQNIEFALKETSPKIGAGAVTGDKLSCTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNYKG T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD V DDFVGR
Sbjct  61    CDPYVEVKLGNYKGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|XP_003546988.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=774

 Score =   229 bits (585),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             M +P +  DF L+ET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MHKPAEALDFALRETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             +DPYVEV+LGNYKG T+HFEKKSNP+WNQVFAFSKERIQAS+LEV++KDKD V DDFVGR
Sbjct  61    VDPYVEVKLGNYKGLTKHFEKKSNPQWNQVFAFSKERIQASVLEVVIKDKDVVVDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FD++EIPKRVPPDSPLAPQWYRLEDR+GDK +  GELMLAVWMGT
Sbjct  121   VMFDINEIPKRVPPDSPLAPQWYRLEDRRGDKAK--GELMLAVWMGT  165



>ref|XP_006289947.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
 gb|EOA22845.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
Length=769

 Score =   229 bits (584),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+P Q  +F LKET P +G G +TGDKL++TYDLVEQM YLYVRV+KA++LP KDVTGS
Sbjct  1     MQKPGQNIEFALKETSPKIGAGAVTGDKLSNTYDLVEQMHYLYVRVMKAKELPGKDVTGS  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              DPYVEV+LGNY+G T+HFEKKSNPEW QVFAFSKERIQAS+LEV+VKDKD V DD +GR
Sbjct  61    CDPYVEVKLGNYRGMTKHFEKKSNPEWKQVFAFSKERIQASILEVVVKDKDVVLDDLIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             ++FDL+EIPKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   IMFDLNEIPKRVPPDSPLAPQWYRLEDRHGRKVK--GELMLAVWMGT  165



>ref|NP_001152102.1| phosphoribosylanthranilate transferase [Zea mays]
 gb|ACG45776.1| phosphoribosylanthranilate transferase [Zea mays]
Length=774

 Score =   228 bits (582),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2     MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD VKDDF+G
Sbjct  61    SCDPYVEVKLGNYKGQTQHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV+FDL+E+PKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   RVIFDLNEVPKRVPPDSPLAPQWYRLEDRNGHKVK--GELMLAVWMGT  166



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score =   228 bits (582),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 5/168 (3%)
 Frame = +2

Query  572   MQRPPQ--EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             MQRP    E++ LKET PHLGG    GDKLT+TYDLVEQMQYLYVRVVKA++LP  D+TG
Sbjct  2     MQRPLLRPEEYSLKETSPHLGGAA-AGDKLTTTYDLVEQMQYLYVRVVKAKELPNMDITG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKERIQ+S++E++VKDKD VKDDF+G
Sbjct  61    SCDPYVEVKLGNYKGQTQHFEKKNNPEWNQVFAFSKERIQSSVVEIVVKDKDLVKDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV+FDL+E+PKRVPPDSPLAPQWYRLEDR G KV+  GELMLAVWMGT
Sbjct  121   RVIFDLNEVPKRVPPDSPLAPQWYRLEDRNGHKVK--GELMLAVWMGT  166



>ref|XP_010673580.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673581.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
Length=770

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPY  760
             PP+E+F L+ET P +G   I GDKL STYDLVEQMQYLYVRVVKA++LP KDVTGS DPY
Sbjct  5     PPREEFALRETSPAIGVAGIAGDKLNSTYDLVEQMQYLYVRVVKAKELPGKDVTGSCDPY  64

Query  761   VEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvfd  940
             VEV+LGNYKGTTRHFEK + PEWNQVFAFSKERIQAS++E+ VKDKD +KDDF+GRV+FD
Sbjct  65    VEVKLGNYKGTTRHFEKNTKPEWNQVFAFSKERIQASIVEIFVKDKDVLKDDFIGRVIFD  124

Query  941   LHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             L E+PKRVPPDSPLAPQWYR+ED KG K +  GE+MLAVWMGT
Sbjct  125   LTEVPKRVPPDSPLAPQWYRIEDLKGGKAK--GEIMLAVWMGT  165



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 6/170 (4%)
 Frame = +2

Query  572   MQRP---PQEDFMLKETKPHLGGGKITG-DKLTSTYDLVEQMQYLYVRVVKARDLPPKDV  739
             MQRP   PQEDF LKET P LGGG + G DKLT+TYDLVEQMQYLYVRVVKA+DLP KDV
Sbjct  1     MQRPFPLPQEDFSLKETAPRLGGGGLGGGDKLTNTYDLVEQMQYLYVRVVKAKDLPAKDV  60

Query  740   TGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddf  919
             TGS DPYVEV+LGNYKGTTRHFEKK+NPEWNQVFAFSK+RIQAS++EV+VKDKDFVKDDF
Sbjct  61    TGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKDRIQASVVEVVVKDKDFVKDDF  120

Query  920   vgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +G V+FDL+EIPKRVPPDSPLAPQWYRLEDRKG+KV+  GELMLAVWMGT
Sbjct  121   MGMVLFDLNEIPKRVPPDSPLAPQWYRLEDRKGEKVK--GELMLAVWMGT  168



>ref|XP_003543552.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Glycine max]
 ref|XP_006595053.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Glycine max]
 gb|KHN30112.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   226 bits (576),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQE-DFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             M +P +  DF LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG 
Sbjct  1     MHKPAEALDFALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTGG  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             +DPYVEV+LGNYKG T+HFEK SNP+WNQVFAFSKERIQAS+LEV++KDKD V DDFVGR
Sbjct  61    VDPYVEVKLGNYKGLTKHFEKNSNPQWNQVFAFSKERIQASVLEVVIKDKDVVVDDFVGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+FD++EIPKRVPPDSPLAPQWYRLEDR+G K +  GELMLAVWMGT
Sbjct  121   VMFDINEIPKRVPPDSPLAPQWYRLEDRRGGKAK--GELMLAVWMGT  165



>ref|XP_007150401.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 ref|XP_007150402.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22395.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
 gb|ESW22396.1| hypothetical protein PHAVU_005G150300g [Phaseolus vulgaris]
Length=774

 Score =   226 bits (575),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             HK + PP+  F LKET P++G G +  DKL+ TYDLVEQMQYLYVRVVKA+DLP KDVTG
Sbjct  2     HKPEGPPE--FALKETSPNIGAGAVMRDKLSCTYDLVEQMQYLYVRVVKAKDLPGKDVTG  59

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
              +DPYVEV+LGNYKG T+HFEKKSNP+WN VFAFSKE IQAS+LEV++KDKD V D+FVG
Sbjct  60    GVDPYVEVKLGNYKGLTKHFEKKSNPQWNHVFAFSKESIQASVLEVVLKDKDVVVDEFVG  119

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             RV+FDL+EIPKRVPPDSPLAPQWYRLEDR+G+K +  GELMLAVWMGT
Sbjct  120   RVMFDLNEIPKRVPPDSPLAPQWYRLEDRRGEKAK--GELMLAVWMGT  165



>ref|XP_012083417.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Jatropha curcas]
 gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score =   219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 144/165 (87%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      D++TSTYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  250   DYALKETSPFLGGGQIVGGRVIRGDRMTSTYDLVEQMRYLFVRVVKARDLPTMDVTGSLD  309

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNYKG T++FEK+ NPEWN+VFAF++ER+Q+S+LEV+VKDKD VKDDFVG V 
Sbjct  310   PYVEVRVGNYKGITKYFEKQQNPEWNEVFAFARERMQSSVLEVVVKDKDLVKDDFVGIVR  369

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++EIP RVPPDSPLAP+WYRLED+KGDKV+  GELMLAVW GT
Sbjct  370   FDMNEIPTRVPPDSPLAPEWYRLEDKKGDKVK--GELMLAVWYGT  412



>ref|XP_009383872.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=1012

 Score =   219 bits (557),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  241   DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  300

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKGTT+HFEKK NPEWN+VFAFS+E +QAS+LEV++KDKD +KDDFVG + 
Sbjct  301   PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFSREHMQASILEVVIKDKDLLKDDFVGIIR  360

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLH++P RVPPDSPLAP+WYRLED+ GDK +  GELMLAVW+GT
Sbjct  361   FDLHDVPTRVPPDSPLAPEWYRLEDKMGDKTK--GELMLAVWIGT  403



>ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 143/165 (87%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      DK  STYDLVEQMQYL+VRVVKA+DLP  DVTGSLD
Sbjct  232   DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQYLFVRVVKAKDLPAMDVTGSLD  291

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNYKGTT+HFEKK NPEWN+VFAFS++++QAS++EV+VKDKD VKDDFVG V 
Sbjct  292   PFVEVRVGNYKGTTKHFEKKQNPEWNEVFAFSRDQLQASIVEVVVKDKDLVKDDFVGLVR  351

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRLED+KGDK +  GELMLAVW+GT
Sbjct  352   FDLNDVPSRVPPDSPLAPEWYRLEDKKGDKTK--GELMLAVWIGT  394



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score =   216 bits (550),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 144/165 (87%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K TSTYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232   DYALKETSPFLGGGQIVGGRVIRAEKPTSTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNY+G+T+HFEKK NPEWN+VFAFS++R+Q+S+LEV+VKD+D +KDDFVG + 
Sbjct  292   PYVEVRVGNYRGSTKHFEKKQNPEWNEVFAFSRDRMQSSVLEVVVKDRDLIKDDFVGLIR  351

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRLED+KGDK +  GELMLAVW+GT
Sbjct  352   FDLNDVPTRVPPDSPLAPEWYRLEDKKGDKTK--GELMLAVWIGT  394



>ref|XP_012092782.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Jatropha curcas]
Length=769

 Score =   215 bits (547),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 3/167 (2%)
 Frame = +2

Query  572   MQRPPQ-EDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             MQ+PPQ  DF LK+T P++G G +T DKL  TYDLVEQMQYL+VRVVKA+DLP  +  G 
Sbjct  1     MQKPPQLVDFGLKQTSPNIGAGVVTTDKLACTYDLVEQMQYLFVRVVKAKDLPDNNTDGC  60

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
              +PY+EV+LGNYKG T+HFEK  NPEWNQVFAFSK+ IQAS+LEV VKDKD V DD +GR
Sbjct  61    -NPYIEVKLGNYKGITKHFEKSLNPEWNQVFAFSKDTIQASVLEVSVKDKDVVLDDLIGR  119

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V+F+L+EIPKRVPPDSPLA QWYRLED+KGDK++  GELMLAVWMGT
Sbjct  120   VLFELNEIPKRVPPDSPLATQWYRLEDQKGDKIK-AGELMLAVWMGT  165



>emb|CDP14088.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   214 bits (545),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 3/168 (2%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             M+ P  E+F LKET P + G    I GDKLT TYDLVEQMQYLYVRVVKARDLP KDVTG
Sbjct  1     MKLPQPEEFALKETAPKIAGSGAIIDGDKLTCTYDLVEQMQYLYVRVVKARDLPGKDVTG  60

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg  925
             S DPY EV++GNYKG T+HFEKKSNPEWN VFAFS++++QAS +EV+VKDKD V DDF+G
Sbjct  61    SCDPYAEVKVGNYKGVTKHFEKKSNPEWNYVFAFSQDKLQASFVEVVVKDKDVVLDDFIG  120

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             R+ FD  EIP+RVPPDSPLAPQWYRLED+KGDK+R  GE+MLAVW GT
Sbjct  121   RITFDFIEIPRRVPPDSPLAPQWYRLEDKKGDKLR-HGEIMLAVWKGT  167



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score =   216 bits (549),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      D++ STYDLVEQM+YL+VRVVKAR+LP KDVTGSLD
Sbjct  244   DYALKETSPFLGGGQIVGGRVIRRDRIASTYDLVEQMKYLFVRVVKARELPSKDVTGSLD  303

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNYKG T+HFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD VKDDFVG V 
Sbjct  304   PYVEVRVGNYKGITKHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLVKDDFVGIVR  363

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++EIP RVPPDSPLAP+WYRLED+KG+K +  GELMLAVW GT
Sbjct  364   FDMNEIPTRVPPDSPLAPEWYRLEDKKGNKDK--GELMLAVWYGT  406



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score =   215 bits (548),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 144/165 (87%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      DK  STYDLVEQMQ+L+VRVVKAR+LPP D+TGSLD
Sbjct  235   DYALKETSPFLGGGQIVGGRVIRADKPASTYDLVEQMQFLFVRVVKARELPPMDITGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKG TRHFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD VKDDFVG ++
Sbjct  295   PYVEVKVGNYKGVTRHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLVKDDFVGIIM  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRL+D+KG+K +  GELMLAVW+GT
Sbjct  355   FDLNEVPIRVPPDSPLAPEWYRLQDKKGEKTK--GELMLAVWIGT  397



>ref|XP_006349900.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=771

 Score =   213 bits (543),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 132/166 (80%), Gaps = 15/166 (9%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRPPQEDF       HL GGK+TGD  T TYDLVEQMQYLYVRVVKA+DLP KD    L
Sbjct  1     MQRPPQEDF-----SAHLDGGKVTGDMFTRTYDLVEQMQYLYVRVVKAKDLPGKD----L  51

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
             DPYVEVRLGNY GTTRHF KK+NPEWNQVFAFS ++IQ S+LEV        KDD VGRV
Sbjct  52    DPYVEVRLGNYSGTTRHFVKKTNPEWNQVFAFSMDQIQVSVLEV----NVKDKDDSVGRV  107

Query  932   vfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +FDL+EIPKRVPPDSPLAPQWYRLED  G KV+  GELM+AVWMGT
Sbjct  108   MFDLNEIPKRVPPDSPLAPQWYRLEDGSGSKVK--GELMMAVWMGT  151



>ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=1006

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G ++      TSTYDLVE+MQYL++RVVKARDLP KDVTGSLD
Sbjct  232   DYSLKETSPFLGGGQIIGGRVIPGNRPTSTYDLVEKMQYLFIRVVKARDLPAKDVTGSLD  291

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKG T+HFEKK NPEWN+VFAF+K+ +Q+S+LEV+VKDKD + DDFVG V 
Sbjct  292   PYVEVKMGNYKGKTKHFEKKQNPEWNEVFAFAKDNLQSSVLEVLVKDKDVLIDDFVGLVR  351

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLAP+WYRL D+ GDK +  GELMLAVW+GT
Sbjct  352   FDLHEVPTRVPPDSPLAPEWYRLADKDGDKKK--GELMLAVWLGT  394



>emb|CBI30044.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  572  MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
            M RPP +DF LKET PHLGGGK+TGDKLTSTYDLVEQMQYLYVRVVKA+DLP KDVTGS 
Sbjct  1    MHRPPPDDFSLKETSPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKAKDLPSKDVTGSC  60

Query  752  DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrv  931
            DPYVEV+LGNYKGTT HFEKK+NPEWN+VFAFSK+R+QASMLEVIVKDKDFVKDD++GRV
Sbjct  61   DPYVEVKLGNYKGTTPHFEKKTNPEWNRVFAFSKDRMQASMLEVIVKDKDFVKDDYIGRV  120

Query  932  vfdLHEIPKRVPPDS  976
            VFDL+E+PKRVPPD+
Sbjct  121  VFDLNEVPKRVPPDT  135



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score =   213 bits (541),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKIT------GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG++        DK  STYDLVEQMQ+L+VRVVKAR+LP  DVTGSLD
Sbjct  229   DFALKETSPFLGGGQVVRGRVIRSDKTASTYDLVEQMQFLFVRVVKARELPAMDVTGSLD  288

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKG T+H EKK NPEWN VFAFS++R+QAS+LEV+VKDKD VKDDFVGR  
Sbjct  289   PYVEVKIGNYKGVTKHMEKKQNPEWNVVFAFSRDRMQASVLEVVVKDKDLVKDDFVGRAR  348

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  349   FDLNEVPMRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  391



>ref|XP_010659323.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Vitis vinifera]
Length=776

 Score =   211 bits (537),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 142/162 (88%), Gaps = 3/162 (2%)
 Frame = +2

Query  587   QEDFMLKETKPHLGGGKIT-GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDPYV  763
             ++D+ LKET P+LGGG+++ GDKLT+ +DLVEQM YLYVRVVKA++LP KD + S DPYV
Sbjct  13    EDDYCLKETSPNLGGGRLSRGDKLTTAFDLVEQMHYLYVRVVKAKELPGKDGSESCDPYV  72

Query  764   EVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvfdL  943
             EV++GN+KG T+H EKKSNP W+QVFAFSK+R+Q+S +EV VKDK+  KDDF+G V+FDL
Sbjct  73    EVKVGNFKGFTKHIEKKSNPVWSQVFAFSKDRLQSSFIEVSVKDKNGGKDDFMGVVLFDL  132

Query  944   HEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             H++P+RVPPDSPLAPQWYRLEDRKG KV+  GELMLAVWMGT
Sbjct  133   HDVPRRVPPDSPLAPQWYRLEDRKGSKVK--GELMLAVWMGT  172



>ref|XP_011625449.1| PREDICTED: uncharacterized protein LOC18439867 isoform X4 [Amborella 
trichopoda]
Length=969

 Score =   212 bits (540),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +2

Query  560   NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  186   NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  244

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV +   +
Sbjct  245   LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  304

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++GRVVFDL+E+PKRVPPDSPLAPQWYRLEDRKG+ KVR  GE+MLAVWMGT
Sbjct  305   MVGRDDYLGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGETKVR--GEMMLAVWMGT  360



>ref|XP_011625448.1| PREDICTED: uncharacterized protein LOC18439867 isoform X3 [Amborella 
trichopoda]
Length=974

 Score =   212 bits (539),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +2

Query  560   NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  191   NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  249

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV +   +
Sbjct  250   LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  309

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++GRVVFDL+E+PKRVPPDSPLAPQWYRLEDRKG+ KVR  GE+MLAVWMGT
Sbjct  310   MVGRDDYLGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGETKVR--GEMMLAVWMGT  365



>ref|XP_011625450.1| PREDICTED: uncharacterized protein LOC18439867 isoform X5 [Amborella 
trichopoda]
Length=950

 Score =   212 bits (539),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +2

Query  560   NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  167   NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  225

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV +   +
Sbjct  226   LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  285

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++GRVVFDL+E+PKRVPPDSPLAPQWYRLEDRKG+ KVR  GE+MLAVWMGT
Sbjct  286   MVGRDDYLGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGETKVR--GEMMLAVWMGT  341



>ref|XP_006850085.1| PREDICTED: extended synaptotagmin-1 isoform X1 [Amborella trichopoda]
 gb|ERN11666.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
Length=1036

 Score =   212 bits (540),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +2

Query  560   NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  253   NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  311

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV +   +
Sbjct  312   LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  371

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++GRVVFDL+E+PKRVPPDSPLAPQWYRLEDRKG+ KVR  GE+MLAVWMGT
Sbjct  372   MVGRDDYLGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGETKVR--GEMMLAVWMGT  427



>ref|XP_011625447.1| PREDICTED: extended synaptotagmin-1 isoform X2 [Amborella trichopoda]
Length=1014

 Score =   212 bits (539),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = +2

Query  560   NNHKMQRPP------QEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             NN++   PP        DF LK T PHLG G  +  +  STYDLVEQM YLYVRVVKA+D
Sbjct  231   NNYQNIVPPPPGTHHHGDFGLKNTSPHLGTG-WSNREFASTYDLVEQMHYLYVRVVKAKD  289

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTGS DPY EV+LGNYKGTT+HFEKK NPEWNQVFAFSKERIQ+SMLEV +   +
Sbjct  290   LPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQVFAFSKERIQSSMLEVFVKDKE  349

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++GRVVFDL+E+PKRVPPDSPLAPQWYRLEDRKG+ KVR  GE+MLAVWMGT
Sbjct  350   MVGRDDYLGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGETKVR--GEMMLAVWMGT  405



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score =   210 bits (535),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 142/165 (86%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKIT------GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             ++ LKET P+LGGG++       GDK  STYDLVEQM +LYVRVVKAR+LP  D++GS+D
Sbjct  236   EYALKETSPYLGGGRVVAGRVIRGDKTASTYDLVEQMHFLYVRVVKARELPAMDISGSID  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNYKG TRH+E+K NPEWNQVFAFS+ER+QAS+L+V++KDKD VKDDFVG V 
Sbjct  296   PYVEVRVGNYKGITRHYEQKQNPEWNQVFAFSRERMQASVLDVVIKDKDLVKDDFVGIVR  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLE +KG+K++  GELMLAVW+GT
Sbjct  356   FDVNEVPLRVPPDSPLAPEWYRLESKKGEKIK--GELMLAVWIGT  398



>ref|XP_011023361.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   210 bits (535),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+  KET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKARDLP  DVTGSLD
Sbjct  235   DYTPKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKARDLPTMDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++RIQ+S+LEV+VKDKD +KDDFVG V 
Sbjct  295   PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRIQSSVLEVVVKDKDLIKDDFVGIVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLA +WYRLED+KG+K +   ELMLAVW GT
Sbjct  355   FDLHEVPTRVPPDSPLASEWYRLEDKKGEKSK--AELMLAVWYGT  397



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score =   210 bits (534),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DVTGSLD
Sbjct  232   DYALKETSPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVTGSLD  291

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEKK NPEW +VFAFS++R+Q+S+L+V+VKDK+ VKDDFVG + 
Sbjct  292   PFVEVRVGNYRGNTKHFEKKQNPEWKEVFAFSRDRMQSSVLDVVVKDKNLVKDDFVGFIR  351

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRLED+KGDK +  GELMLAVW GT
Sbjct  352   FDLNDVPTRVPPDSPLAPEWYRLEDKKGDKTK--GELMLAVWFGT  394



>ref|XP_011015655.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   210 bits (534),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 139/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  235   DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++RIQ+S+LEV+VKDKD +KDDFVG V 
Sbjct  295   PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRIQSSVLEVVVKDKDLIKDDFVGIVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLA +WYRLED+KG+K +   ELMLAVW GT
Sbjct  355   FDLHEVPTRVPPDSPLASEWYRLEDKKGEKSK--AELMLAVWYGT  397



>ref|XP_002301353.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
 gb|EEE80626.2| hypothetical protein POPTR_0002s15950g [Populus trichocarpa]
Length=1008

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 139/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+  KET P LGGG+I G      D+  STYDLVEQM+YL+VRVVKARDLP  DVTGSLD
Sbjct  236   DYTPKETSPFLGGGQIVGGRVIRGDRPASTYDLVEQMKYLFVRVVKARDLPTMDVTGSLD  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKGTT+HFEKK NPEWN+VFAF+++R+Q+S+LEV+VKDKD +KDDFVG V 
Sbjct  296   PYVEVKVGNYKGTTKHFEKKQNPEWNEVFAFARDRMQSSVLEVVVKDKDLIKDDFVGIVR  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLA +WYRLED+KG+K +   ELMLAVW GT
Sbjct  356   FDLHEVPTRVPPDSPLASEWYRLEDKKGEKSK--AELMLAVWYGT  398



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score =   207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235   DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+++EKK NPEWN+VFAFS+ERIQ+S+LEV VKDKD VKDD+VG V 
Sbjct  295   PFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLA +WYRLEDRKG+K +  GELMLAVW GT
Sbjct  355   FDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKK--GELMLAVWYGT  397



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score =   207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITGDKL------TSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG++ G ++       STYDLVEQM+YL+VRVVKARDLP KDVTGSLD
Sbjct  235   DYALKETSPFLGGGQVIGGRVVRGDLRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+++EKK NPEWN+VFAFS+ERIQ+S+LEV VKDKD VKDD+VG V 
Sbjct  295   PFVEVKVGNYKGITKYYEKKQNPEWNEVFAFSRERIQSSVLEVAVKDKDVVKDDYVGLVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLA +WYRLEDRKG+K +  GELMLAVW GT
Sbjct  355   FDLNEVPTRVPPDSPLAAEWYRLEDRKGEKKK--GELMLAVWYGT  397



>ref|XP_002299538.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
 gb|EEE84343.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
Length=1008

 Score =   207 bits (528),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  236   DYALKETSPFLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD VKDDFVG + 
Sbjct  296   PFVEVRIGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGVIR  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  356   FDINEVPLRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  398



>ref|XP_007204276.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
 gb|EMJ05475.1| hypothetical protein PRUPE_ppa001596mg [Prunus persica]
Length=795

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 15/176 (9%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  727
             P QED+ LK+TKPHLG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP
Sbjct  7     PNQEDYKLKDTKPHLGERWPHGGIRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLP  66

Query  728   PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdf  904
                VTG  DPYV V+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQAS+LEV +      
Sbjct  67    TNPVTGICDPYVGVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKIQASILEVYVKDKAMV  126

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
              +DD+VG+VVFD++E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+MLAVWMGT
Sbjct  127   ARDDYVGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRQGDTKVR--GEVMLAVWMGT  180



>ref|XP_008240964.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Prunus mume]
Length=795

 Score =   205 bits (522),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 15/176 (9%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  727
             P QED+ LK+TKPHLG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP
Sbjct  7     PNQEDYKLKDTKPHLGERWPHGGIRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLP  66

Query  728   PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdf  904
                VTG  DP+V V+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQAS+LEV +      
Sbjct  67    TNPVTGICDPFVAVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKIQASILEVYVKDKAMV  126

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
              +DD+VG+VVFD++E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+MLAVWMGT
Sbjct  127   ARDDYVGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRQGDTKVR--GEVMLAVWMGT  180



>ref|XP_010273065.1| PREDICTED: uncharacterized protein LOC104608707 [Nelumbo nucifera]
Length=1009

 Score =   207 bits (526),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 145/165 (88%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+      I  DKL+STYDLVE+MQ+L+VRVVKAR+LP KD+TGSLD
Sbjct  236   DYALKETSPFLGGGQVVGGRVIRVDKLSSTYDLVEKMQFLFVRVVKARELPAKDITGSLD  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKG T+HFEKK NPEWN+VFAF++ER+Q+S+LEV+VKDKD VKDDFVG + 
Sbjct  296   PYVEVKVGNYKGITKHFEKKQNPEWNEVFAFARERMQSSVLEVVVKDKDLVKDDFVGILK  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  356   FDLNEVPTRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  398



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score =   207 bits (526),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233   DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNYKGTTRHFEKK NPEWN+VFAF+KE  Q+S+L+V+VKDKD +KDDFVG V 
Sbjct  293   PYVEVRIGNYKGTTRHFEKKQNPEWNEVFAFAKENEQSSVLDVVVKDKDLLKDDFVGLVR  352

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLAP+WYRL ++ G K +  GELMLAVW GT
Sbjct  353   FDLHEVPTRVPPDSPLAPEWYRLANKDGKKEK--GELMLAVWYGT  395



>ref|XP_011029251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X1 [Populus euphratica]
 ref|XP_011029252.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X2 [Populus euphratica]
Length=1007

 Score =   207 bits (526),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  235   DYALKETSPFLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD +KDDFVG + 
Sbjct  295   PFVEVRIGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLLKDDFVGVIR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  355   FDVNEVPLRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  397



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score =   206 bits (525),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P+LGGG+I G      D+ + TYDLV++MQYL+VRVVKARDLP  DVTGSLD
Sbjct  233   DYSLKETSPYLGGGQIVGGRVIRADRPSGTYDLVQKMQYLFVRVVKARDLPHMDVTGSLD  292

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNYKGTTRHFEKK NPEWN+VFAF+KE  Q+S+L+V+VKDKD +KDDFVG V 
Sbjct  293   PYVEVRIGNYKGTTRHFEKKQNPEWNEVFAFAKENEQSSVLDVVVKDKDLLKDDFVGLVR  352

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDLHE+P RVPPDSPLAP+WYRL ++ G K +  GELMLAVW GT
Sbjct  353   FDLHEVPTRVPPDSPLAPEWYRLANKDGKKEK--GELMLAVWYGT  395



>gb|AFN53655.1| putative synaptotagmin protein [Linum usitatissimum]
Length=793

 Score =   205 bits (522),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             +EDF LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKARDLPP 
Sbjct  10    KEDFKLKDTKPQLGERWPHGGSRGGGGWISSERATSTYDLVEQMFYLYVRVVKARDLPPN  69

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              V+GS DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKE++Q+S+LEV +   +   +
Sbjct  70    PVSGSCDPYVEVKLGNYKGKTQHFEKKTNPEWNQVFAFSKEKLQSSVLEVYVRDREMVGR  129

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD+ G+V+FD+HE+P RVPPDSPLAPQWYRLEDR+G+  +  GE+MLAVWMGT
Sbjct  130   DDYAGKVIFDMHEVPTRVPPDSPLAPQWYRLEDRRGE-TKVKGEVMLAVWMGT  181



>emb|CDX81021.1| BnaC03g02750D [Brassica napus]
Length=287

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9     QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VT + DPYVEV++GNYKG T+HFEK++NPEWNQVFAFSK++IQ+S +EV +   +   +
Sbjct  69    PVTSNCDPYVEVKIGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSTVEVFVRDKEMVTR  128

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD+HEIP RVPPDSPLAPQWYRLE R+G+  +  GE+M+AVW+GT
Sbjct  129   DDYIGKVVFDMHEIPTRVPPDSPLAPQWYRLEARRGE-AKKRGEVMVAVWLGT  180



>emb|CBI40337.3| unnamed protein product [Vitis vinifera]
Length=640

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  164   DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  223

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD +KDD VG V 
Sbjct  224   PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFVR  283

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL ++P RVPPDSPLAP+WYR+ + KG+K    GELMLAVW GT
Sbjct  284   FDLSDVPTRVPPDSPLAPEWYRIANSKGEK--NNGELMLAVWYGT  326



>gb|EYU23487.1| hypothetical protein MIMGU_mgv1a000757mg [Erythranthe guttata]
Length=993

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 138/167 (83%), Gaps = 10/167 (6%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITGDKLT--------STYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             DF LKET P LGGG+I G K+          TYDLVE+M +L+VRVVKAR+LP  DVTGS
Sbjct  221   DFALKETSPFLGGGRIVGGKVVKTDRTTAGGTYDLVEKMHFLFVRVVKARELPAMDVTGS  280

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgr  928
             LDPYVEV++GNYKG T+H EK+ NP WN VFAFS+ER+QAS+LEV+VKDKD +KDDFVG 
Sbjct  281   LDPYVEVKIGNYKGITKHIEKQQNPMWNVVFAFSRERMQASVLEVVVKDKDILKDDFVGF  340

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             V FDL+E+P RVPPDSPLAP+WYRLED+KG+K+R  GELMLAVW+GT
Sbjct  341   VRFDLNEVPMRVPPDSPLAPEWYRLEDKKGEKIR--GELMLAVWIGT  385



>ref|XP_002320122.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
 gb|EEE98437.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
Length=1008

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 139/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      D+ +S+YDLVEQM+YLYVRVVKA DLP  DVTGSLD
Sbjct  236   DYALKETSPFLGGGQIVGGRVIRGDRPSSSYDLVEQMKYLYVRVVKAHDLPTMDVTGSLD  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEV++GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD VKDDFVG V 
Sbjct  296   PYVEVKVGNYKGITKHFEKNKNPEWNEVFAFAGDRLQSSVLEVMVKDKDLVKDDFVGIVR  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD +E+P RVPPDSPLAP+WYRLED+KG+KV+  GELMLAVW GT
Sbjct  356   FDRNEVPTRVPPDSPLAPEWYRLEDKKGEKVK--GELMLAVWYGT  398



>ref|XP_012086923.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Jatropha curcas]
 ref|XP_012086924.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Jatropha curcas]
 gb|KDP25449.1| hypothetical protein JCGZ_20605 [Jatropha curcas]
Length=1005

 Score =   206 bits (524),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 142/165 (86%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  233   DYALKETSPLLGGGRVVGGRVIHGDKTASTYDLVERMFFLYVRVVKARDLPAMDVTGSLD  292

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD VKDDFVG + 
Sbjct  293   PFVEVKIGNYKGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGIMR  352

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++EIP RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  353   FDINEIPLRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  395



>ref|XP_006342310.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=791

 Score =   204 bits (520),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 141/175 (81%), Gaps = 15/175 (9%)
 Frame = +2

Query  584   PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  730
             PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9     PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  731   KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfv  907
               VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S++EV +   +   
Sbjct  69    NPVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSIIEVFVRDKEMVQ  128

Query  908   kddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             +DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+G+ KVR  GE+MLAVWMGT
Sbjct  129   RDDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGESKVR--GEVMLAVWMGT  181



>ref|XP_007052594.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOX96751.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1050

 Score =   206 bits (525),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 144/182 (79%), Gaps = 15/182 (8%)
 Frame = +2

Query  563   NHKMQRPPQEDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVV  709
             N + Q   QED+ LK+T P LG         GG+  I+G++ TSTYDLVEQM YLYVRVV
Sbjct  257   NAQAQPGYQEDYNLKDTNPQLGERWPNGGAYGGRGWISGERFTSTYDLVEQMFYLYVRVV  316

Query  710   KARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-I  886
             KA+DLPP  VTGS DPYVEV+LGNYKG T+HFE+K NPEWNQVFAFSK+R+Q+S+LEV +
Sbjct  317   KAKDLPPSSVTGSCDPYVEVKLGNYKGRTKHFERKMNPEWNQVFAFSKDRVQSSVLEVFV  376

Query  887   vkdkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWM  1063
                +   +DD++GRVVFDL+EIP RVPPDSPLAPQWYRLEDR+ + KVR  G++MLAVWM
Sbjct  377   KDKEMVGRDDYLGRVVFDLNEIPTRVPPDSPLAPQWYRLEDRRREGKVR--GDVMLAVWM  434

Query  1064  GT  1069
             GT
Sbjct  435   GT  436



>gb|KJB25055.1| hypothetical protein B456_004G174500 [Gossypium raimondii]
Length=805

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 138/175 (79%), Gaps = 16/175 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----GGKITG-------DKLTSTYDLVEQMQYLYVRVVKARDLPP  730
             QED+ LK+T P LG     GG   G       D+ TSTYDLVEQM YLYVRVVKA++LPP
Sbjct  20    QEDYNLKDTSPQLGERWPNGGTFGGRGWMNGGDRFTSTYDLVEQMFYLYVRVVKAKELPP  79

Query  731   KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfv  907
               +TGS DPYVEV+LGNYKG T+HF++KSNPEWNQVFAFSK+R+Q+S+LEV +   +   
Sbjct  80    SSLTGSCDPYVEVKLGNYKGRTKHFDRKSNPEWNQVFAFSKDRVQSSLLEVFVKDKEMAG  139

Query  908   kddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             +DD+V RV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  GE+MLAVWMGT
Sbjct  140   RDDYVRRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GEVMLAVWMGT  192



>gb|KHG10339.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=1011

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I  DK  STYDLVE+M +LYVRVVKAR+LP  DVTG +D
Sbjct  238   DFALKETSPFLGGGRVVGGRVIHADKTASTYDLVERMHFLYVRVVKARELPSVDVTGGID  297

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+HFEKK NPEWNQVFAFS++R+QAS+LEV++KDK  VKD+ VG V 
Sbjct  298   PFVEVKVGNYKGITKHFEKKQNPEWNQVFAFSRDRMQASILEVVIKDKSMVKDETVGIVR  357

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAPQWYRLED+KGDKV+  GELMLAVW+GT
Sbjct  358   FDINEVPLRVPPDSPLAPQWYRLEDKKGDKVK--GELMLAVWIGT  400



>ref|XP_012087734.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Jatropha curcas]
 gb|KDP24593.1| hypothetical protein JCGZ_25509 [Jatropha curcas]
Length=788

 Score =   204 bits (519),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             +EDF LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  7     KEDFKLKDTKPQLGERWPHGGLRSGGGWISSDRATSTYDLVEQMFYLYVRVEKARDLPTN  66

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTG+LDPYVEV++GNY+G T+HFEKK+NPEW QVFAFSK++IQ+S+LEV +   +   +
Sbjct  67    PVTGNLDPYVEVKVGNYRGRTKHFEKKTNPEWKQVFAFSKDKIQSSVLEVFVRDREMVGR  126

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD+VG+VVFD+HE+P RVPPDSPLAPQWYRLEDR GD  +  GE+MLAVWMGT
Sbjct  127   DDYVGKVVFDMHEVPTRVPPDSPLAPQWYRLEDRHGDS-KVKGEVMLAVWMGT  178



>gb|KJB25820.1| hypothetical protein B456_004G210900 [Gossypium raimondii]
Length=1011

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I  DK  STYDLVE+M +LYVRVVKAR+LP  DVTG +D
Sbjct  238   DFALKETSPFLGGGRVVGGRVIHADKTASTYDLVERMHFLYVRVVKARELPSVDVTGGID  297

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+HFEKK NPEWNQVFAFS++R+QAS+LEV++KDK  VKD+ VG V 
Sbjct  298   PFVEVKVGNYKGITKHFEKKQNPEWNQVFAFSRDRMQASVLEVVIKDKSMVKDETVGVVR  357

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAPQWYRLED+KGDKV+  GELMLAVW+GT
Sbjct  358   FDINEVPLRVPPDSPLAPQWYRLEDKKGDKVK--GELMLAVWIGT  400



>ref|XP_010238001.1| PREDICTED: LOW QUALITY PROTEIN: extended synaptotagmin-1-like 
[Brachypodium distachyon]
Length=771

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = +2

Query  572   MQRPPQEDFMLKETKPHLGGGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSL  751
             MQRP  E+++LK+T PHLGG    GDKLT TYDLVEQMQYLYV VVKA+DLP KD+TGS 
Sbjct  1     MQRPRSEEYLLKDTSPHLGGFMAAGDKLTRTYDLVEQMQYLYVHVVKAKDLPFKDLTGSC  60

Query  752   DPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvg-r  928
             DPYVE++LGNYKG T H EK ++PEWNQVFAF KE IQ+  +EV+VKDKD    D    R
Sbjct  61    DPYVEIKLGNYKGITHHMEKNTSPEWNQVFAFPKEHIQSPYVEVVVKDKDLFIQDDFIGR  120

Query  929   vvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              VFDL EIPKRV PDSPLAP+WY LE   G K    GELMLAVWMGT
Sbjct  121   AVFDLSEIPKRVSPDSPLAPEWYSLEGWNGGKF---GELMLAVWMGT  164



>ref|XP_010918556.1| PREDICTED: uncharacterized protein LOC105042892 [Elaeis guineensis]
Length=1004

 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 142/165 (86%), Gaps = 9/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I G+K    YDLVE+MQYL+VRVVKAR+LP KD+TGSLD
Sbjct  230   DFQLKETSPFLGGGRVVGGRVIPGEK-AGAYDLVEKMQYLFVRVVKARELPAKDLTGSLD  288

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVRLGN+KGTTRHFEKK+NPEWN+VFAFS+ER+QAS LEV+VKDKD VKDDFVG V 
Sbjct  289   PYVEVRLGNFKGTTRHFEKKANPEWNEVFAFSRERLQASFLEVVVKDKDLVKDDFVGIVR  348

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLA+W GT
Sbjct  349   FDLNEVPTRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAIWYGT  391



>ref|XP_010928529.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1 [Elaeis guineensis]
Length=1012

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +2

Query  590   EDFMLKETKPHLG-------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGS  748
             E++ LK+T P LG        GK  GDK TSTYDLVEQM YLYVRVVKA+DLP   +TGS
Sbjct  234   EEYKLKDTSPQLGERWPAGAHGKGDGDKFTSTYDLVEQMYYLYVRVVKAKDLPTNAITGS  293

Query  749   LDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvkddfvg  925
              DPY EV+LGNY+GTT+HFEK++NPEWNQVFAFSKERIQ+++LEV +   +   +DD+VG
Sbjct  294   CDPYAEVKLGNYRGTTKHFEKRTNPEWNQVFAFSKERIQSTILEVFVKDREMVARDDYVG  353

Query  926   rvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +VVFDL+E+P RVPPDSPLAPQWYRLEDR+ ++V+  GE+MLAVWMGT
Sbjct  354   KVVFDLNEVPTRVPPDSPLAPQWYRLEDRR-EEVKVRGEIMLAVWMGT  400



>ref|XP_006483676.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
Length=1035

 Score =   205 bits (521),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  250   QEEYNLKDTNPQLGERWLNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  309

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV +   +   +
Sbjct  310   SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFVKDKEMLGR  369

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  G++MLA+WMGT
Sbjct  370   DDYLGRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GQIMLAIWMGT  421



>gb|EMT30716.1| hypothetical protein F775_31640 [Aegilops tauschii]
Length=983

 Score =   204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242   DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEK+ NPEWN VFAFS+ER+QAS++EV+VKDKD V+DDFVG V 
Sbjct  302   PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFSRERMQASVIEVLVKDKDLVRDDFVGMVR  361

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRL  + GDK R  GELMLAVW+GT
Sbjct  362   FDLNDVPVRVPPDSPLAPEWYRLVHKDGDKSR--GELMLAVWIGT  404



>ref|XP_006439068.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
 gb|ESR52308.1| hypothetical protein CICLE_v10030600mg [Citrus clementina]
Length=1026

 Score =   205 bits (521),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241   QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV +   +   +
Sbjct  301   SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFVKDKEMLGR  360

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  G++MLA+WMGT
Sbjct  361   DDYLGRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GQIMLAIWMGT  412



>ref|XP_009393442.1| PREDICTED: uncharacterized protein LOC103979123 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score =   205 bits (521),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 137/164 (84%), Gaps = 3/164 (2%)
 Frame = +2

Query  584   PQEDFMLKETKPHLGG--GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLDP  757
             P  DF + ET P L G  G  +GDK+ STYDLVEQM+YLYV VVKARDLP  D+TGSLDP
Sbjct  269   PGPDFGIVETAPPLAGRLGYRSGDKIASTYDLVEQMRYLYVNVVKARDLPTMDLTGSLDP  328

Query  758   YVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvvf  937
             YVEV+LGNYKGTT+H EK SNP W QVFAFSK+RIQ+S LEV+VKDKD VKDDFVGR+VF
Sbjct  329   YVEVKLGNYKGTTKHLEKNSNPVWQQVFAFSKDRIQSSQLEVVVKDKDLVKDDFVGRLVF  388

Query  938   dLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DL E+P RVPPDSPLA QWYRLED+KGDK+   GELMLA+W+GT
Sbjct  389   DLTEVPLRVPPDSPLAAQWYRLEDKKGDKI-PKGELMLAIWIGT  431



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score =   204 bits (520),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 142/165 (86%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVEQMQYL+VRVVKARDLP  DV+GSLD
Sbjct  232   DYALKETNPFLGGGQIVGGRVIRAEKPASTYDLVEQMQYLFVRVVKARDLPAMDVSGSLD  291

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNY+G T+HFEKK NPEWN+VFAFS++R+Q+S++EV+VKDKD VKDDFVG + 
Sbjct  292   PYVEVRVGNYRGITKHFEKKQNPEWNEVFAFSQDRMQSSVVEVVVKDKDLVKDDFVGLIR  351

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRLED+KGDK +  GELMLAVW+GT
Sbjct  352   FDLNDVPTRVPPDSPLAPEWYRLEDKKGDKRK--GELMLAVWIGT  394



>ref|XP_004235089.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=789

 Score =   203 bits (516),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 141/175 (81%), Gaps = 15/175 (9%)
 Frame = +2

Query  584   PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  730
             PQ+D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP
Sbjct  9     PQDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPP  68

Query  731   KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfv  907
               VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+++V +   +   
Sbjct  69    NPVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSVIDVFVRDKEMVQ  128

Query  908   kddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             +DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+G+ KVR  GE+MLAVWMGT
Sbjct  129   RDDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGESKVR--GEVMLAVWMGT  181



>ref|XP_010241420.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Nelumbo nucifera]
Length=1056

 Score =   204 bits (520),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             +ED+ LK+T P LG           GG ++GDK TSTYDLVEQM YLYVRVVKA++LP  
Sbjct  271   EEDYKLKDTSPQLGERWPSGGIRGGGGWMSGDKFTSTYDLVEQMYYLYVRVVKAKELPTN  330

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              + G+ DPY EV+LGNYKGTTRHFEKK+NPEWNQVFAFSKERIQ+S LEV +   +   +
Sbjct  331   SIAGNCDPYAEVKLGNYKGTTRHFEKKTNPEWNQVFAFSKERIQSSALEVFVKDKEMVAR  390

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++G+VVFDL+E+P RVPPDSPLAPQWYRLEDR+GD KV+  GE+MLAVWMGT
Sbjct  391   DDYLGKVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGDGKVK--GEIMLAVWMGT  442



>ref|XP_008775338.1| PREDICTED: uncharacterized protein LOC103695724 [Phoenix dactylifera]
Length=1003

 Score =   204 bits (518),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 140/165 (85%), Gaps = 9/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I G+K    YDLVE+MQYL+VRVVKARDLP KDVTGSLD
Sbjct  229   DFQLKETSPFLGGGRVVGGRVIHGEK-AGAYDLVEKMQYLFVRVVKARDLPAKDVTGSLD  287

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVRLGN+KG T+HFEKK NPEWN+VFAFS+ER+QAS LEV++KDKD VKDDFVG V 
Sbjct  288   PFVEVRLGNFKGITKHFEKKLNPEWNEVFAFSRERLQASFLEVVLKDKDLVKDDFVGIVR  347

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRLED+KGDK++  GELMLA+W GT
Sbjct  348   FDLNEVPTRVPPDSPLAPEWYRLEDKKGDKIK--GELMLAIWYGT  390



>emb|CDY13273.1| BnaC09g23830D [Brassica napus]
Length=462

 Score =   197 bits (502),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKLT-STYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET P+LGGG+      I  DK   STYDLVE+M +LYVRVVKAR+L
Sbjct  230   HSIASAQPADFALKETSPNLGGGRVVGGRVIHKDKTARSTYDLVERMYFLYVRVVKAREL  289

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEV++GNYKG TRHFEK+ +PEWNQVFAF+KER+QAS+LEV+VKDKD 
Sbjct  290   PIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASVLEVVVKDKDL  349

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD+++IP RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  350   LKDDYVGFVRFDINDIPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  402



>emb|CAN79812.1| hypothetical protein VITISV_018822 [Vitis vinifera]
Length=1020

 Score =   204 bits (518),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 133/165 (81%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  240   DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  299

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD +KDD VG   
Sbjct  300   PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFXR  359

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL ++P RVPPDSPLAP+WYR+ + KG+K    GELMLAVW GT
Sbjct  360   FDLSDVPTRVPPDSPLAPEWYRIANSKGEK--NNGELMLAVWYGT  402



>ref|XP_002271590.1| PREDICTED: uncharacterized protein LOC100253432 [Vitis vinifera]
Length=1018

 Score =   204 bits (518),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      DK  STYDLVEQM YL+VRVVKARDLP KDVTGSLD
Sbjct  238   DYQLKETSPILGGGQIVGGRVIRADKPASTYDLVEQMHYLFVRVVKARDLPTKDVTGSLD  297

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNYKG T+HFEK  NPEWN+VFAF+ +R+Q+S+LEV+VKDKD +KDD VG V 
Sbjct  298   PFVEVRVGNYKGITKHFEKNKNPEWNEVFAFAGDRMQSSVLEVVVKDKDMLKDDIVGFVR  357

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL ++P RVPPDSPLAP+WYR+ + KG+K    GELMLAVW GT
Sbjct  358   FDLSDVPTRVPPDSPLAPEWYRIANSKGEK--NNGELMLAVWYGT  400



>ref|XP_009339918.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Pyrus x bretschneideri]
Length=1011

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238   DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD +KDDFVG V 
Sbjct  298   PYVEVRIGNYRGITKHFEKQQNPTWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  357

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++   ELMLAVW+GT
Sbjct  358   FDINEVPMRVPPDSPLAPEWYRLEDKKGEKIK--SELMLAVWIGT  400



>ref|XP_008383982.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Malus domestica]
Length=1011

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  238   DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  297

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD +KDDFVG V 
Sbjct  298   PYVEVRIGNYRGITKHFEKQQNPTWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  357

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++   ELMLAVW+GT
Sbjct  358   FDINEVPMRVPPDSPLAPEWYRLEDKKGEKIK--SELMLAVWIGT  400



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  242   DYALKETSPFLGGGQIVGGRVIGGEKHASTYDLVERMQYLFVRVVKARDLPNMDITGSLD  301

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEK+ NPEWN VFAFS+ER+QAS++EV+VKDKD V+DDFVG V 
Sbjct  302   PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFSRERMQASVVEVLVKDKDLVRDDFVGMVR  361

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRL  + GDK R  GELMLAVW+GT
Sbjct  362   FDLNDVPVRVPPDSPLAPEWYRLVHKDGDKSR--GELMLAVWVGT  404



>ref|XP_004299880.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=1036

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 137/176 (78%), Gaps = 10/176 (6%)
 Frame = +2

Query  566   HKMQRPPQED--FMLKETKPHLGG------GKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             H  Q PP+++  F L ET P L        G  TGDK +STYDLVEQM YLYV VVKARD
Sbjct  254   HMQQGPPRQNPEFALVETSPPLAARLRYRPGGFTGDKTSSTYDLVEQMHYLYVSVVKARD  313

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkd  901
             LP  DV+GSLDPYVEV+LGNY+G T+H EK  NP W Q+FAFSKER+Q+++LEV VKDKD
Sbjct  314   LPTMDVSGSLDPYVEVKLGNYRGVTKHLEKNQNPVWKQIFAFSKERLQSNLLEVSVKDKD  373

Query  902   fvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             F KDD VGRV FDL E+P RVPPDSPLAPQWYRL D+KGDKVR  GE+MLAVWMGT
Sbjct  374   FGKDDHVGRVFFDLTEVPVRVPPDSPLAPQWYRLVDKKGDKVR--GEIMLAVWMGT  427



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 138/165 (84%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG+I G      +K  STYDLVE+MQYL+VRVVKARDLP  D+TGSLD
Sbjct  235   DYALKETSPFLGGGQIVGGRVIRGEKHASTYDLVERMQYLFVRVVKARDLPDMDITGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEK+ NPEWN VFAF+++R+QAS+LEV+VKDKD VKDDFVG V 
Sbjct  295   PFVEVRVGNYRGITKHFEKQRNPEWNAVFAFARDRMQASVLEVLVKDKDLVKDDFVGMVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+++P RVPPDSPLAP+WYRL  + GDK R  GELMLAVW+GT
Sbjct  355   FDLNDVPIRVPPDSPLAPEWYRLVHKSGDKSR--GELMLAVWVGT  397



>ref|XP_008795741.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Phoenix dactylifera]
Length=998

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 147/192 (77%), Gaps = 17/192 (9%)
 Frame = +2

Query  542   VVLWKKNNHKMQRPPQ-EDFMLKETKPHLG----------GG----KITGDKLTSTYDLV  676
             ++ + +  H   +P + E++ LK+T P LG          GG     + GDK TSTYDLV
Sbjct  222   IMTYHQVQHGQAQPSRGEEYKLKDTTPQLGERWPAGAHGRGGAWMTSLYGDKFTSTYDLV  281

Query  677   EQMQYLYVRVVKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKE  856
             EQM YLYVRVVKA+DLPP  +TGS DPY EV+LGNY+GTT+H+EK+++PEWNQVFAFSKE
Sbjct  282   EQMYYLYVRVVKAKDLPPNALTGSCDPYAEVKLGNYRGTTKHYEKRTHPEWNQVFAFSKE  341

Query  857   RIQASMLEV-IvkdkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRG  1033
             RIQ+++LEV +   +   +DD+VG+VVFDL+E+P RVPPDSPLAPQWYRLEDR+G+ V+ 
Sbjct  342   RIQSTVLEVFVKDREMVARDDYVGKVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGE-VKV  400

Query  1034  GGELMLAVWMGT  1069
              GE+MLAVWMGT
Sbjct  401   RGEIMLAVWMGT  412



>ref|XP_011022713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Populus euphratica]
Length=848

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D  LKET P LGGG++ G      DK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  76    DHALKETSPFLGGGRVVGGRVIRGDKTASTYDLVERMYFLYVRVVKARDLPAIDVTGSLD  135

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD VKDDFVG + 
Sbjct  136   PFVEVRVGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGVIK  195

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  196   FDINEVPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  238



>emb|CAB39932.1| putative phosphoribosylanthranilate transferase [Arabidopsis 
thaliana]
 emb|CAB78204.1| putative phosphoribosylanthranilate transferase [Arabidopsis 
thaliana]
Length=857

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKL-TSTYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET PHLGGG+      I  DK  TSTYDLVE+M +LYVRVVKAR+L
Sbjct  77    HSIASAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKAREL  136

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEVR+GNYKG TRHFEK+ +PEWNQVFAF+KER+QAS+LEV+VKDKD 
Sbjct  137   PIMDITGSVDPFVEVRVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASVLEVVVKDKDL  196

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD++++P RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  197   LKDDYVGFVRFDINDVPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  249



>ref|XP_009391825.1| PREDICTED: uncharacterized protein LOC103977897 [Musa acuminata 
subsp. malaccensis]
Length=1041

 Score =   203 bits (517),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 16/174 (9%)
 Frame = +2

Query  590   EDFMLKETKPHLG------------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             E++ LK+T P LG            G    GDKLTSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  255   EEYKLKDTSPQLGERWPHARRVGWMGMVGGGDKLTSTYDLVEQMSYLYVRVVKAKDLPPN  314

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV+LGNYKG T+HF+KKS+PEWNQ FAFSKERIQ+++LEV +   +   +
Sbjct  315   AITGSCDPYVEVKLGNYKGITKHFDKKSSPEWNQAFAFSKERIQSTVLEVYVKDKEVAAR  374

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRVVFDL+E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+MLAVWMGT
Sbjct  375   DDYIGRVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGDGKVR--GEIMLAVWMGT  426



>ref|XP_010434689.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010434697.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=1013

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKL-TSTYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET PHLGGG+      I  DK  TSTYDLVE+M +LYVRVVKAR+L
Sbjct  233   HSIASAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKAREL  292

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEV++GNYKG TRHFEK+ +PEWNQVFAF+KER+QASMLEV+VKDKD 
Sbjct  293   PIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASMLEVVVKDKDL  352

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD+++IP RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  353   LKDDYVGFVRFDINDIPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  405



>gb|KDO57729.1| hypothetical protein CISIN_1g003882mg [Citrus sinensis]
Length=789

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10    QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              V+GS DPYVEV+LGNYKG TRHFEKKSNPEW QVFAFSKE+IQ+S+LEV +   +   +
Sbjct  70    PVSGSCDPYVEVKLGNYKGKTRHFEKKSNPEWKQVFAFSKEKIQSSVLEVFVRDREIVGR  129

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+ D+ +  GE+MLAVW+GT
Sbjct  130   DDYIGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRDDR-KVKGEVMLAVWIGT  181



>ref|XP_010455572.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=1014

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKL-TSTYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET PHLGGG+      I  DK  TSTYDLVE+M +LYVRVVKAR+L
Sbjct  234   HSIASAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKAREL  293

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEV++GNYKG TRHFEK+ +PEWNQVFAF+KER+QASMLEV+VKDKD 
Sbjct  294   PIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASMLEVVVKDKDL  353

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD+++IP RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  354   LKDDYVGFVRFDINDIPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  406



>gb|KDO83484.1| hypothetical protein CISIN_1g001696mg [Citrus sinensis]
Length=1026

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 138/174 (79%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QE++ LK+T P LG            G ++G++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  241   QEEYNLKDTNPQLGERWPNGGGYGGRGWMSGERFTSTYDLVEQMSYLYVRVVKAKDLPPS  300

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV++GNYKG T+HFEK+ NPEWNQVFAFSKERIQ+SMLEV +   +   +
Sbjct  301   SITGSCDPYVEVKMGNYKGRTKHFEKRMNPEWNQVFAFSKERIQSSMLEVFLKDKEMVGR  360

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  G+ MLA+WMGT
Sbjct  361   DDYLGRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GQTMLAIWMGT  412



>ref|XP_012065512.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Jatropha curcas]
 gb|KDP43429.1| hypothetical protein JCGZ_16716 [Jatropha curcas]
Length=1030

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 137/174 (79%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  245   QDDYSLKDTNPQLGERWPAGGAFGGRGWMNSERYASTYDLVEQMSYLYVRVVKAKDLPPS  304

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV+LGNYKG TRHFEK+ NPEWNQVF+FSK+RIQ+S LEV +   +   +
Sbjct  305   SITGSCDPYVEVKLGNYKGRTRHFEKRMNPEWNQVFSFSKDRIQSSTLEVFVKDKEMLGR  364

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRVVFDL+EIP RVPPDSPLAPQWYRLEDR+G+ KVR  GE+M+AVWMGT
Sbjct  365   DDYLGRVVFDLNEIPTRVPPDSPLAPQWYRLEDRRGEGKVR--GEIMVAVWMGT  416



>ref|XP_008392066.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Malus domestica]
Length=795

 Score =   201 bits (511),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 139/176 (79%), Gaps = 15/176 (9%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  727
             P QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KA+DLP
Sbjct  7     PNQEDYKLKDTKPRLGERWPHGGVRGGGGWISSERATSTYDLVEQMFYLYVRVEKAKDLP  66

Query  728   PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdf  904
                VTGS DPY+EV+LGNYKG T+HFEKK+NPEW QVFAFSKE+IQ+S+LEV +   +  
Sbjct  67    TNPVTGSCDPYIEVKLGNYKGKTKHFEKKTNPEWKQVFAFSKEKIQSSILEVYVRDREMV  126

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
              +DD VG+VVFD++E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+MLAVWMGT
Sbjct  127   ARDDNVGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGDTKVR--GEVMLAVWMGT  180



>ref|XP_007040201.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOY24702.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1007

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGS+D
Sbjct  234   DFALKETSPFLGGGRVVGGRVIHGDKTASTYDLVERMHFLYVRVVKARELPAMDVTGSID  293

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+HFEKK NPEWNQVFAFS++R+QAS+LEV++KDKD VKDDFVG + 
Sbjct  294   PFVEVKVGNYKGITKHFEKKQNPEWNQVFAFSRDRMQASVLEVVIKDKDLVKDDFVGIIR  353

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD+ E+P RVPPDSPLAP+WYRL+D+KG+K++  GELMLAVW+GT
Sbjct  354   FDISEVPLRVPPDSPLAPEWYRLKDKKGEKIK--GELMLAVWIGT  396



>ref|XP_006289911.1| hypothetical protein CARUB_v10003526mg [Capsella rubella]
 gb|EOA22809.1| hypothetical protein CARUB_v10003526mg [Capsella rubella]
Length=1012

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKL-TSTYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET PHLGGG+      I  DK  TSTYDLVE+M +LYVRVVKAR+L
Sbjct  232   HSIASAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKAREL  291

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEV++GNYKG TRHFEK+ +PEWNQVFAF+KER+QASMLEV+VKDKD 
Sbjct  292   PIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASMLEVVVKDKDL  351

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD++++P RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  352   LKDDYVGFVRFDINDVPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  404



>ref|NP_192898.2| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAO64141.1| unknown protein [Arabidopsis thaliana]
 gb|AAP40420.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00585.1| phosphoribosylanthranilate transferase like protein [Arabidopsis 
thaliana]
 gb|AEE83030.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Arabidopsis thaliana]
Length=1011

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +2

Query  566   HKMQRPPQEDFMLKETKPHLGGGK------ITGDKL-TSTYDLVEQMQYLYVRVVKARDL  724
             H +      DF LKET PHLGGG+      I  DK  TSTYDLVE+M +LYVRVVKAR+L
Sbjct  231   HSIASAQPADFALKETSPHLGGGRVVGGRVIHKDKTATSTYDLVERMYFLYVRVVKAREL  290

Query  725   PPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdf  904
             P  D+TGS+DP+VEVR+GNYKG TRHFEK+ +PEWNQVFAF+KER+QAS+LEV+VKDKD 
Sbjct  291   PIMDITGSVDPFVEVRVGNYKGITRHFEKRQHPEWNQVFAFAKERMQASVLEVVVKDKDL  350

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +KDD+VG V FD++++P RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  351   LKDDYVGFVRFDINDVPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  403



>ref|XP_011022711.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Populus euphratica]
 ref|XP_011022712.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Populus euphratica]
Length=1009

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D  LKET P LGGG++ G      DK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  237   DHALKETSPFLGGGRVVGGRVIRGDKTASTYDLVERMYFLYVRVVKARDLPAIDVTGSLD  296

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD VKDDFVG + 
Sbjct  297   PFVEVRVGNYRGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGVIK  356

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAPQWYRLED+KG+K++  GELMLAVW+GT
Sbjct  357   FDINEVPLRVPPDSPLAPQWYRLEDKKGEKIK--GELMLAVWIGT  399



>ref|XP_008238857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238859.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238860.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=1005

 Score =   202 bits (514),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  233   DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  292

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD +KDDFVG V 
Sbjct  293   PFVEVRIGNYRGITKHFEKQQNPVWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  352

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++   ELMLAVW+GT
Sbjct  353   FDINEVPLRVPPDSPLAPEWYRLEDKKGEKIK--SELMLAVWIGT  395



>ref|XP_007210407.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
 gb|EMJ11606.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
Length=1005

 Score =   202 bits (513),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P+LGGG+      I GDK  STYDLVE+M +LYVRVVKAR+LP  DVTGSLD
Sbjct  233   DFALKETSPYLGGGRVVGGRVIHGDKTASTYDLVERMYFLYVRVVKARELPAMDVTGSLD  292

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY+G T+HFEK+ NP WNQVFAFSK+R+QAS+LEV++KDKD +KDDFVG V 
Sbjct  293   PFVEVRIGNYRGITKHFEKQQNPVWNQVFAFSKDRMQASVLEVVIKDKDLIKDDFVGLVR  352

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++   ELMLAVW+GT
Sbjct  353   FDINEVPLRVPPDSPLAPEWYRLEDKKGEKIK--SELMLAVWIGT  395



>ref|XP_006437049.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
 ref|XP_006485020.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR50289.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
Length=789

 Score =   200 bits (509),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRV KARDLP  
Sbjct  10    QEDYKLKDTKPQLGERWPHGGIRGAGGWISSERATSTYDLVEQMFYLYVRVEKARDLPTN  69

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              ++GS DPYVEV+LGNYKG TRHFEKKSNPEW QVFAFSKE+IQ+S+LEV +   +   +
Sbjct  70    PMSGSCDPYVEVKLGNYKGKTRHFEKKSNPEWKQVFAFSKEKIQSSVLEVFVRDREIVGR  129

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+ D+ +  GE+MLAVW+GT
Sbjct  130   DDYIGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRDDR-KVKGEVMLAVWIGT  181



>ref|XP_002513191.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF49182.1| synaptotagmin, putative [Ricinus communis]
Length=1049

 Score =   202 bits (513),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----GGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             Q+D+ LK+T P LG     GG   G      ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  264   QDDYTLKDTNPQLGERWPAGGAYGGRGWMHSERYASTYDLVEQMSYLYVRVVKAKDLPPS  323

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              +TGS DPYVEV+LGNY+G ++HFEKK NPEWNQVFAFSK+RIQ+SMLEV +   + F +
Sbjct  324   SITGSCDPYVEVKLGNYRGRSKHFEKKMNPEWNQVFAFSKDRIQSSMLEVFVKDKEMFGR  383

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++GRVVFDL+EIP RVPPDSPLAPQWYRLEDR+G+ KVR  G++MLAVWMGT
Sbjct  384   DDYLGRVVFDLNEIPTRVPPDSPLAPQWYRLEDRRGEGKVR--GDVMLAVWMGT  435



>ref|XP_009386055.1| PREDICTED: uncharacterized protein LOC103973268 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386056.1| PREDICTED: uncharacterized protein LOC103973268 [Musa acuminata 
subsp. malaccensis]
Length=1010

 Score =   201 bits (512),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 140/165 (85%), Gaps = 9/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P LGGG+      I GDK    +DLVE+M+YL+VRVVKAR+LP KD+TGSLD
Sbjct  237   DFQLKETSPSLGGGRIIGGRMIPGDK-AGAFDLVEKMEYLFVRVVKARELPAKDITGSLD  295

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVRLGNYKGTTRHFEK  +PEWNQVFAF++ER+QAS +EV++KDKD VKDDFVG V 
Sbjct  296   PFVEVRLGNYKGTTRHFEKNQSPEWNQVFAFARERVQASFMEVVLKDKDLVKDDFVGLVR  355

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL+E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW GT
Sbjct  356   FDLNEVPSRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWYGT  398



>ref|XP_010113221.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC74799.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=796

 Score =   200 bits (508),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D+ LKET P LGGG++ G      DK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  23    DYALKETSPFLGGGRVVGGRVIRGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  82

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEV++GNYKG T+HFE + NPEWNQVFAFSK+R+QAS+LEV++KDKD VKDDFVG V 
Sbjct  83    PFVEVKIGNYKGITKHFEHRQNPEWNQVFAFSKDRMQASVLEVVIKDKDLVKDDFVGIVR  142

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++EIP RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  143   FDINEIPLRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  185



>ref|XP_010111400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30878.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=787

 Score =   199 bits (507),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 141/178 (79%), Gaps = 15/178 (8%)
 Frame = +2

Query  575   QRPPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARD  721
             Q  P+ED+ LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA++
Sbjct  4     QAAPKEDYKLKDTKPQLGERWPHGGLRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKN  63

Query  722   LPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdk  898
             LP   VTG+ DPYVEV+LGNYKG T+HFEKK+NPEWNQVFAFSKE+IQ+S++EV +   +
Sbjct  64    LPTNPVTGNCDPYVEVKLGNYKGKTKHFEKKTNPEWNQVFAFSKEKIQSSVVEVYVRDRE  123

Query  899   dfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
                +DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR  D KVR  GE+MLAVWMGT
Sbjct  124   MVSRDDYIGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRHSDAKVR--GEVMLAVWMGT  179



>ref|XP_006598248.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=810

 Score =   200 bits (508),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 12/170 (7%)
 Frame = +2

Query  590   EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  29    EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  88

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfv-kddfv  922
             S DPYVEV+LGNYKG T+H EKK+NPEWNQV+AFSK+RIQ+S+LEVIVKDK+ + +DD++
Sbjct  89    SCDPYVEVKLGNYKGRTKHIEKKTNPEWNQVYAFSKDRIQSSVLEVIVKDKEMLGRDDYI  148

Query  923   grvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             GRV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  G++MLAVWMGT
Sbjct  149   GRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GDIMLAVWMGT  196



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score =   201 bits (511),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 133/165 (81%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKIT------GDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             ++ LKET P LGGG++        DK  STYDLVE MQ+L+VRVVKARDLP KDVTGSLD
Sbjct  235   EYALKETSPVLGGGQVVQGRVIRADKPASTYDLVEPMQFLFVRVVKARDLPSKDVTGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             PYVEVR+GNY+G T HFEK+ NPEWN VFAF+K+RIQ+S +EV+VKDKD +KDDFVG + 
Sbjct  295   PYVEVRVGNYRGVTSHFEKRQNPEWNAVFAFAKDRIQSSFVEVVVKDKDMLKDDFVGMIR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FDL E+P RVPPDSPLAP+WY LE + G K +  GELMLAVWMGT
Sbjct  355   FDLQEVPMRVPPDSPLAPEWYHLESKNGKKKK--GELMLAVWMGT  397



>ref|XP_011093374.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Sesamum indicum]
Length=1014

 Score =   201 bits (511),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 19/183 (10%)
 Frame = +2

Query  572   MQRP--------PQEDFMLKETKPHLG-----GGK--ITGDKLTSTYDLVEQMQYLYVRV  706
             MQRP         ++DF +KE  P LG     GG+  ++G+++T+T+DLVEQ  YLYVRV
Sbjct  222   MQRPISLQARASNEDDFEVKEANPQLGEHWPNGGRGWMSGERMTNTFDLVEQAFYLYVRV  281

Query  707   VKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-  883
             VKA+DLPP  +T S DPYVEV+LGNYKG TRH ++K+NPEWNQVFAFSKERIQ+S+LEV 
Sbjct  282   VKAKDLPPSSITASCDPYVEVKLGNYKGRTRHLDRKTNPEWNQVFAFSKERIQSSVLEVF  341

Query  884   IvkdkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVW  1060
             +   +   +DD++G VVFDL+E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+M+AVW
Sbjct  342   VKDKEMVGRDDYLGWVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGDGKVR--GEIMVAVW  399

Query  1061  MGT  1069
             MGT
Sbjct  400   MGT  402



>ref|XP_011093373.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Sesamum indicum]
Length=1038

 Score =   201 bits (511),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 19/183 (10%)
 Frame = +2

Query  572   MQRP--------PQEDFMLKETKPHLG-----GGK--ITGDKLTSTYDLVEQMQYLYVRV  706
             MQRP         ++DF +KE  P LG     GG+  ++G+++T+T+DLVEQ  YLYVRV
Sbjct  246   MQRPISLQARASNEDDFEVKEANPQLGEHWPNGGRGWMSGERMTNTFDLVEQAFYLYVRV  305

Query  707   VKARDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-  883
             VKA+DLPP  +T S DPYVEV+LGNYKG TRH ++K+NPEWNQVFAFSKERIQ+S+LEV 
Sbjct  306   VKAKDLPPSSITASCDPYVEVKLGNYKGRTRHLDRKTNPEWNQVFAFSKERIQSSVLEVF  365

Query  884   IvkdkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVW  1060
             +   +   +DD++G VVFDL+E+P RVPPDSPLAPQWYRLEDR+GD KVR  GE+M+AVW
Sbjct  366   VKDKEMVGRDDYLGWVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGDGKVR--GEIMVAVW  423

Query  1061  MGT  1069
             MGT
Sbjct  424   MGT  426



>gb|KHN49030.1| Putative Ras GTPase-activating protein 4B [Glycine soja]
Length=796

 Score =   199 bits (507),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 12/170 (7%)
 Frame = +2

Query  590   EDFMLKETKPHLGG--------GKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTG  745
             ED+ L+ET P LGG        G I G++ +STYDLVEQM YLYVRVVKA+DL P  +T 
Sbjct  15    EDYNLRETDPQLGGDRWPNARRGWIGGERFSSTYDLVEQMFYLYVRVVKAKDLSPSTLTS  74

Query  746   SLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfv-kddfv  922
             S DPYVEV+LGNYKG T+H EKK+NPEWNQV+AFSK+RIQ+S+LEVIVKDK+ + +DD++
Sbjct  75    SCDPYVEVKLGNYKGRTKHIEKKTNPEWNQVYAFSKDRIQSSVLEVIVKDKEMLGRDDYI  134

Query  923   grvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             GRV FDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  G++MLAVWMGT
Sbjct  135   GRVAFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GDIMLAVWMGT  182



>ref|XP_004497937.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=798

 Score =   199 bits (507),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 141/179 (79%), Gaps = 13/179 (7%)
 Frame = +2

Query  569   KMQRPPQEDFMLKETKPHLG-----GGK------ITGDKLTSTYDLVEQMQYLYVRVVKA  715
             K  +P Q+D+ LK+TKP LG     GG+      I  ++ TSTYDLVEQM YLYVRVVKA
Sbjct  6     KDSKPNQDDYKLKDTKPELGEKWPHGGQRGGTGWIYTERATSTYDLVEQMFYLYVRVVKA  65

Query  716   RDLPPKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivk  892
             ++LPP  VTG++DPYVEV++GNYKG TRHFEKK+NPEW QVFAFSKE+IQ+S++EV +  
Sbjct  66    KELPPNPVTGNVDPYVEVKVGNYKGKTRHFEKKTNPEWKQVFAFSKEKIQSSIVEVFVRD  125

Query  893   dkdfvkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
              +   +DD++G+V FD+HE+P RVPPDSPLAPQWYRLE+ +G+  R  GE+MLAVW+GT
Sbjct  126   KEMVARDDYIGKVEFDMHEVPTRVPPDSPLAPQWYRLENLRGE-TRTRGEVMLAVWIGT  183



>ref|XP_007158492.1| hypothetical protein PHAVU_002G157000g [Phaseolus vulgaris]
 gb|ESW30486.1| hypothetical protein PHAVU_002G157000g [Phaseolus vulgaris]
Length=1008

 Score =   201 bits (511),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 141/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGK------ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             DF LKET P+LGGG+      I  DK  STYDLVE+M +LYVRVVKAR+LP  D+TGSLD
Sbjct  235   DFALKETSPYLGGGRVVGGRVIHKDKTDSTYDLVERMYFLYVRVVKARELPTMDITGSLD  294

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNYKG TRHF+K  +PEWNQVFAFSKER+QAS+L+V++KDKD +KDDFVG V 
Sbjct  295   PFVEVRIGNYKGITRHFDKNQSPEWNQVFAFSKERMQASILDVVIKDKDLIKDDFVGIVR  354

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  355   FDINEVPLRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  397



>ref|XP_011025029.1| PREDICTED: uncharacterized protein LOC105126018 isoform X2 [Populus 
euphratica]
Length=897

 Score =   200 bits (508),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 137/173 (79%), Gaps = 15/173 (9%)
 Frame = +2

Query  590   EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  736
             +DF LK+T P LG         GG+  + G++  STYDLVEQ+ YLYVR+VKA+DLP   
Sbjct  268   DDFNLKDTDPQLGELWPSGGAYGGRGWMNGERYASTYDLVEQVSYLYVRIVKAKDLPSSS  327

Query  737   VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvkd  913
             +T S DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSK+RIQ+S+LEV +   +   +D
Sbjct  328   ITASCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKDRIQSSVLEVFVKDKEMVGRD  387

Query  914   dfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             D++GRVVFDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  GE+MLAVWMGT
Sbjct  388   DYLGRVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GEIMLAVWMGT  438



>ref|XP_010534658.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=749

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+ KP LG            G I+ ++  STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  10    QEDYKLKDMKPELGERWPHGGLRGGSGWISSERAASTYDLVEQMFYLYVRVVKAKDLPPN  69

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTG+ DPYV+V+LGNYKG T+HFEK++NPEWNQVFAFSK++IQ+S++EV +   +   +
Sbjct  70    PVTGNCDPYVDVKLGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSVVEVFVRDKEMVTR  129

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+G+  +  GE+MLAVWMGT
Sbjct  130   DDYIGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGES-KKKGEIMLAVWMGT  181



>emb|CAN75086.1| hypothetical protein VITISV_010815 [Vitis vinifera]
Length=794

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+T P LG           GG I+ D++TSTYDLVEQM YLYVRVVKA+DLP  
Sbjct  8     QEDYKLKDTHPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKAKDLPTN  67

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTG  DPYVEV+LGNYKG T HFEKK+NPEW+QVFAFSK++IQ+S+LEV + +     +
Sbjct  68    AVTGGCDPYVEVKLGNYKGKTMHFEKKTNPEWHQVFAFSKDKIQSSVLEVYVRERDMVSR  127

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+GD  +  GE+MLAVWMGT
Sbjct  128   DDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGDS-KVKGEVMLAVWMGT  179



>ref|XP_002277970.2| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=794

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+T P LG           GG I+ D++TSTYDLVEQM YLYVRVVKA+DLP  
Sbjct  8     QEDYKLKDTHPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKAKDLPTN  67

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTG  DPYVEV+LGNYKG T HFEKK+NPEW+QVFAFSK++IQ+S+LEV + +     +
Sbjct  68    AVTGGCDPYVEVKLGNYKGKTMHFEKKTNPEWHQVFAFSKDKIQSSVLEVYVRERDMVSR  127

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+GD  +  GE+MLAVWMGT
Sbjct  128   DDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGDS-KVKGEVMLAVWMGT  179



>ref|XP_009763246.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
 ref|XP_009763247.1| PREDICTED: uncharacterized protein LOC104215187 [Nicotiana sylvestris]
Length=785

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4     EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+LEV +   +   +
Sbjct  64    PVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSILEVFVRDKEMVQR  123

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRL DR+G+ KVR  GE+MLAVWMGT
Sbjct  124   DDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLVDRRGESKVR--GEVMLAVWMGT  175



>ref|XP_009611365.1| PREDICTED: uncharacterized protein LOC104104885 [Nicotiana tomentosiformis]
Length=785

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             ++D+  KETKP LG           GG I+ D++TSTYDLVEQM +LYVRVVKARDLPP 
Sbjct  4     EDDYKAKETKPQLGERWPHGGFRGGGGWISSDRVTSTYDLVEQMHFLYVRVVKARDLPPN  63

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTGS DPYVEV+LGNYKG T+HF+KK NPEW QVFAFSKE+IQ+S+LEV +   +   +
Sbjct  64    PVTGSCDPYVEVKLGNYKGKTKHFDKKVNPEWKQVFAFSKEKIQSSILEVFVRDKEMVQR  123

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD++G+VVFD++E+P RVPPDSPLAPQWYRL DR+G+ KVR  GE+MLAVWMGT
Sbjct  124   DDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLVDRRGESKVR--GEVMLAVWMGT  175



>ref|XP_011078852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Sesamum indicum]
Length=789

 Score =   199 bits (505),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 139/174 (80%), Gaps = 13/174 (7%)
 Frame = +2

Query  584   PQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPP  730
             PQ+D+ +K+TKP LG           GG I+ D++TSTYDLVEQM YLYVRVVKARDLP 
Sbjct  6     PQDDYKIKDTKPQLGERWPHGGVRGGGGWISSDRVTSTYDLVEQMYYLYVRVVKARDLPT  65

Query  731   KDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfv  907
               VTGS DPYVEV+LGNYKG T+HFEKK NPEWNQVFAF+K++IQ++ LEV +   +   
Sbjct  66    NPVTGSCDPYVEVKLGNYKGKTQHFEKKMNPEWNQVFAFAKDKIQSTDLEVFVRDREMVG  125

Query  908   kddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             +DD++G+VVFD++E+P RVPPDSPLAPQWYRLEDR+G+  +  GE+MLAVWMGT
Sbjct  126   RDDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRRGES-KLKGEVMLAVWMGT  178



>ref|XP_011007360.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Populus euphratica]
Length=1052

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 15/173 (9%)
 Frame = +2

Query  590   EDFMLKETKPHLG---------GGK--ITGDKLTSTYDLVEQMQYLYVRVVKARDLPPKD  736
             +DF LK+T P LG         GG+  + G++  ST+DLVEQM YLYVRVVKA+DLPP  
Sbjct  268   DDFDLKDTNPKLGERWPSGGAYGGRGWMNGERYASTFDLVEQMSYLYVRVVKAKDLPPSP  327

Query  737   VTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvkd  913
             +TGS DPYVEV+LGNYKG TRHFEKK NPEWNQVFAFSKER+Q+ +LEV +   +   +D
Sbjct  328   ITGSCDPYVEVKLGNYKGRTRHFEKKMNPEWNQVFAFSKERMQSLVLEVFVKDKEMVGRD  387

Query  914   dfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             D++GRVVFDL+E+P RVPPDSPLAPQWYRLEDR+G+ KVR  GE+MLAVWMGT
Sbjct  388   DYLGRVVFDLNEVPTRVPPDSPLAPQWYRLEDRRGEGKVR--GEIMLAVWMGT  438



>ref|XP_003518076.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
 gb|KHM98983.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=796

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+TKP LG            G I  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  12    QEDYKLKDTKPELGEKWPHGGQRGGSGWIYNERATSTYDLVEQMFYLYVRVVKAKDLPPN  71

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VT ++DPYVEV++GNYKG TRHFEKK++PEW QVFAFSKE+IQ+S++EV +   +   +
Sbjct  72    PVTSNVDPYVEVKVGNYKGKTRHFEKKTSPEWKQVFAFSKEKIQSSVVEVFVRDKEMVAR  131

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+V FD+HE+P RVPPDSPLAPQWYRLE+ +G+  R  GE+MLAVWMGT
Sbjct  132   DDYIGKVEFDIHEVPTRVPPDSPLAPQWYRLENLRGE-ARSRGEIMLAVWMGT  183



>ref|XP_007145658.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
 gb|ESW17652.1| hypothetical protein PHAVU_007G257600g [Phaseolus vulgaris]
Length=796

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+TKP LG            G +  ++ TSTYDLVEQM YLYVRVVKA+DLPP 
Sbjct  11    QEDYKLKDTKPDLGERWPHGGQRGGSGWLYSERATSTYDLVEQMFYLYVRVVKAKDLPPN  70

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VT +LDPYVEV++GNYKG TRHFEKK++PEW QVFAFSKE+IQ+S++EV +   +   +
Sbjct  71    PVTSNLDPYVEVKVGNYKGKTRHFEKKTSPEWKQVFAFSKEKIQSSVVEVFVRDKEMVAR  130

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+V FD+HE+P RVPPDSPLAPQWYRLE+ +G+  R  GE+MLAVWMGT
Sbjct  131   DDYIGKVEFDMHEVPTRVPPDSPLAPQWYRLENLRGE-ARSRGEIMLAVWMGT  182



>ref|XP_008387247.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
 ref|XP_008387248.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=795

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 138/176 (78%), Gaps = 15/176 (9%)
 Frame = +2

Query  581   PPQEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLP  727
             P QED+ LK+TKP LG           GG I+ D+ TSTYDLVEQM YLYVRV KA+DLP
Sbjct  7     PNQEDYKLKDTKPQLGERWPHGGLRGGGGWISSDRATSTYDLVEQMFYLYVRVEKAKDLP  66

Query  728   PKDVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdf  904
                VTGS DPYV+V+LGNYKG T+HFEKK+NPEW +VFAF+KE+IQ+S+LEV +      
Sbjct  67    TNPVTGSCDPYVQVKLGNYKGKTKHFEKKTNPEWKEVFAFAKEKIQSSVLEVYVKDKGMV  126

Query  905   vkddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
              +DD+VG+VVFD+HE+P RVPPDSPLAPQWYRLEDR+ D KVR  GE+MLAVWMGT
Sbjct  127   ARDDYVGKVVFDMHEVPTRVPPDSPLAPQWYRLEDRRRDTKVR--GEVMLAVWMGT  180



>ref|XP_002303582.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE78561.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1009

 Score =   200 bits (509),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 140/165 (85%), Gaps = 8/165 (5%)
 Frame = +2

Query  593   DFMLKETKPHLGGGKITG------DKLTSTYDLVEQMQYLYVRVVKARDLPPKDVTGSLD  754
             D  LKET P LGGG++ G      DK  STYDLVE+M +LYVRVVKARDLP  DVTGSLD
Sbjct  237   DHALKETSPFLGGGRVVGGRVIRGDKTASTYDLVERMYFLYVRVVKARDLPAMDVTGSLD  296

Query  755   PYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEVIvkdkdfvkddfvgrvv  934
             P+VEVR+GNY G T+HFEKK NPEWNQVFAFS+ER+QAS+LEV++KDKD VKDDFVG + 
Sbjct  297   PFVEVRVGNYGGITKHFEKKQNPEWNQVFAFSRERMQASVLEVVIKDKDLVKDDFVGVIR  356

Query  935   fdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             FD++E+P RVPPDSPLAP+WYRLED+KG+K++  GELMLAVW+GT
Sbjct  357   FDINEVPSRVPPDSPLAPEWYRLEDKKGEKIK--GELMLAVWIGT  399



>ref|XP_003537180.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=797

 Score =   199 bits (505),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+TKP LG            G I  ++ TSTYD+VEQM YLYVRVVKA+DLPP 
Sbjct  12    QEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATSTYDMVEQMFYLYVRVVKAKDLPPN  71

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VT ++DPYVEV++GNYKG TRHFEKK++PEW QVFAFSKE+IQ+S++EV +   +   +
Sbjct  72    PVTSNVDPYVEVKVGNYKGKTRHFEKKTSPEWKQVFAFSKEKIQSSVVEVFVRDKEMVAR  131

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+V FD+HE+P RVPPDSPLAPQWYRLE+ +G+  R  GE+MLAVWMGT
Sbjct  132   DDYIGKVEFDMHEVPTRVPPDSPLAPQWYRLENSRGE-ARSRGEIMLAVWMGT  183



>emb|CDY70344.1| BnaA03g55080D, partial [Brassica napus]
Length=504

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             QED+ LK+ KP LG            G I+ +++ STYDLVEQM YLYVRVVKA+DLPP 
Sbjct  9     QEDYKLKDMKPDLGEKWPHGGQRGGSGWISSERVASTYDLVEQMFYLYVRVVKAKDLPPN  68

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VT + DPYVEV++GNYKG T+HFEK++NPEWNQVFAFSK++IQ+S +EV +   +   +
Sbjct  69    PVTSNCDPYVEVKIGNYKGKTKHFEKRTNPEWNQVFAFSKDKIQSSTVEVFVRDKEMVTR  128

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGDKVRGGGELMLAVWMGT  1069
             DD++G+VVFD+HEIP RVPPDSPLAPQWYRLE R+G+  +  GE+M+AVW+GT
Sbjct  129   DDYIGKVVFDMHEIPTRVPPDSPLAPQWYRLEARRGE-AKKRGEVMVAVWLGT  180



>ref|XP_011033255.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=796

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 141/174 (81%), Gaps = 15/174 (9%)
 Frame = +2

Query  587   QEDFMLKETKPHLG-----------GGKITGDKLTSTYDLVEQMQYLYVRVVKARDLPPK  733
             ++DF LK+TKP LG           GG I+ ++ TSTYDLVEQM YLYVRVVKA+DLP  
Sbjct  10    KDDFKLKDTKPQLGERWPHGGPRGGGGWISSERATSTYDLVEQMFYLYVRVVKAKDLPTN  69

Query  734   DVTGSLDPYVEVRLGNYKGTTRHFEKKSNPEWNQVFAFSKERIQASMLEV-Ivkdkdfvk  910
              VTGSLDPY+EV++GNY+G T+HFEKK+NPEWNQVFAFSKE+IQ+S++EV +   +  ++
Sbjct  70    PVTGSLDPYIEVKVGNYRGKTQHFEKKTNPEWNQVFAFSKEKIQSSVVEVFLRDREMVLR  129

Query  911   ddfvgrvvfdLHEIPKRVPPDSPLAPQWYRLEDRKGD-KVRGGGELMLAVWMGT  1069
             DD+VG+VVFD+HE+P RVPPDSPLAPQWYRLE R GD KVR  GE+MLAVWMGT
Sbjct  130   DDYVGKVVFDMHEVPTRVPPDSPLAPQWYRLEGRSGDRKVR--GEVMLAVWMGT  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2788341287920