BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6221

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46296.1|  cytochrome P450                                        280   3e-87   Ipomoea nil [qian niu]
emb|CDP22261.1|  unnamed protein product                                232   1e-72   Coffea canephora [robusta coffee]
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               241   2e-72   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               240   2e-72   Solanum lycopersicum
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               238   1e-71   Nicotiana sylvestris
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               238   1e-71   Nicotiana tomentosiformis
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               238   2e-71   Nicotiana tomentosiformis
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               238   3e-71   Solanum tuberosum [potatoes]
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               237   6e-71   Solanum tuberosum [potatoes]
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               236   9e-71   
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               236   1e-70   Solanum lycopersicum
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               234   3e-70   Sesamum indicum [beniseed]
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               234   5e-70   Nicotiana sylvestris
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                232   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               229   4e-68   Nicotiana tomentosiformis
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                228   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               226   1e-66   Nicotiana sylvestris
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                224   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               225   2e-66   Nicotiana tomentosiformis
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               224   2e-66   
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               225   2e-66   Nicotiana tomentosiformis
gb|EPS60789.1|  hypothetical protein M569_14012                         223   7e-66   Genlisea aurea
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               221   1e-64   Nicotiana tomentosiformis
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               213   7e-62   Solanum lycopersicum
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               213   9e-62   
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               211   3e-61   Solanum tuberosum [potatoes]
gb|EPS65366.1|  hypothetical protein M569_09411                         211   5e-61   Genlisea aurea
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               209   6e-61   Solanum tuberosum [potatoes]
gb|AJD25225.1|  cytochrome P450 CYP96A85                                210   6e-61   Salvia miltiorrhiza [Chinese salvia]
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                206   5e-59   Erythranthe guttata [common monkey flower]
gb|AEI59774.1|  cytochrome P450                                         201   2e-57   Helianthus annuus
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                192   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               191   2e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                184   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    186   2e-51   Brassica rapa
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    184   4e-51   Vitis vinifera
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    184   7e-51   Arabis alpina [alpine rockcress]
emb|CDY46088.1|  BnaA09g42120D                                          184   9e-51   Brassica napus [oilseed rape]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               183   1e-50   Nicotiana tomentosiformis
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             183   1e-50   
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    183   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               182   3e-50   Nicotiana tomentosiformis
ref|XP_002878665.1|  CYP96A1                                            182   3e-50   
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               181   5e-50   Nicotiana sylvestris
ref|XP_010680694.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    176   7e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               179   2e-49   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX76867.1|  BnaC08g34530D                                          179   4e-49   
ref|XP_010027332.1|  PREDICTED: cytochrome P450 86B1-like               173   6e-49   Eucalyptus grandis [rose gum]
gb|EPS60696.1|  hypothetical protein M569_14105                         177   1e-48   Genlisea aurea
ref|XP_006374652.1|  cytochrome P450 family protein                     177   2e-48   
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    177   2e-48   
gb|EYU41727.1|  hypothetical protein MIMGU_mgv1a023193mg                175   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         177   2e-48   
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               177   2e-48   Phoenix dactylifera
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               177   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    177   3e-48   
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               176   4e-48   Nicotiana sylvestris
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    176   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               176   5e-48   Nicotiana tomentosiformis
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    176   5e-48   Arabis alpina [alpine rockcress]
ref|XP_010419318.1|  PREDICTED: cytochrome P450 86B1-like               173   5e-48   
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               175   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               176   7e-48   Camelina sativa [gold-of-pleasure]
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                176   7e-48   Erythranthe guttata [common monkey flower]
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               176   8e-48   Tarenaya hassleriana [spider flower]
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    176   9e-48   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                174   1e-47   Erythranthe guttata [common monkey flower]
gb|KDO37445.1|  hypothetical protein CISIN_1g036716mg                   167   1e-47   Citrus sinensis [apfelsine]
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               175   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               175   1e-47   Sesamum indicum [beniseed]
ref|XP_002866853.1|  CYP96A10                                           175   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               174   2e-47   Nicotiana sylvestris
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             174   2e-47   Capsella rubella
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               174   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               174   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             174   3e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               173   5e-47   Eucalyptus grandis [rose gum]
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    173   5e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53179.1|  BnaA06g40580D                                          173   7e-47   Brassica napus [oilseed rape]
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             173   7e-47   Capsella rubella
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               173   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    173   8e-47   Brassica rapa
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               174   9e-47   Tarenaya hassleriana [spider flower]
emb|CDY53181.1|  BnaA06g40600D                                          173   9e-47   Brassica napus [oilseed rape]
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             173   9e-47   Citrus clementina [clementine]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               172   1e-46   Populus euphratica
ref|XP_010472325.1|  PREDICTED: cytochrome P450 86B1-like               167   2e-46   
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    171   2e-46   Arabis alpina [alpine rockcress]
emb|CDX72698.1|  BnaC07g47200D                                          171   3e-46   
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             171   3e-46   Capsella rubella
emb|CDX72695.1|  BnaC07g47170D                                          171   3e-46   
gb|KDO55118.1|  hypothetical protein CISIN_1g036278mg                   167   3e-46   Citrus sinensis [apfelsine]
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                171   3e-46   Erythranthe guttata [common monkey flower]
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               171   3e-46   Populus euphratica
gb|KDO37689.1|  hypothetical protein CISIN_1g047842mg                   170   4e-46   Citrus sinensis [apfelsine]
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               171   4e-46   
ref|XP_010027235.1|  PREDICTED: cytochrome P450 86B1-like               164   4e-46   Eucalyptus grandis [rose gum]
ref|XP_002521474.1|  cytochrome P450, putative                          171   4e-46   Ricinus communis
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               171   4e-46   Sesamum indicum [beniseed]
emb|CDP04331.1|  unnamed protein product                                170   5e-46   Coffea canephora [robusta coffee]
ref|XP_002878579.1|  CYP96A5                                            171   5e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    171   6e-46   Brassica rapa
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               171   6e-46   
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             170   8e-46   Eutrema salsugineum [saltwater cress]
ref|XP_012075244.1|  PREDICTED: alkane hydroxylase MAH1                 169   1e-45   Jatropha curcas
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             170   1e-45   Eutrema salsugineum [saltwater cress]
ref|XP_002529227.1|  cytochrome P450, putative                          169   2e-45   Ricinus communis
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    169   2e-45   Vitis vinifera
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             169   2e-45   
gb|KCW62188.1|  hypothetical protein EUGRSUZ_H04845                     167   2e-45   Eucalyptus grandis [rose gum]
emb|CAB44684.1|  cytochrome P450-like protein                           168   3e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             169   3e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               169   3e-45   Eucalyptus grandis [rose gum]
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                167   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               168   4e-45   Eucalyptus grandis [rose gum]
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               168   4e-45   Brassica rapa
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               168   4e-45   Eucalyptus grandis [rose gum]
emb|CDY27160.1|  BnaA08g07980D                                          168   5e-45   Brassica napus [oilseed rape]
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    168   5e-45   Brassica rapa
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               168   6e-45   Nicotiana sylvestris
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               167   7e-45   
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             167   1e-44   
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                167   1e-44   Erythranthe guttata [common monkey flower]
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     167   2e-44   Eucalyptus grandis [rose gum]
emb|CAN80536.1|  hypothetical protein VITISV_035975                     166   2e-44   Vitis vinifera
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             166   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             166   2e-44   Phaseolus vulgaris [French bean]
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               166   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    166   2e-44   Solanum lycopersicum
emb|CDP18605.1|  unnamed protein product                                165   2e-44   Coffea canephora [robusta coffee]
emb|CDY70656.1|  BnaAnng34510D                                          161   3e-44   Brassica napus [oilseed rape]
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             166   3e-44   
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               166   4e-44   Glycine max [soybeans]
emb|CDY53177.1|  BnaA06g40560D                                          166   4e-44   Brassica napus [oilseed rape]
emb|CDY53182.1|  BnaA06g40610D                                          165   4e-44   Brassica napus [oilseed rape]
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               165   5e-44   Eucalyptus grandis [rose gum]
emb|CDX76962.1|  BnaC08g35480D                                          165   6e-44   
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               165   6e-44   Glycine max [soybeans]
emb|CDY12435.1|  BnaC08g09240D                                          165   8e-44   Brassica napus [oilseed rape]
ref|XP_007048137.1|  Cytochrome P450                                    164   1e-43   
ref|XP_010444891.1|  PREDICTED: cytochrome P450 86B1-like               157   1e-43   
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    164   1e-43   Arabis alpina [alpine rockcress]
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             164   1e-43   
emb|CDP12888.1|  unnamed protein product                                164   1e-43   Coffea canephora [robusta coffee]
emb|CDY29171.1|  BnaC09g15680D                                          163   2e-43   Brassica napus [oilseed rape]
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               164   2e-43   Solanum tuberosum [potatoes]
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               164   2e-43   Populus euphratica
emb|CDY32582.1|  BnaC03g15500D                                          162   2e-43   Brassica napus [oilseed rape]
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               164   2e-43   Brassica rapa
emb|CDY38915.1|  BnaA03g12640D                                          157   2e-43   Brassica napus [oilseed rape]
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               163   2e-43   Eucalyptus grandis [rose gum]
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    163   2e-43   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             163   3e-43   Phaseolus vulgaris [French bean]
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    163   3e-43   Arabis alpina [alpine rockcress]
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               163   3e-43   Glycine max [soybeans]
emb|CDY44658.1|  BnaA08g06820D                                          163   3e-43   Brassica napus [oilseed rape]
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               163   3e-43   Brassica rapa
emb|CDX72691.1|  BnaC07g47130D                                          157   4e-43   
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               163   4e-43   Solanum lycopersicum
gb|KJB71270.1|  hypothetical protein B456_011G113900                    163   4e-43   Gossypium raimondii
ref|XP_011658477.1|  PREDICTED: alkane hydroxylase MAH1-like            162   5e-43   Cucumis sativus [cucumbers]
ref|XP_012075243.1|  PREDICTED: alkane hydroxylase MAH1-like            162   5e-43   Jatropha curcas
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               162   6e-43   Nicotiana sylvestris
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    162   6e-43   
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             162   7e-43   Capsella rubella
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               162   7e-43   Arabis alpina [alpine rockcress]
gb|EYU27555.1|  hypothetical protein MIMGU_mgv1a020397mg                162   7e-43   Erythranthe guttata [common monkey flower]
emb|CDY39927.1|  BnaA09g15090D                                          162   8e-43   Brassica napus [oilseed rape]
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               162   8e-43   Tarenaya hassleriana [spider flower]
emb|CDX83711.1|  BnaC07g24510D                                          155   9e-43   
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               162   9e-43   Tarenaya hassleriana [spider flower]
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               162   1e-42   
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               161   1e-42   Brassica rapa
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             160   1e-42   Phaseolus vulgaris [French bean]
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     161   1e-42   Eucalyptus grandis [rose gum]
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             161   2e-42   
ref|XP_011657793.1|  PREDICTED: alkane hydroxylase MAH1-like            161   2e-42   Cucumis sativus [cucumbers]
emb|CDY13727.1|  BnaA06g31960D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_004142037.2|  PREDICTED: alkane hydroxylase MAH1-like            161   2e-42   Cucumis sativus [cucumbers]
gb|KHN27469.1|  Cytochrome P450 86B1                                    160   2e-42   Glycine soja [wild soybean]
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               160   2e-42   
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             161   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               160   2e-42   Glycine max [soybeans]
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    160   3e-42   Arabis alpina [alpine rockcress]
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               160   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88475.1|  hypothetical protein OsI_09946                          160   4e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    160   4e-42   Brassica rapa
gb|ABF93892.1|  Cytochrome P450 family protein                          160   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               160   4e-42   Brassica rapa
emb|CDY39926.1|  BnaA09g15080D                                          160   5e-42   Brassica napus [oilseed rape]
dbj|BAD94304.1|  cytochrome p450 - like protein                         160   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               160   5e-42   Brassica rapa
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               160   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               159   6e-42   Cucumis melo [Oriental melon]
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             159   6e-42   Capsella rubella
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             159   6e-42   Capsella rubella
gb|KHN19680.1|  Cytochrome P450 86B1                                    160   6e-42   Glycine soja [wild soybean]
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             160   7e-42   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             159   7e-42   Eutrema salsugineum [saltwater cress]
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               159   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010681237.1|  PREDICTED: cytochrome P450 86B1-like               154   9e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             159   9e-42   Eutrema salsugineum [saltwater cress]
gb|KHN27468.1|  Cytochrome P450 86B1                                    158   9e-42   Glycine soja [wild soybean]
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    159   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               159   1e-41   Glycine max [soybeans]
emb|CDX72690.1|  BnaC07g47120D                                          159   1e-41   
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    159   1e-41   Arabis alpina [alpine rockcress]
ref|XP_002869292.1|  CYP96A2                                            159   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   Elaeis guineensis
ref|NP_001117509.1|  alkane hydroxylase CYP96A15                        157   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KEH22137.1|  cytochrome P450 family protein                          158   2e-41   Medicago truncatula
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   Sesamum indicum [beniseed]
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   Brassica rapa
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               158   2e-41   Populus euphratica
gb|KEH22136.1|  cytochrome P450 family protein                          158   2e-41   Medicago truncatula
gb|ACR38435.1|  unknown                                                 158   3e-41   Zea mays [maize]
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             161   3e-41   
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    158   3e-41   
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    157   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    157   4e-41   Brassica rapa
gb|KJB44293.1|  hypothetical protein B456_007G244800                    157   4e-41   Gossypium raimondii
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    157   4e-41   Glycine max [soybeans]
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           157   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012075242.1|  PREDICTED: alkane hydroxylase MAH1-like            157   5e-41   Jatropha curcas
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               157   5e-41   Nicotiana sylvestris
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                157   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             157   5e-41   Capsella rubella
emb|CDY39035.1|  BnaA02g17240D                                          157   5e-41   Brassica napus [oilseed rape]
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    157   5e-41   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               157   5e-41   Brassica rapa
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    159   6e-41   Arabis alpina [alpine rockcress]
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg             157   6e-41   Capsella rubella
emb|CDY58383.1|  BnaC09g51620D                                          157   6e-41   Brassica napus [oilseed rape]
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    157   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               157   7e-41   Eucalyptus grandis [rose gum]
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         156   8e-41   Jatropha curcas
ref|XP_002866852.1|  CYP96A9                                            156   9e-41   Arabidopsis lyrata subsp. lyrata
emb|CDY42628.1|  BnaC01g00400D                                          156   1e-40   Brassica napus [oilseed rape]
ref|XP_002894062.1|  CYP96A8                                            156   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             155   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               155   2e-40   Oryza brachyantha
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               156   2e-40   
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          155   2e-40   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             155   2e-40   Populus trichocarpa [western balsam poplar]
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    155   2e-40   Arabis alpina [alpine rockcress]
gb|KJB44331.1|  hypothetical protein B456_007G246400                    155   2e-40   Gossypium raimondii
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       155   3e-40   Cucumis sativus [cucumbers]
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    155   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    155   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               155   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               155   4e-40   Sesamum indicum [beniseed]
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               154   4e-40   Camelina sativa [gold-of-pleasure]
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    154   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012072814.1|  PREDICTED: alkane hydroxylase MAH1-like            154   4e-40   Jatropha curcas
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             154   4e-40   Arabidopsis lyrata subsp. lyrata
emb|CDX84084.1|  BnaC08g07610D                                          152   5e-40   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               154   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               154   6e-40   Setaria italica
emb|CDY39931.1|  BnaA09g15130D                                          154   6e-40   Brassica napus [oilseed rape]
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               154   7e-40   Camelina sativa [gold-of-pleasure]
emb|CDY53178.1|  BnaA06g40570D                                          153   7e-40   Brassica napus [oilseed rape]
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    154   8e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002521476.1|  cytochrome P450, putative                          154   9e-40   
emb|CDX72693.1|  BnaC07g47150D                                          153   1e-39   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               153   1e-39   Camelina sativa [gold-of-pleasure]
emb|CDY39928.1|  BnaA09g15100D                                          153   1e-39   Brassica napus [oilseed rape]
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               153   1e-39   Camelina sativa [gold-of-pleasure]
gb|EEE54005.1|  hypothetical protein OsJ_00650                          152   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             153   2e-39   Phaseolus vulgaris [French bean]
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               153   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_010436206.1|  PREDICTED: cytochrome P450 86B1-like               149   2e-39   
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like               153   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             152   2e-39   Eutrema salsugineum [saltwater cress]
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               152   3e-39   Arabis alpina [alpine rockcress]
ref|XP_002894061.1|  CYP96A8                                            152   3e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               152   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             152   3e-39   Phaseolus vulgaris [French bean]
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               152   4e-39   Populus euphratica
ref|NP_001042228.1|  Os01g0183600                                       152   4e-39   
dbj|BAC42841.1|  putative cytochrome P450                               152   4e-39   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    152   4e-39   
gb|EAY72807.1|  hypothetical protein OsI_00673                          152   4e-39   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like               152   4e-39   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               152   5e-39   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             151   6e-39   
ref|XP_012071985.1|  PREDICTED: alkane hydroxylase MAH1-like            151   7e-39   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             150   1e-38   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               150   1e-38   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               150   1e-38   
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             150   2e-38   
gb|EEC74485.1|  hypothetical protein OsI_09945                          150   2e-38   
ref|XP_004142039.2|  PREDICTED: alkane hydroxylase MAH1-like            149   2e-38   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               150   2e-38   
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               149   3e-38   
emb|CDY68678.1|  BnaCnng60030D                                          149   3e-38   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               149   3e-38   
gb|EPS72790.1|  hypothetical protein M569_01963                         149   4e-38   
ref|XP_012075240.1|  PREDICTED: alkane hydroxylase MAH1-like isof...    145   4e-38   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               149   5e-38   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               149   5e-38   
gb|AIE57505.1|  MAH1                                                    149   5e-38   
ref|XP_002868909.1|  CYP96A12                                           149   5e-38   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    148   5e-38   
gb|AGV40485.1|  hypothetical protein                                    149   6e-38   
gb|KEH41380.1|  cytochrome P450 family protein                          148   6e-38   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               148   7e-38   
gb|KHN45347.1|  Cytochrome P450 86B1                                    148   7e-38   
ref|XP_004151610.1|  PREDICTED: alkane hydroxylase MAH1-like            148   7e-38   
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    148   8e-38   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               148   9e-38   
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               148   9e-38   
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like               148   1e-37   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             147   1e-37   
gb|EPS57870.1|  hypothetical protein M569_16947                         147   2e-37   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               147   2e-37   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             147   2e-37   
gb|EMS66236.1|  Cytochrome P450 86B1                                    145   2e-37   
gb|KJB33823.1|  hypothetical protein B456_006G032600                    146   2e-37   
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             146   3e-37   
emb|CBI33551.3|  unnamed protein product                                145   3e-37   
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               146   3e-37   
gb|ABF93891.1|  Cytochrome P450 family protein                          147   3e-37   
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          146   3e-37   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          146   4e-37   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             146   4e-37   
gb|EMT14219.1|  Cytochrome P450 86A2                                    146   4e-37   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               146   4e-37   
ref|XP_002526301.1|  heme binding protein, putative                     145   4e-37   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               146   5e-37   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    146   5e-37   
ref|XP_002457225.1|  hypothetical protein SORBIDRAFT_03g003600          145   6e-37   
ref|XP_012075239.1|  PREDICTED: alkane hydroxylase MAH1-like isof...    145   1e-36   
gb|KEH24777.1|  cytochrome P450 family protein                          145   1e-36   
gb|EMS62655.1|  Cytochrome P450 86B1                                    145   1e-36   
gb|EAZ25511.1|  hypothetical protein OsJ_09335                          145   1e-36   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               145   1e-36   
gb|EPS67771.1|  hypothetical protein M569_06997                         144   1e-36   
ref|XP_003629932.1|  Cytochrome P450                                    144   1e-36   
ref|NP_001048908.1|  Os03g0138200                                       145   1e-36   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             144   2e-36   
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433             144   2e-36   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             144   2e-36   
gb|EAY88464.1|  hypothetical protein OsI_09931                          144   2e-36   
gb|KEH40839.1|  cytochrome P450 family protein                          144   2e-36   
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               144   2e-36   
ref|XP_004142038.1|  PREDICTED: alkane hydroxylase MAH1-like            144   2e-36   
emb|CDY29175.1|  BnaC09g15720D                                          144   2e-36   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             144   2e-36   
dbj|BAA99522.1|  putative cytochrome P450                               144   3e-36   
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               143   3e-36   
ref|XP_002865907.1|  CYP96A4                                            144   3e-36   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   144   3e-36   
dbj|BAJ86572.1|  predicted protein                                      143   4e-36   
ref|XP_004142036.2|  PREDICTED: alkane hydroxylase MAH1-like            143   5e-36   
gb|KEH40821.1|  cytochrome P450 family protein                          143   6e-36   
gb|KJB33822.1|  hypothetical protein B456_006G032500                    143   6e-36   
emb|CDP12889.1|  unnamed protein product                                143   6e-36   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         142   6e-36   
gb|EAY88476.1|  hypothetical protein OsI_09947                          143   7e-36   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    142   7e-36
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               142   8e-36   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    142   8e-36   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               142   9e-36   
ref|NP_001048917.1|  Os03g0140100                                       142   9e-36   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    142   1e-35   
ref|XP_012075241.1|  PREDICTED: alkane hydroxylase MAH1-like            142   1e-35   
dbj|BAK07250.1|  predicted protein                                      142   1e-35   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             142   1e-35   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               142   1e-35   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             142   2e-35   
ref|XP_011628156.1|  PREDICTED: cytochrome P450 86B1-like               141   2e-35   
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    141   2e-35   
ref|XP_010242506.1|  PREDICTED: cytochrome P450 86B1-like               141   3e-35   
ref|XP_006649370.1|  PREDICTED: cytochrome P450 86B1-like               141   3e-35   
dbj|BAK03685.1|  predicted protein                                      140   3e-35   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    140   5e-35   
gb|KFK22185.1|  hypothetical protein AALP_AAs38949U000100               143   5e-35   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               140   6e-35   
emb|CDY20374.1|  BnaC02g24420D                                          137   6e-35   
emb|CDY39934.1|  BnaA09g15160D                                          139   6e-35   
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               140   8e-35   
gb|KDP46409.1|  hypothetical protein JCGZ_10249                         139   1e-34   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               139   1e-34   
gb|EMT29524.1|  Cytochrome P450 86A2                                    138   1e-34   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               139   1e-34   
emb|CDM81753.1|  unnamed protein product                                139   1e-34   
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like               139   1e-34   
emb|CDM81752.1|  unnamed protein product                                139   1e-34   
gb|EMT13313.1|  Cytochrome P450 86A1                                    139   2e-34   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    139   2e-34   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               139   2e-34   
emb|CDY66735.1|  BnaC03g60620D                                          139   2e-34   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               138   2e-34   
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             138   3e-34   
emb|CDX90336.1|  BnaA08g16480D                                          138   3e-34   
gb|EPS73452.1|  hypothetical protein M569_01304                         130   3e-34   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               138   3e-34   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               138   3e-34   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               138   4e-34   
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               137   4e-34   
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               137   5e-34   
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    137   5e-34   
gb|AAM65207.1|  putative cytochrome P450                                137   6e-34   
ref|XP_002886391.1|  predicted protein                                  137   7e-34   
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             137   7e-34   
gb|EMT07503.1|  Cytochrome P450 86A2                                    137   7e-34   
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    137   8e-34   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     138   9e-34   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               137   9e-34   
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               137   1e-33   
ref|XP_010274134.1|  PREDICTED: cytochrome P450 86B1-like               136   2e-33   
gb|KEH40835.1|  cytochrome P450 family protein                          136   2e-33   
gb|KEH40842.1|  cytochrome P450 family protein                          136   2e-33   
ref|XP_007042364.1|  Cytochrome P450-like protein                       135   2e-33   
ref|XP_010270999.1|  PREDICTED: cytochrome P450 86B1-like               135   2e-33   
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    135   2e-33   
ref|XP_002322212.1|  hypothetical protein POPTR_0015s09850g             135   2e-33   
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               135   3e-33   
ref|XP_009109987.1|  PREDICTED: cytochrome P450 86B1-like               132   3e-33   
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like               135   5e-33   
gb|EAY77762.1|  hypothetical protein OsI_32799                          135   5e-33   
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like               134   6e-33   
gb|KEH40811.1|  cytochrome P450 family protein                          134   7e-33   
emb|CAB41474.1|  cytochrome P450                                        134   7e-33   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    134   8e-33   
gb|EEE68351.1|  hypothetical protein OsJ_26654                          134   9e-33   
ref|NP_001061394.1|  Os08g0262500                                       134   1e-32   
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-32   
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-32   
ref|XP_009402197.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-32   
emb|CDX90337.1|  BnaA08g16470D                                          134   1e-32   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               134   1e-32   
ref|XP_004492144.1|  PREDICTED: cytochrome P450 86B1-like               133   1e-32   
gb|KEH40805.1|  cytochrome P450 family protein                          133   2e-32   
emb|CDX90335.1|  BnaA08g16490D                                          130   2e-32   
gb|KEH40818.1|  cytochrome P450 family protein                          133   2e-32   
gb|KEH24775.1|  cytochrome P450 family protein                          133   2e-32   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               133   2e-32   
ref|XP_002312417.2|  cytochrome P450 family protein                     132   2e-32   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    132   3e-32   
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             132   3e-32   
ref|XP_007031595.1|  Cytochrome P450, putative                          131   7e-32   
ref|NP_001061395.1|  Os08g0263000                                       131   7e-32   
dbj|BAJ87689.1|  predicted protein                                      131   7e-32   
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg             131   8e-32   
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             131   8e-32   
emb|CDY64400.1|  BnaCnng43840D                                          128   9e-32   
gb|EAZ42091.1|  hypothetical protein OsJ_26652                          131   9e-32   
ref|XP_010275494.1|  PREDICTED: cytochrome P450 86B1-like               131   1e-31   
ref|XP_010522165.1|  PREDICTED: cytochrome P450 86B1-like               131   1e-31   
gb|KJB77357.1|  hypothetical protein B456_012G133700                    131   1e-31   
gb|KEH24772.1|  cytochrome P450 family protein                          130   1e-31   
gb|AAS58486.1|  phytochrome P450-like protein                           130   1e-31   
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                    130   1e-31   
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    130   1e-31   
gb|EMS35652.1|  Cytochrome P450 86B1                                    130   2e-31   
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-31   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-31   
ref|XP_009130123.1|  PREDICTED: cytochrome P450 86B1-like               130   2e-31   
emb|CDY46948.1|  BnaA02g32980D                                          130   2e-31   
emb|CBI33552.3|  unnamed protein product                                128   3e-31   
ref|XP_010241540.1|  PREDICTED: cytochrome P450 86B1-like               129   3e-31   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               129   3e-31   
ref|XP_002523775.1|  cytochrome P450, putative                          130   3e-31   
gb|EMS63638.1|  Cytochrome P450 86B1                                    130   3e-31   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like               130   3e-31   
ref|XP_009631300.1|  PREDICTED: cytochrome P450 86B1-like               129   4e-31   
gb|AJD25224.1|  cytochrome P450 CYP96A84                                129   4e-31   
gb|KEH24773.1|  cytochrome P450 family protein                          129   4e-31   
ref|XP_011070444.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    130   4e-31   
emb|CDY61911.1|  BnaC07g49710D                                          129   5e-31   
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               129   5e-31   
gb|EAY88477.1|  hypothetical protein OsI_09948                          129   5e-31   
ref|XP_010474420.1|  PREDICTED: cytochrome P450 86A4-like               127   6e-31   
ref|XP_004952982.1|  PREDICTED: cytochrome P450 86B1-like               129   6e-31   
ref|XP_003607255.1|  Cytochrome P450                                    129   6e-31   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like               129   6e-31   
ref|XP_010269497.1|  PREDICTED: cytochrome P450 86B1-like               129   7e-31   
ref|XP_010442700.1|  PREDICTED: cytochrome P450 86B1-like               128   7e-31   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    129   7e-31   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            129   7e-31   
gb|KEH40819.1|  cytochrome P450 family protein                          128   7e-31   
ref|XP_010905515.1|  PREDICTED: cytochrome P450 86B1-like               129   7e-31   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                   129   9e-31   
gb|EEC73748.1|  hypothetical protein OsI_08390                          128   9e-31   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein            128   9e-31   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    129   9e-31   
gb|KGN58549.1|  hypothetical protein Csa_3G681140                       127   1e-30   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like               128   1e-30   
ref|XP_010452806.1|  PREDICTED: cytochrome P450 86B1 isoform X2         127   1e-30   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like               128   1e-30   
ref|XP_010242505.1|  PREDICTED: cytochrome P450 86B1-like               128   1e-30   
gb|AJD25208.1|  cytochrome P450 CYP86A92                                128   1e-30   
ref|XP_007019556.1|  Cytochrome P450                                    128   1e-30   
ref|NP_001047674.1|  Os02g0666500                                       128   1e-30   
gb|KEH40822.1|  cytochrome P450 family protein                          128   1e-30   
gb|KFK27637.1|  hypothetical protein AALP_AA8G409300                    128   1e-30   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg             128   1e-30   
ref|XP_002304502.2|  cytochrome P450 family protein                     128   1e-30   



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 151/183 (83%), Gaps = 1/183 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+I   LGC+  +K++  SS    +PR W +VGM+P LL NAHR+H+F TD+LK SGGTF
Sbjct  14   FIIVLSLGCYMILKLRCRSSDDKVVPRNWPLVGMMPALLKNAHRVHEFATDVLKHSGGTF  73

Query  339  EFKGPV-LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  515
            EFKGP    NL ML T DPANIHH+LS+NFSNYPKGP+FR+IFD+LGDGIFNVDSQLWE 
Sbjct  74   EFKGPAAFANLSMLATSDPANIHHVLSKNFSNYPKGPEFRKIFDILGDGIFNVDSQLWEL  133

Query  516  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*  695
            HRKTTLSF NHA F+TLL+TNVWHKV+ GLLP+LD FAE+ A+FDLQDVFQRFTFD IS 
Sbjct  134  HRKTTLSFLNHAQFYTLLQTNVWHKVEKGLLPVLDWFAEEGAEFDLQDVFQRFTFDAISK  193

Query  696  LVL  704
            LVL
Sbjct  194  LVL  196



>emb|CDP22261.1| unnamed protein product, partial [Coffea canephora]
Length=217

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +F F+  FCY          S++P  W V+GM+PGL+ N+HRL ++ T+ILKESGGTFE 
Sbjct  15   LFCFIFLFCYYYSFSRRWRNSSLPTNWPVIGMMPGLVRNSHRLQEYGTEILKESGGTFEA  74

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
             GP   N+ M++TCDPANIH+ILS+NFSNYPKGP+FR+IFD+LGDGIFN DSQLWE HR+
Sbjct  75   NGPWFANMHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRR  134

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             TLS  +H  F  LLE  VW KV+ GLLP+L + A+  +Q DLQD+FQRF FD+IS LVL
Sbjct  135  VTLSLMHHPSFLKLLEVTVWDKVEKGLLPVLQNCAKTGSQLDLQDIFQRFAFDSISKLVL  194



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 138/177 (78%), Gaps = 3/177 (2%)
 Frame = +3

Query  183  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            CF Y      S+     S++P  W +VGMLPGL+ NAHR+H+FVTD L E+ GTFEF GP
Sbjct  2    CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGP  61

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            VL NL+ML+T DPANIHHILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+
Sbjct  62   VLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMLGNGMFNVDYELWEMHRKTTM  121

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            S  NHA F TLLE N+W  ++NGL P+LD FAEQ   FDLQD+FQRFTFD IS L+L
Sbjct  122  SLMNHAKFQTLLERNMWSIIENGLQPVLDGFAEQGTLFDLQDIFQRFTFDAISKLLL  178



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            ++I   + CF Y  +K    ++S+ P  W + GMLPGL++NAHR+H F TDIL E+   F
Sbjct  10   YVIPLIILCFTYWNLK-NKWAKSSKPTNWPIFGMLPGLVHNAHRIHSFFTDILLETTSNF  68

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  69   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  128

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RKTT+S  NH+ F TLL+ NVW  +  G++P LD  A+Q+   DLQD+FQRF+FDTIS L
Sbjct  129  RKTTMSLMNHSKFQTLLQRNVWDTIDKGIVPTLDILAKQDTPVDLQDIFQRFSFDTISKL  188

Query  699  VL  704
            +L
Sbjct  189  LL  190



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +   LG   +  + +   S+++ P  W +VGMLPGL+ NAHR+H F TDIL E+G  FEF
Sbjct  9    VLIILGFTYFTWLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILLETGNNFEF  68

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
             GP LGN++ML T DPANIHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK
Sbjct  69   YGPALGNMNMLFTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRK  128

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             T+S  +HA F  LL+ NVW+ V+ GL+P+LD+FAE+   FDLQD+FQRFTFD IS L+L
Sbjct  129  ITMSLMSHAKFQILLKKNVWNTVEKGLVPVLDAFAERGTTFDLQDIFQRFTFDNISKLLL  188



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +3

Query  207  MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITC  386
            +   S+S+ P  W + GMLPGL+ NAHR+H+F TDIL E+G  FEF+GPV+ N++ML T 
Sbjct  23   INRRSKSSAPTDWPLAGMLPGLIQNAHRIHEFFTDILLETGNNFEFRGPVISNMNMLFTS  82

Query  387  DPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL  566
            DPANIHHILSRNFSNYPKGP+FR+IF++LG+GIFNVDS+LWE HRK T+S  +HA F  L
Sbjct  83   DPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKFQIL  142

Query  567  LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            L+ NVW  V+ GL+P+LD+FAE+   FDLQD+FQRFTFD IS L+L
Sbjct  143  LKKNVWDTVEKGLVPVLDAFAERGTTFDLQDIFQRFTFDNISKLLL  188



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +3

Query  222  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  401
            +S+ P  W + GMLPGL+ NAHR+H F T IL E+GGTFEF GPVL NL+ML+T DPANI
Sbjct  31   KSSTPTNWPLFGMLPGLIRNAHRIHDFATSILMETGGTFEFYGPVLTNLNMLVTSDPANI  90

Query  402  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  581
            HHILS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F TLLE N+
Sbjct  91   HHILSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  582  WHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            W  ++ GL P+LD+FAEQ   FDLQD+FQRFTFD IS L+L
Sbjct  151  WDTIEKGLRPILDTFAEQGTPFDLQDIFQRFTFDAISKLLL  191



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 140/177 (79%), Gaps = 3/177 (2%)
 Frame = +3

Query  183  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            CF Y      S+     S++P  W +VGMLPGL+ NAHR+H+F TDIL E+ GTF+F GP
Sbjct  16   CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIQNAHRVHEFATDILVETKGTFKFHGP  75

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            VL NL+MLIT DPANIH+ILS+NFSNYPKG +FR+IFD+LG+G+FNVD +LWE HRKTT+
Sbjct  76   VLANLNMLITSDPANIHYILSKNFSNYPKGVEFRKIFDILGNGMFNVDYELWEMHRKTTM  135

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            S  NHA F TLLE N+W+ ++N L P+LD+FAEQ+  FD+QD+FQRFTFD IS L+L
Sbjct  136  SLMNHAKFQTLLERNMWNIIENRLRPILDAFAEQDILFDMQDIFQRFTFDAISKLLL  192



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = +3

Query  183  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            CF Y      S+     S++P  W +VGMLPGL+ N HR+H+F TD+L E+ GTFEF GP
Sbjct  16   CFTYSTWWYLSNRWWKSSSVPTNWPLVGMLPGLIRNVHRVHEFATDVLVETKGTFEFHGP  75

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            VL NL+ML T DPANIHHILS+NFSNYPKG +FR+ FD+LG+GIFNVD +LWE HRKTT+
Sbjct  76   VLANLNMLATSDPANIHHILSKNFSNYPKGVEFRKFFDILGNGIFNVDYELWEIHRKTTM  135

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            S  +HA F T LE N+W  ++NGL P+LD+FAEQ+  FDLQD+FQRFTFD IS L+L
Sbjct  136  SLMSHAKFQTFLERNLWDIIENGLRPILDTFAEQDTLFDLQDIFQRFTFDAISKLLL  192



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            ++I   + C  Y  +K    ++++ P  W ++GMLPG ++NAHR+H F TD+L E+   F
Sbjct  7    YVIPLIILCLTYWYLK-NKWTKTSKPIDWPIIGMLPGFVHNAHRIHSFFTDLLLETSSNF  65

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            EF+GP+  N+DML T DPANIHHILSRNFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE H
Sbjct  66   EFRGPIFANMDMLFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIH  125

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RKTT+   NHA F TLL+ NVW  +  G++P LD FA+Q+   DLQD+FQRF+FDTIS L
Sbjct  126  RKTTMYLMNHAKFQTLLQRNVWDTIDKGIVPTLDIFAKQDTPVDLQDIFQRFSFDTISKL  185

Query  699  VL  704
            +L
Sbjct  186  LL  187



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = +3

Query  183  CFCYMKMKMESS---SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            CF Y      S+     S+ P  W +VGMLPGL+ N HR+H+FVTD L ES GTFEF GP
Sbjct  16   CFTYSTRWYLSNIWWKSSSAPTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGP  75

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            VL NL+ML+T DPANIHHILS+NFSNYPKG +FR+IFD++G+GIFNVD +LWE HRKTT+
Sbjct  76   VLANLNMLLTSDPANIHHILSKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTM  135

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            S  NH  F T+LE N+W  ++NGL P+LD FAEQ   FDLQD+FQRFTFD I+ L+L
Sbjct  136  SLMNHPKFQTMLERNMWSIIENGLWPILDGFAEQGTLFDLQDIFQRFTFDAITKLLL  192



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = +3

Query  168  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  347
            F+F+       ++  S  +S+ P  W ++GMLP LL  + R+H   T ++ ESGGTFEFK
Sbjct  12   FTFIVILLPAVLRSRSWRKSSGPTNWPLLGMLPWLLRISRRIHSSATQLMNESGGTFEFK  71

Query  348  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  527
            GP   N+DMLITCDPANIHHI SRNFSNYPKGP+FR+IFDVLGDGIFN D +LWE HR+T
Sbjct  72   GPWFCNMDMLITCDPANIHHIFSRNFSNYPKGPEFRKIFDVLGDGIFNADFELWELHRRT  131

Query  528  TLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            TLSFF+HA FHTLL   VW KV+  LLP+LDSF EQ    DLQD+FQRF+FD I  LVL
Sbjct  132  TLSFFSHARFHTLLGRAVWGKVETALLPVLDSFLEQGVAVDLQDIFQRFSFDNICKLVL  190



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +3

Query  222  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  401
            +S++P  W +VGMLPGL+ NAHR+H F T IL E+GGTFEF GPVL N +ML T DPANI
Sbjct  31   KSSVPTNWPLVGMLPGLIRNAHRVHDFATSILVETGGTFEFYGPVLTNSNMLATSDPANI  90

Query  402  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  581
            HH+LS+NFSNYPKG +F++IFD+LG+GIFNVDS+LWE HRKTT+S  +HA F TLLE N+
Sbjct  91   HHVLSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQTLLERNM  150

Query  582  WHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            W   + GL P+LD+FAEQ   FDLQD+FQRFTFD IS L+L
Sbjct  151  WDTFEKGLQPILDTFAEQGTPFDLQDIFQRFTFDAISKLLL  191



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +3

Query  165  IFSFL--GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            IF FL      ++  + ++  ++++P  W +VGMLPG+L N+HR+H + TDIL ESGGTF
Sbjct  9    IFLFLLPAMILFLVWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDYATDILSESGGTF  68

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            +FK P + N+DML+TCDPANIHHI SRNFSNYPKGP+FR+IF++LGDGIFN D +LWE H
Sbjct  69   QFKFPGVFNMDMLVTCDPANIHHIFSRNFSNYPKGPEFRKIFEILGDGIFNADFELWELH  128

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSF-AEQEA----QFDLQDVFQRFTFD  683
            R+TTL+F NH  F++LLE++VW KV  GLLP+LD   A+Q A    + DLQDVFQR TFD
Sbjct  129  RRTTLAFLNHTKFYSLLESSVWGKVGTGLLPVLDDLIAKQGANNSHEVDLQDVFQRLTFD  188

Query  684  TIS*LVL  704
             I  LVL
Sbjct  189  NICKLVL  195



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = +3

Query  189  CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNL  368
            CY++ +    ++++ P  W  VGMLP ++ N HR+H ++T +L E+GGTFEFKGP+   +
Sbjct  22   CYLRNRW---TKTSAPTYWPFVGMLPAIILNFHRIHDYITKVLIETGGTFEFKGPIFAYM  78

Query  369  DMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNH  548
            DMLITCDPANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRKTT+S  +H
Sbjct  79   DMLITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKTTMSIMSH  138

Query  549  AHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            A F TLLE N+W+ ++    P+LD+FAEQ    DLQD+ QR +FD+I+ L+L
Sbjct  139  AKFQTLLERNMWNIIEKRFRPILDAFAEQGNSLDLQDILQRLSFDSITKLLL  190



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +3

Query  204  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  383
            + ++ +++++P  W +VGMLP +L N HR+  + T+IL ESGGTF+ K P + N+DML+T
Sbjct  26   RTKTPAKTSLPTNWPLVGMLPAILQNCHRIQPYFTEILTESGGTFQLKFPRVFNMDMLLT  85

Query  384  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  563
              PANIHHI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLSF NH+ F+ 
Sbjct  86   SHPANIHHIFSRNFSNYPKGPEFRKVFEILGDGIFNADFELWELHRRTTLSFLNHSEFYG  145

Query  564  LLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            LLE++VW KV+ GLLP+LD F+E  A FD QDVFQRF FD+I  LVL
Sbjct  146  LLESSVWEKVETGLLPVLDDFSENRASFDFQDVFQRFAFDSICRLVL  192



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            ++++ P  W  VGMLP ++ N H +H ++T +L E+GGTFEFKGP+  N+DMLITCDPAN
Sbjct  29   TKTSAPIYWPFVGMLPAIILNFHHIHDYITKVLTETGGTFEFKGPIFANMDMLITCDPAN  88

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            IHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVDS+LWE HRK T+S  +HA F TLLE N
Sbjct  89   IHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKITMSIMSHAKFQTLLENN  148

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +W  +   L P+LD FAEQ   FDLQD+ QR +FD+I+ L+L
Sbjct  149  MWGIMDKRLRPILDVFAEQGNSFDLQDILQRLSFDSITKLLL  190



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S+ P  W +VGMLP ++ N HR+H + T +L E GGTFEFKGP   ++DM++T DPANIH
Sbjct  35   SSKPTNWPLVGMLPAVVQNLHRIHDYATTVLTECGGTFEFKGPWFCHVDMVVTSDPANIH  94

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            HI SRNFSNYPKGP+FR++F++LGDGIFN D +LWE HR+TTLS   H  F   LE NVW
Sbjct  95   HIFSRNFSNYPKGPEFRKMFEILGDGIFNADFELWELHRRTTLSMLTHPEFPDFLEVNVW  154

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            HKVQ GLLP+LD FAE    FDLQDVFQR TFD I  LVL
Sbjct  155  HKVQTGLLPVLDYFAENGDYFDLQDVFQRLTFDGICKLVL  194



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHEYMTEVLIDVGGTY  69

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RKTTLS  +HA F TLLE N+W  V+ GL P+LD+F EQ+   DLQDV QRFTFD+I+ L
Sbjct  130  RKTTLSIMSHAKFQTLLERNLWDTVEKGLRPILDAFTEQDKTLDLQDVLQRFTFDSITKL  189

Query  699  VL  704
            +L
Sbjct  190  LL  191



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +3

Query  216  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
              +S++P  W ++ M+P LL N  RLHQF T++L++SGGT+ FKGP   N DML TCDPA
Sbjct  17   KEKSSLPTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDPA  76

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            NIHH+ S+NFSNYPKGP+FR+IF++LGDGIFN D +LWE HR+TT+S   H+ FH+ LE+
Sbjct  77   NIHHVFSKNFSNYPKGPEFRKIFEILGDGIFNADFELWEIHRRTTISLLTHSKFHSSLES  136

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             VW KV+ GLLP+L SF +Q A+ DLQD+FQRFTFD I  +VL
Sbjct  137  TVWGKVETGLLPVLASFCKQGAEVDLQDIFQRFTFDNICKVVL  179



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
             +IF F   F    ++   +  S+ P  W  + MLP ++ N HR+H+++T++L + GGT+
Sbjct  11   LIIFGF-TYFIVWYLRHRWTKTSSEPTNWPFIRMLPAVIMNLHRIHKYMTEVLIDVGGTY  69

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            EF+GP+  NLDM +TCD ANIHHI S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  70   EFEGPMFANLDMFVTCDSANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIH  129

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RKTTLS  +HA F TLLE N+W  V+ GL P+LD+F EQ+   DLQDV QRFTFD+I+ L
Sbjct  130  RKTTLSIMSHAKFQTLLERNLWDTVEKGLRPILDAFTEQDKTLDLQDVLQRFTFDSITKL  189

Query  699  VL  704
            +L
Sbjct  190  LL  191



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 124/177 (70%), Gaps = 0/177 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            F+      K K      +A+P  W VVGM P  L N HR+H F+T++L E GGTFEFKGP
Sbjct  2    FIAFVILRKWKSSGKFATAVPTNWPVVGMWPAALRNCHRVHDFITEVLSECGGTFEFKGP  61

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
             L N+DML TCDPANIHH+ SRNF+NYPKGP+F +IFDVLG+GIFN D +LW+FHRKTT+
Sbjct  62   WLCNMDMLFTCDPANIHHVFSRNFANYPKGPEFMKIFDVLGNGIFNADFELWKFHRKTTM  121

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             F     F  L+E  VW KV+ GL P+LD FAE     DLQDVFQRFTFD I  +VL
Sbjct  122  GFMGSLEFSGLIEGIVWRKVEKGLFPVLDLFAETGDSVDLQDVFQRFTFDGICKVVL  178



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +3

Query  216  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
            S +   P  W ++GMLPGLL N HRLH+FVT+IL E+ G FEFKGPV  NL+ML + DPA
Sbjct  36   SKKPVTPTNWPLIGMLPGLLRNTHRLHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPA  95

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            N+HH+LS+NF+NYPKG +++++FD++GDGIFNVD++LWE  RK T+S  +H  F + LE 
Sbjct  96   NLHHMLSKNFNNYPKGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLER  155

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            NVW KV  GL P+LD+FA+Q + FDLQD+FQRFTFDTIS L+L
Sbjct  156  NVWDKVVKGLQPVLDNFAKQGSCFDLQDIFQRFTFDTISKLLL  198



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            ++++ P  W ++  LPG++ N HR H ++T++L E GGT++FKGP+  N+DM  TCDPAN
Sbjct  28   TKTSAPTNWPILRELPGVIGNLHRGHAYMTEVLIEYGGTYDFKGPIFTNVDMFFTCDPAN  87

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE HR+TT+S  +HA F  LLE  
Sbjct  88   IHYIFSKNFSNYPKGPEFRKIFDMLGNGIFNVDHELWELHRRTTMSIMSHAKFQMLLEKT  147

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +W  ++ GL P+LD+FA+Q    DLQDV QRFTFD+I+ L+L
Sbjct  148  MWDIIEKGLKPILDAFAKQGKTLDLQDVLQRFTFDSITRLLL  189



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S++P  W +VGMLP L+ N HR+H+  T++L ES GTFEF GPV  N +ML T DP NIH
Sbjct  19   SSLPTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGTSDPENIH  78

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +ILS+NFSNYPKG +FR+ FD+ G+GIF+VD +LWE HRKTT+    HA FHTLLE N+W
Sbjct  79   YILSKNFSNYPKGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHTLLERNIW  138

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
              ++NGL P+LD FAE +  FDLQD+F RFTFD I  L+L
Sbjct  139  EIIENGLRPILDDFAELDTLFDLQDIFHRFTFDVICKLLL  178



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = +3

Query  162  MIFSFLGCFCY-MKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            ++F  + CF Y +   +   ++++ P  W ++  LP ++ N HR H ++T++L E G T+
Sbjct  8    ILFLLIFCFTYSIWFIIYRRTKTSAPTNWPILRELPAVIGNIHRGHAYMTEVLIEYGSTY  67

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            +FKGP+  N+DML TCDP +IH+I S+NFSNYPKGP+FR+IFD+LG+GIFNVD +LWE H
Sbjct  68   KFKGPIFTNMDMLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWELH  127

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RKTT+S  +HA F  LLE  +W  ++ GL P+LD+FA+Q    DLQDV QRFTFD+I+ L
Sbjct  128  RKTTMSIMSHAKFQILLEKTLWDIIEKGLRPILDAFAKQGKTLDLQDVLQRFTFDSITRL  187

Query  699  VL  704
            +L
Sbjct  188  LL  189



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 125/182 (69%), Gaps = 0/182 (0%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F++ S +    ++ ++      +AIP  + +VGMLP LL N+HR+H F+TDIL E GGTF
Sbjct  6    FLLLSSIAAALFLLLRRNLKKPTAIPTNFPIVGMLPALLLNSHRVHDFITDILSEVGGTF  65

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
            EFKGP   NLDM++T DP+N+HH+ SR+F  YPKGP FR++F VLGDGIFN D  +WE H
Sbjct  66   EFKGPTFSNLDMVLTSDPSNVHHVFSRSFLKYPKGPDFRKMFGVLGDGIFNTDFAVWEVH  125

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RK TL F     F+ L+E  VW KV+ G+ P+LDSF E     DLQDVFQR +FD I  L
Sbjct  126  RKATLGFVGDREFNGLVEGVVWGKVEKGVFPVLDSFVESGGFVDLQDVFQRMSFDGICRL  185

Query  699  VL  704
            VL
Sbjct  186  VL  187



>ref|XP_006339338.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=465

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLPG ++N HR+H F TDIL E+   FEF+GP+  N+DML   DPANIHHILSRNFSNYP
Sbjct  1    MLPGFVHNMHRVHSFFTDILLETNSNFEFRGPIFANMDMLFPSDPANIHHILSRNFSNYP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F +IFD+LG+ IFNVDS+LWE HRKTT+S  NHA F TLL+ NVW  +  G++P L
Sbjct  61   KGPEFHEIFDILGNEIFNVDSELWEIHRKTTMSLMNHAKFQTLLQRNVWDTIDKGIVPTL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            D FA+Q+   DLQD+FQR++FDT S L+L
Sbjct  121  DIFAKQDTPVDLQDIFQRYSFDTNSKLLL  149



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W ++GMLP ++ N HR+H ++T +L   GGT+ F+GP   N+DML T DPANIHH+ 
Sbjct  32   PTDWPLIGMLPRVILNFHRVHDYITSVLTVCGGTYMFRGPCFFNIDMLFTSDPANIHHVF  91

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            SRNFSNYPKGP+FR+IFD+LGDGIF  D +LWE HRKTTL+   HA F+  LE  VWHKV
Sbjct  92   SRNFSNYPKGPEFRKIFDILGDGIFGADFELWEIHRKTTLAQLTHADFNAQLERAVWHKV  151

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            + GLLP+LD F  +    DLQDVFQRFTFD I  +VL
Sbjct  152  ETGLLPVLDHFCAEGKDLDLQDVFQRFTFDNICKIVL  188



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 127/174 (73%), Gaps = 0/174 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            C   +  +     ++++P  W +VGMLP +  N HR+  ++T+IL ESGGTF+FK P   
Sbjct  22   CVWRICNRKSYGKKTSLPTNWPLVGMLPAIQRNRHRMQDYITEILIESGGTFQFKFPHFL  81

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
            N+D LIT +P NI+HI ++NFSNYPKGP+F++IF+ LGD IF+VD++LWEF R+TT SF 
Sbjct  82   NMDTLITSNPDNINHIFTKNFSNYPKGPEFKKIFEELGDSIFSVDNELWEFQRRTTHSFM  141

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             H  F++LLE  VW KV+NGLLP+LD F +    FDLQDVFQRFTFD+I  LVL
Sbjct  142  THPEFNSLLEGVVWQKVENGLLPVLDHFLQGNIDFDLQDVFQRFTFDSICKLVL  195



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 118/161 (73%), Gaps = 0/161 (0%)
 Frame = +3

Query  222  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  401
            R  IP  W ++GM+PG+L NAH+LH + T++L +S GTF  KGP L N+DML+T DP +I
Sbjct  30   RHVIPSNWPILGMIPGVLVNAHQLHDYTTELLIQSRGTFMLKGPWLANMDMLLTTDPLDI  89

Query  402  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  581
            HHILS+NFSNYPKG +F++IFD+LGDGI N D ++WE   K   S  NH  F + +ET +
Sbjct  90   HHILSKNFSNYPKGDKFQKIFDILGDGILNADGKIWEISHKVIFSVLNHVGFQSKMETII  149

Query  582  WHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            W KV+NGLLP+L+S  E+  + DLQD+FQRF FD +  L+L
Sbjct  150  WDKVENGLLPILESICERGTEMDLQDIFQRFAFDIVFKLLL  190



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = +3

Query  204  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  383
            K E+  + + P  W VVGMLPGL+ NAHR+H ++T+IL+E+G TF FKGP+  N+DM+ T
Sbjct  23   KFENRRKGSTPTNWPVVGMLPGLVGNAHRIHDYITEILRENGATFVFKGPLFTNMDMVFT  82

Query  384  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  563
            CDP NI+HI ++ FSNYPKGP+F++IF+++GDGIF  D ++WE  R+ TLS  N   F+T
Sbjct  83   CDPININHIFNKRFSNYPKGPEFQKIFEIMGDGIFRSDFEMWELQRRLTLSIVNQVGFYT  142

Query  564  LLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
             +E   W  V+  L+P+LD F ++  + ++QD+ +RF FD I
Sbjct  143  SVEKTTWGTVRTELVPVLDHFLQRGIEMEMQDILERFAFDNI  184



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 119/173 (69%), Gaps = 5/173 (3%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            FCY        +++ +P  W +VGML  LL N  R+H ++T++L++S   F FKGP   N
Sbjct  17   FCY-----SFRNKNGVPTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFAN  71

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            ++M +T DPAN+H+I+S+NF NYPKG +F ++FDV GDGIFNVDS+LWE+HRK   +F  
Sbjct  72   MEMFVTLDPANVHYIMSKNFKNYPKGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIG  131

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            H  FH  L   VW KV+ GL+P+LD  ++Q    DLQD+F RFTFDTI  L++
Sbjct  132  HPKFHQFLHEKVWEKVEKGLIPVLDDASKQGLVVDLQDLFSRFTFDTICTLIV  184



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 114/162 (70%), Gaps = 13/162 (8%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
             ++++P  W +VGMLP +L N HR+H + T+IL ESGGTF  +G   G +          
Sbjct  29   KKTSLPTNWPLVGMLPAILLNCHRIHAYFTEILIESGGTFIPRGFQHGYVGYF-------  81

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
                  RNFSNYPKGP+F+++F++LGDGIFN D +LWE HR+TTLSF NH  F+ LLE +
Sbjct  82   ------RNFSNYPKGPEFKKMFEILGDGIFNADFELWELHRRTTLSFLNHTKFYDLLERS  135

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +W KV+ GLLP+LD F+EQ   FDLQD+FQRFTFD+I  LVL
Sbjct  136  IWEKVETGLLPVLDDFSEQGIDFDLQDIFQRFTFDSICNLVL  177



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 126/190 (66%), Gaps = 8/190 (4%)
 Frame = +3

Query  123  MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  299
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  19   MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  73

Query  300  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  479
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  74   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  133

Query  480  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAEQEAQFDLQ  656
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE++  FDLQ
Sbjct  134  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAEKKLVFDLQ  192

Query  657  DVFQRFTFDT  686
            DVFQRFTFDT
Sbjct  193  DVFQRFTFDT  202



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 123/193 (64%), Gaps = 9/193 (5%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA  +   +L+  + F F+G FC         S+  +P  W +VGM  GLL++ HR+H  
Sbjct  1    MALVSYPEILVAVIFFLFIGGFC---------SKKGVPWNWPIVGMFAGLLFHVHRIHDE  51

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
              +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+PKG +FR++F+VLGDG
Sbjct  52   AAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFPKGTEFRKMFEVLGDG  111

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN D + W   RK   S  N+  FH  L    ++KV+ GL+PLLD  +EQ    DLQDV
Sbjct  112  IFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLLDHLSEQGRVVDLQDV  171

Query  663  FQRFTFDTIS*LV  701
            FQR TFDT   LV
Sbjct  172  FQRLTFDTTCMLV  184



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 123/188 (65%), Gaps = 4/188 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA   LL + + F+ FS L  +  +  K   S     P  W  +GMLPGLL   HR++ +
Sbjct  1    MALIGLLEVSVSFLCFSVLFAYFLISKKPHPS----FPTNWPFLGMLPGLLVEIHRVYDY  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T++L+ S  T+ F+GP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   MTEVLEASNLTYPFRGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN DS+LW+  RK+  S  +H  F          K++ GL+PLL+  AE++   DLQDV
Sbjct  117  IFNADSELWKDLRKSAQSMMSHPEFQRFTLRTSISKLEKGLIPLLNLVAEKKLVVDLQDV  176

Query  663  FQRFTFDT  686
            FQRFTFDT
Sbjct  177  FQRFTFDT  184



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 126/190 (66%), Gaps = 8/190 (4%)
 Frame = +3

Query  123  MASAAlllllllFMIFS-FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  299
            MA  +LL + + F+ FS F G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEISVSFLCFSYFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  300  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  479
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++FDVLGD
Sbjct  56   YVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFDVLGD  115

Query  480  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAEQEAQFDLQ  656
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE++  FDLQ
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAEKKLVFDLQ  174

Query  657  DVFQRFTFDT  686
            DVFQRFTFDT
Sbjct  175  DVFQRFTFDT  184



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 114/176 (65%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            F+  FC+         RS +P  W  +GM PGLL++ +R+H+   ++   +GGTF  KGP
Sbjct  16   FVAIFCFFVF-CALGDRSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTGGTFLLKGP  74

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+D+L T DPAN+H+I+S NF N+PKG +F++IFDVLGDGIFN D  LW+  RK T 
Sbjct  75   WFANIDILGTVDPANVHYIMSANFENFPKGEEFKKIFDVLGDGIFNSDLDLWKSQRKITR  134

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +   H  FH  LE   W K++NGL+P+L+  A +    DLQDVFQRFTFDT   LV
Sbjct  135  TLITHQRFHNCLEKTSWDKIENGLIPVLEFVARESKIVDLQDVFQRFTFDTTCQLV  190



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 120/173 (69%), Gaps = 0/173 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C++ ++   S+ + IP+ + VVG LP LL N HR+H + T++L+++  TF FKGP
Sbjct  10   FLAIICFLILRYCFSNNNGIPKNFPVVGTLPHLLLNVHRIHDYSTEVLEKTQCTFLFKGP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+D+L T DPAN+HHI+S NFSN+PKGP+F++IFD+LGDGIFN DS LW+  R+   
Sbjct  70   WFANMDILATVDPANVHHIMSSNFSNFPKGPEFKRIFDILGDGIFNSDSDLWKNQRRFAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
            +  N   F+  L  +   K++ GL+P+LD  ++Q    DLQD+FQRFTFD+ S
Sbjct  130  ALMNRHSFYKFLVKSNQAKLEKGLIPILDHMSKQGTTVDLQDLFQRFTFDSTS  182



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W  +GMLPGLL    R++ FVT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSN  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F++IFDVLGDGIFN DS+LW+  RK+  S   H  F       +  K++ G
Sbjct  97   FANYPKGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLEKG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+PLLD  AE++   DLQDVFQRFTFDT
Sbjct  157  LVPLLDYVAEKKQVVDLQDVFQRFTFDT  184



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            +   +DML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   LFAKMDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADMDLWKIQRKTAR  130

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +   H  F+  L      KV+ GL+P+LD    +    DLQD+FQRFTFDT   LV
Sbjct  131  ALITHQQFYKFLVKTSREKVEKGLIPVLDHVCHKGVIVDLQDLFQRFTFDTTCILV  186



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 121/188 (64%), Gaps = 4/188 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA   LL + +  +  SFL  +C +  K   S  +     W  +GMLPGLL    R++ +
Sbjct  1    MALITLLEVSISLLFISFLYGYCLISKKPHRSFLT----NWPFLGMLPGLLVEIPRVYDY  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            VT++L+ S  T+ FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   VTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN DS+LW+  RK+  S   H  F          K++ GL+PLLD  AE++   DLQDV
Sbjct  117  IFNADSELWKDLRKSAQSMMTHQDFQRFTLRTSMSKLEKGLVPLLDYVAEKKLVVDLQDV  176

Query  663  FQRFTFDT  686
            FQRFTFDT
Sbjct  177  FQRFTFDT  184



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+        ++   PR W + GMLPG LY    +H+ VT  ++ SGGTF FKGP
Sbjct  12   FLAILCFFLFHGLKDTK-GYPRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGP  70

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
            +   LDML T DPAN+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D  LW+  RKT  
Sbjct  71   IFAKLDMLATVDPANVHYIMSENFMNFPKGPKFREIFDVLGDGIFNADLDLWKIQRKTAR  130

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +   H  F+  L      KV+ GL+P+L+    +    DLQD+FQRFTFDT   LV
Sbjct  131  ALITHQQFYKFLVKTSREKVEKGLIPVLNHVCHKGVIVDLQDLFQRFTFDTTCILV  186



>ref|XP_010680694.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
               SFFNH  FH  L    W KV+NGL+P+L+  ++     DLQD+F RF++DT+
Sbjct  121  VAHSFFNHPKFHQSLVDVTWKKVKNGLIPVLEHVSKHNIVIDLQDLFLRFSYDTM  175



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 0/162 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            ++S  P  W +VGML  LL N +R+H +V++IL+ S  +F FKGP   N++ML+T DPAN
Sbjct  22   NKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQLSFLFKGPWFTNMEMLVTVDPAN  81

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            IHHI+++NFSNYPKG +F +IFDV+GDGIFNVD  LW++HR    +F  H  F   L   
Sbjct  82   IHHIMTKNFSNYPKGTKFNEIFDVMGDGIFNVDFDLWKYHRSMAHTFIAHPRFRHFLVVK  141

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +  KV+ GL+P+LD  A +    DLQD+F RFTFD I  LV+
Sbjct  142  IQEKVEKGLIPVLDHAANERLVVDLQDIFARFTFDNICTLVM  183



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 124/190 (65%), Gaps = 8/190 (4%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFL-GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQ  299
            MA  +LL + + F+ FSF  G F  MK    S      P  W  +GMLPGLL    R++ 
Sbjct  1    MAMISLLEITVSFLCFSFFFGYFLIMKKPHRS-----FPTNWPFLGMLPGLLVEIPRVYD  55

Query  300  FVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  479
            +VT+ L+ S  TF FKGP  G LDML T DPANIHHI+S NF+NYPKG +F+++F VLGD
Sbjct  56   YVTEFLEASNLTFPFKGPCFGGLDMLFTVDPANIHHIMSSNFANYPKGSEFKKLFSVLGD  115

Query  480  GIFNVDSQLWEFHRKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAEQEAQFDLQ  656
            GIFN DS LW+  RK+  S  +   F    L TN+  K++ GL+P+LD FAE++  FDLQ
Sbjct  116  GIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNM-SKLEKGLVPILDHFAEKKLVFDLQ  174

Query  657  DVFQRFTFDT  686
            DVFQ FTFDT
Sbjct  175  DVFQSFTFDT  184



>ref|XP_010027332.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62196.1| hypothetical protein EUGRSUZ_H04854 [Eucalyptus grandis]
Length=272

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  +++ S S    PR W +VGMLP LL N    H + T +++ S G F  + P
Sbjct  10   FLAGICFAVLRLLSKSNDGFPRNWPLVGMLPALLLNPSHFHDWATGVVERSHGNFFVRFP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L +    K +NGLL +LD  +++    DLQD+F RFTFD+
Sbjct  130  VFMKDQRFHRFLSSTTRDKAENGLLRVLDELSQRGVTVDLQDLFHRFTFDS  180



>gb|EPS60696.1| hypothetical protein M569_14105, partial [Genlisea aurea]
Length=468

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 0/162 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            SR++    W +V MLPGL  N HR+H F+ ++L ESGGTF F+GPV GN DML+T DPAN
Sbjct  2    SRNSKIADWPIVAMLPGLARNVHRVHDFIAEVLAESGGTFVFRGPVFGNTDMLVTSDPAN  61

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            +H+ILS+NF N+ KGP F++IFD+LGDGIF  + + WE  R+   +   +  FH  +   
Sbjct  62   VHYILSKNFHNFGKGPDFKKIFDILGDGIFAAEFESWEKQRRAAKAAVGNLAFHQFVART  121

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            VW KV   L+P+L S +E E   DLQ  F+R  FDT    VL
Sbjct  122  VWGKVSETLVPMLRSASENEETIDLQTTFERLAFDTTCMQVL  163



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 0/176 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            F    C++ +       + +P+ W ++GMLPGLL+  HR H +VTD+L++S  TF+FKGP
Sbjct  10   FFAFICFLSLIFCLRKNNGLPKNWPLIGMLPGLLFQVHRFHDWVTDVLEQSKCTFQFKGP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
              G++D+L+T DPANIH+I S NFSN+ KG  F + FD+LGDGI N D  LW+  RK   
Sbjct  70   WFGDMDILVTADPANIHYITSSNFSNFEKGSDFNKRFDILGDGIINADRDLWKSQRKVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  NH  F+  L   +  KV+ GL+P+L+   +Q    DLQD+FQRFTFD    +V
Sbjct  130  ALVNHRLFYQRLVKTIQDKVERGLIPVLEHVYKQSLVLDLQDLFQRFTFDATCVIV  185



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W ++GMLPGLL    R++ F+TD+L+     F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITDVLEGGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQKFSLATSLSKLEKG  155

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+PLLD  A+++   DLQDVFQRFTFDT
Sbjct  156  LVPLLDHVAKEKLVVDLQDVFQRFTFDT  183



>gb|EYU41727.1| hypothetical protein MIMGU_mgv1a023193mg, partial [Erythranthe 
guttata]
Length=401

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  312  ILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFN  491
            IL E GGTF+ + P + N+DMLIT DP NI HI S+NF+NYPKG QFR+IFD+LGD IFN
Sbjct  42   ILSECGGTFQMRFPRIFNMDMLITSDPLNIDHIFSKNFANYPKGRQFREIFDILGDSIFN  101

Query  492  VDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQR  671
            VD +LWEF RKTT SF     F++LLE+ VW KV+NGLLP+LD F + +  FDLQDVFQR
Sbjct  102  VDDELWEFQRKTTHSFMTGPEFNSLLESVVWQKVENGLLPVLDYFLQGDIGFDLQDVFQR  161

Query  672  FTFDTIS*LVL  704
            FT+D+I  L L
Sbjct  162  FTYDSICKLAL  172



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A+++   DLQDVFQRFTFDT
Sbjct  153  EKGLVPLLDHVAKEKLAVDLQDVFQRFTFDT  183



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            +CY K   E +    IP  W  VGMLP LL + H+LH + T ILKE+G  F F GP    
Sbjct  31   YCYRKRMNEGT---GIPVNWPFVGMLPALLVHLHQLHDWGTMILKETGCNFFFHGPWYSG  87

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +DMLITCDPAN++H+ S NF NYPKG  F +IFDVLGDGIFN D++ W   R    S  N
Sbjct  88   MDMLITCDPANVYHVFSANFHNYPKGDDFSEIFDVLGDGIFNSDAESWRRQRMKAHSLIN  147

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
               F   +  +   KV+ GL+PLLD  AEQE   DLQDVF R TFDT   LV
Sbjct  148  DRRFRAFVAQSSRSKVEKGLIPLLDQLAEQEVAVDLQDVFLRLTFDTTCYLV  199



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 122/194 (63%), Gaps = 2/194 (1%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            M S A + +    M+   L   C++ ++  S + S +P  W V+GMLP LL N H +H +
Sbjct  1    MTSMAFMGMGYFEMLLLSLAVVCFIYLRRLSRNDSPLP-DWPVLGMLPSLLRNIHHVHDW  59

Query  303  VTDILKESGG-TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGD  479
             T +L++S   TF F+GP L  +DM+ TCDPAN+H+I+S +FSN+PKGP+F+ IFDVLGD
Sbjct  60   TTKLLEQSRSYTFTFRGPWLAGMDMVWTCDPANVHYIMSTHFSNFPKGPEFKNIFDVLGD  119

Query  480  GIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQD  659
            GIFN DS LW+  RK      +   F   LE      V+ GL+P+LD  +EQ    DLQD
Sbjct  120  GIFNSDSDLWKTQRKVAHGLISRRRFCRFLERTSRKNVEEGLIPVLDHISEQGMIVDLQD  179

Query  660  VFQRFTFDTIS*LV  701
            VFQRFTFD+   L+
Sbjct  180  VFQRFTFDSTCTLI  193



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 121/187 (65%), Gaps = 4/187 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA   LL   + F+ FSF+  +  +  K   S  +     W +VGMLPGLL    R++ +
Sbjct  1    MALITLLEASIYFLFFSFISGYFLISKKPHRSFMT----DWPIVGMLPGLLVEIPRIYDY  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T++L+ S  T+ FKGP  G LDML+T DPANIH+I+S NF+NYPKG +FR++FDVLGDG
Sbjct  57   LTELLEASNLTYPFKGPCSGGLDMLVTIDPANIHYIMSSNFANYPKGSEFRKLFDVLGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN DS+LW+  RK+     +H  F          K++ GL+PLLD  A+++   DLQDV
Sbjct  117  IFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKGLVPLLDCVAQKKLVVDLQDV  176

Query  663  FQRFTFD  683
            FQRFTFD
Sbjct  177  FQRFTFD  183



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHLQFYKFLVKTSR  146

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             KV+ GL+P+LD   ++ +  DLQD+FQRFTFDT   LV
Sbjct  147  EKVEKGLIPVLDYICDKGSIVDLQDLFQRFTFDTTCILV  185



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 114/175 (65%), Gaps = 5/175 (3%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +  F   FCY+       +++ IP  W ++GMLP LL NA+R+H+F+ ++++ S  TF F
Sbjct  6    VLIFFVLFCYL-----FRNKNGIPTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHF  60

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP   N+++L+T DP NIHH+LS+ F NY KGP+  +I + LGDGI   DS LW +HR 
Sbjct  61   KGPWFSNMNLLLTIDPTNIHHVLSKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRN  120

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
               SFFNH  FH  L    W KV+NGL+P+L+  ++     DLQD+F RF++DT+
Sbjct  121  VAHSFFNHPKFHQSLVDVTWKKVKNGLIPVLEHVSKHNIVIDLQDLFLRFSYDTM  175



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S  P  W + GMLPG LY+  ++H+  T  ++ SGGTF FKGP   N+DML T DPAN+H
Sbjct  27   SKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPANVH  86

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RKTT +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHQQFYKFLVKTSR  146

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             KV+ GL+P+LD   ++ +  DLQD+FQRFTFDT   LV
Sbjct  147  DKVEKGLIPVLDYICDKGSIVDLQDLFQRFTFDTTCILV  185



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 110/167 (66%), Gaps = 0/167 (0%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            FC++   +      + P  W  +GMLPGLL    R++ FVT+ L+++   F FKGP  G 
Sbjct  14   FCFLIFLISKKRHRSFPTNWPFLGMLPGLLVEIPRVYDFVTEFLEDANLNFLFKGPFWGG  73

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            LDML+T DPANIHHI+S NF+NYPKG +F+++FD+LGDGIFN DS+LW   RK+  S   
Sbjct  74   LDMLVTVDPANIHHIMSSNFANYPKGTEFKKLFDILGDGIFNADSELWNDLRKSAQSMMM  133

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +  F          K++ GLLPLLD  A+++   DL+DVFQRFTFDT
Sbjct  134  NPKFQKFSLATSLSKLEKGLLPLLDHVAKEKLVVDLEDVFQRFTFDT  180



>ref|XP_010419318.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=363

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+ 
Sbjct  32   PRNWPVLGMLPGILITLHRINDYVAEVLEVSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K+
Sbjct  92   SSNFSNYSKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVLLSHQGFQSFSLRTITRKI  151

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +NG +P+LD FAE+   FDLQD FQR +FD    LV
Sbjct  152  KNGAVPVLDHFAEENMIFDLQDFFQRLSFDVTLTLV  187



>ref|XP_010436205.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=450

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W ++GMLPGL+    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLVPELPRVYDFLTEVLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFSLATSLSKLEKG  155

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+PLLD  A+++   DLQDVFQRFTFDT
Sbjct  156  LVPLLDHVAKEKLVVDLQDVFQRFTFDT  183



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W ++GMLPGLL    R++ ++T++L+ S  T+ FKGP  G LDML+T DPANIH+I+S N
Sbjct  37   WPILGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCFGGLDMLVTVDPANIHYIMSSN  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +FR++FDVLGDGIFN DS+LW+  RK+     +H  F          K++ G
Sbjct  97   FANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLEKG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFD  683
            L+PLLD  AE++   DLQDVFQRFTFD
Sbjct  157  LVPLLDCVAEKKLVVDLQDVFQRFTFD  183



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 110/160 (69%), Gaps = 0/160 (0%)
 Frame = +3

Query  204  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  383
            K + SS +  P  W + GMLPGLL N  R+H F+T++L+ SGGTF  KG    N+ MLIT
Sbjct  27   KDKKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFMTELLESSGGTFYLKGAWFANMSMLIT  86

Query  384  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  563
             DPAN+H+IL++NF N+ KGPQF+++FDVLGDGIFN +S+ WE  ++T  S  ++  F  
Sbjct  87   SDPANVHYILAKNFPNFEKGPQFKKMFDVLGDGIFNAESESWEIQKRTAKSLMHNTSFPD  146

Query  564  LLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFD  683
             +    W KV+N L+P+L+  +E   + DLQ++FQRF FD
Sbjct  147  FIARTSWSKVENALIPILELASETGTEVDLQELFQRFAFD  186



>ref|XP_010531420.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=514

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 0/168 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF    + +     +  PR W  +GMLPG+L   HR++ +  D+L+ S  TF FKGP   
Sbjct  17   CFLVFHILLNKKPHACFPRNWPFLGMLPGVLVVFHRVYDWAADVLEISDLTFTFKGPWFA  76

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +DML+T DP+NIHHI+S +FSNYPKGP+F+++FDVLGDGI NVDS LWE  RK+T S F
Sbjct  77   GIDMLVTVDPSNIHHIMSSHFSNYPKGPEFKEVFDVLGDGILNVDSDLWENLRKSTQSIF  136

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            NH  F          K++ GLLP LD  A++    D+QDV +R+ FDT
Sbjct  137  NHEGFKKFSFLANVKKLKTGLLPFLDQAAKENMVVDVQDVLERYIFDT  184



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = +3

Query  186  FCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            FC++  +   +   +    P  W   GM+PGLL   HR++ F+T+IL+ +  T+   GP 
Sbjct  14   FCFLLFRHFLINKKTHRLCPTNWPFFGMIPGLLVEIHRVYDFITEILEVTNLTYPCTGPC  73

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
              NLDML+T DPANIHHI+S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S
Sbjct  74   FANLDMLVTVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQS  133

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
               +  F          K++ GL+PLLD  A+++   DLQD+FQRFTFDT
Sbjct  134  MMMNPEFQKFSLATSLKKLEKGLVPLLDHVAKEKLAVDLQDMFQRFTFDT  183



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLP ++ N HR H  +T++L E G TF  +GP   + D+L T DPANI HI S+ FSNYP
Sbjct  1    MLPTIVRNLHRAHDKLTEVLIECGATFLLRGPWFFDTDILFTSDPANIQHIFSKRFSNYP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KG +FR  F++LGDG+F+ D +LWE  R+T LS  +HA FHT LE NVW K++ GL+P+L
Sbjct  61   KGSEFRNKFEILGDGVFSSDFELWELQRRTILSIISHAKFHTSLERNVWEKIETGLIPVL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            D F+ Q    DLQ++FQRF FD I  LVL
Sbjct  121  DYFSGQGIVVDLQEIFQRFAFDNICQLVL  149



>gb|KDO37445.1| hypothetical protein CISIN_1g036716mg, partial [Citrus sinensis]
Length=208

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 110/180 (61%), Gaps = 13/180 (7%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +F F+GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFIFIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
               S   H  F + LE  ++ K++NGL+P+LD  +E   + DLQDVFQRFTFD I   VL
Sbjct  113  MIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVL  172



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            SRS IP  W VVGMLP LL N HRLH + TD+L+E+G +F F+GP    ++ L+TCDPAN
Sbjct  43   SRSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCDPAN  102

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            +HH+   NFSNYPKG  F +IFD+LGDGIFN D Q W+  R    S  +   F T +  +
Sbjct  103  VHHVFGANFSNYPKGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFVADS  162

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
               KV+ GLLPL+   A++    DLQDVF R TFDT   LV
Sbjct  163  ARSKVEKGLLPLIHHIAQRGVAVDLQDVFLRLTFDTTCNLV  203



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 118/180 (66%), Gaps = 1/180 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            I  +L   CY +  +    +S++P  W ++GM+P LL N  RLHQ  T++L++SGGT  F
Sbjct  13   IVLYLMLLCY-RYAVGRKEKSSLPTNWPILGMIPALLKNIGRLHQVTTEVLEQSGGTIWF  71

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP   N+DM++T D AN+H+IL++NF N+ KGP+F++IFD+ GDGIF  + + WE  R+
Sbjct  72   KGPWFANMDMMVTSDRANVHYILTKNFPNFSKGPEFKKIFDIFGDGIFAAEHESWESQRR  131

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +T +      F  L+ T  W+KV+  L+P+++  +E   + D+Q++FQRF FD    LVL
Sbjct  132  STKALMMQPGFQELVATTSWNKVETSLIPIMELVSETGTEVDVQELFQRFAFDCSCILVL  191



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +GM+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFITEILEVTNLTYPCIGPCFANLDMLVTVDPANIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NF+NYPKGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSSNKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A+++   DLQD+FQRFTFDT
Sbjct  153  EKGLVPLLDHVAKEKLVVDLQDMFQRFTFDT  183



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 120/196 (61%), Gaps = 9/196 (5%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRL  293
            MA  +++  +  F IF  + CF   C +        RS +P  W  +GM PGLL++ +R+
Sbjct  1    MALISIMASIGYFEIFVAIFCFFVFCAL------GDRSGLPCNWPFLGMFPGLLFHVNRI  54

Query  294  HQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVL  473
            H+   ++   +GGT+  KGP   N+D+L T DPAN+H+I+S  F N+PKG +F++IFDVL
Sbjct  55   HERCFEVFSRTGGTYLLKGPWFANMDILGTVDPANVHYIMSAKFENFPKGEEFKKIFDVL  114

Query  474  GDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDL  653
            GDGIFN D  LW+  RK T +   H  FH  L    W K++NGL+ +L+  A +    DL
Sbjct  115  GDGIFNSDLDLWKTQRKITRTLITHQRFHNCLVKTSWDKIENGLISVLEFVARESKIVDL  174

Query  654  QDVFQRFTFDTIS*LV  701
            QDVFQRFTFDT   LV
Sbjct  175  QDVFQRFTFDTTCQLV  190



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +GM+PGLL   HR++ FVT++L+ +  T+   GP    LDMLIT DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTEVLEVTNLTYPCVGPCFAGLDMLITVDPANIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NF+NYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A+++   DLQD+FQRFTFDT
Sbjct  153  EKGLVPLLDHVAKEKLVLDLQDMFQRFTFDT  183



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W ++GMLPGLL    R++ F+T++L++    F FKGP LG LDML T DPANIHHI+S N
Sbjct  36   WPILGMLPGLLPELPRVYDFITELLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMSSN  95

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK + S  +H  F          K++ G
Sbjct  96   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKFSQSMMSHPEFQRFSLATSLSKLEKG  155

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+PLLD  A+++   DLQDVFQRFTFDT
Sbjct  156  LVPLLDHVAKEKIVVDLQDVFQRFTFDT  183



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
             S NF+NY KGP+F++IFD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FSSNFTNYDKGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++NG++P+LD FAE    FDLQDVFQR  FD    LV
Sbjct  151  IKNGVVPVLDHFAEANMIFDLQDVFQRLAFDVTLTLV  187



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 103/151 (68%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +GM+PGLL   HR++ FVTDIL+ +  T+   GP    LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCIGPCFAGLDMLVTVDPANIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   +  F          K+
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQRFSLATSLSKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A ++   DL+DVF RFTFDT
Sbjct  153  EKGLVPLLDHVANEKLVVDLEDVFSRFTFDT  183



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 108/171 (63%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C   +++ S S   +PRKW +VGMLP LL N    H + T +++ S G F F+ P
Sbjct  10   FLAGICLGVLRLLSKSDDGLPRKWPLVGMLPTLLLNLSHFHDWATGVVERSHGNFFFRLP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L +    K +NGLL +LD  +++    DLQD+F RFTFD+
Sbjct  130  VFMKDQRFHRFLSSTTRDKAENGLLMVLDELSQRGVTVDLQDLFHRFTFDS  180



>ref|NP_179782.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD20408.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07237.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 106/160 (66%), Gaps = 0/160 (0%)
 Frame = +3

Query  207  MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITC  386
            +   S    PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT 
Sbjct  23   IHKKSHQITPRNWPVLGMLPGVLVMLHRINDYVAEILEVSNLTFAFKGPWFSGMNMLITA  82

Query  387  DPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL  566
            DP+NI H+ S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F + 
Sbjct  83   DPSNIQHVFSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSF  142

Query  567  LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
                +  K++NGL+P+LD FAE    FDLQDVFQR  FD 
Sbjct  143  SLRTITCKIKNGLVPVLDHFAEANTVFDLQDVFQRLAFDV  182



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +3

Query  168  FSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFK  347
             +FL  F +    +        P  W  +G++PGLL   HR++ F+T+IL+ +  T+  K
Sbjct  11   IAFLCFFLFRHFLINKKPHRLCPTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCK  70

Query  348  GPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKT  527
            GP    LDML+T DP+NIHHI+S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+
Sbjct  71   GPCYAGLDMLVTVDPSNIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKS  130

Query  528  TLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
              S   H  F          K++ GL+PLLD  A ++   +L+DVFQRFTFDT
Sbjct  131  AQSMMMHPEFQKFSLATSMSKLEKGLVPLLDHVANEKLVVNLEDVFQRFTFDT  183



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W  +GMLPGLL    R++ F+T++L+++   + FKGP LG +DML T DPANIHHI+S N
Sbjct  37   WPFLGMLPGLLTQLPRVYDFLTEVLEDANLNYLFKGPFLGGIDMLFTVDPANIHHIMSSN  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK++ S  +H  F          K++ G
Sbjct  97   FANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFTLDTSLSKLEKG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+PLLD  A+++   DLQDVFQRFTFDT
Sbjct  157  LVPLLDHVAKEKLVVDLQDVFQRFTFDT  184



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W V+GMLPG+L   HR++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
             S NF+NY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FSSNFTNYDKGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQSFSLRTITRK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++NG++P+LD FAE    FDLQDVFQR  FD    LV
Sbjct  151  IENGVVPVLDHFAEANMIFDLQDVFQRLAFDVTLTLV  187



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
               +  F +       +K++ GL+PLLD  A+++   DLQDVFQRFTFD+
Sbjct  134  MMMNPEFQSFSIATSLNKLEKGLVPLLDHVAKEKLVVDLQDVFQRFTFDS  183



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 108/168 (64%), Gaps = 0/168 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF      +   S   +   W ++GMLP L+    R++ +  D+L+ S  TF FKGP L 
Sbjct  70   CFLIFGFLLFKKSNRDVLTNWPILGMLPSLVVQIPRVYDWSVDVLEASNLTFLFKGPWLA  129

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +D+L+T DPANIHHI+S NF NYPKG +F++IFDVLGDGIFNVDS LW+  RK+  + F
Sbjct  130  GMDLLVTVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDGIFNVDSDLWKDLRKSAQTMF  189

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            NH  F T        K++ GLLPLLD  +  +   DLQDVFQRFTFDT
Sbjct  190  NHQDFQTFTVRTSISKLEKGLLPLLDHVSGHDIVVDLQDVFQRFTFDT  237



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            FC++  ++   S+   P     W  +GMLPGLL    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
               +  F +       +K++ GL+PLLD  A+++   DLQDVFQRFTFD+
Sbjct  134  MMMNPEFQSFSIATSLNKLEKGLVPLLDHVAKEKLVVDLQDVFQRFTFDS  183



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 109/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPA  395
            SR+++ R   V+GMLPGLL N  RLH+F+T D+LK++ GTFEF GP    +D++IT DP 
Sbjct  29   SRNSLRRNRPVLGMLPGLLGNTWRLHEFLTHDVLKKNRGTFEFTGPWFAQMDLIITSDPM  88

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            N+H+I S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F + LE 
Sbjct  89   NVHYISSKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHNKFESALEN  148

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
                K++ GL+P+LD  +E     DLQDV +RF FD I  LVL
Sbjct  149  VAHQKLETGLIPVLDHASELGTVVDLQDVLKRFAFDNICMLVL  191



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +GM+PG+L   HR++ FVTDIL+ +  T+   GP+   LDML+T DPANIHHI+
Sbjct  33   PTNWPFLGMIPGMLAEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NF+NYPKGP+F+++FDVLGDGIFN DS LW+  RK+  +   +  F         +K+
Sbjct  93   SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQNMMMNPEFQKFSLATSLNKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A ++   DLQD+FQRFTFDT
Sbjct  153  EKGLVPLLDHAANEKLAVDLQDMFQRFTFDT  183



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 106/154 (69%), Gaps = 0/154 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI ++N
Sbjct  33   WPVVGMLPGLLFQAQNVHEYATQLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTKN  92

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++  K+  G
Sbjct  93   FVNYPKGPEYKKIFEPFGDGVLNSDFESWKSFRKLIHSMIKDNKFQVFLERSLREKIVKG  152

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            L+P+L+  + QE + D+QDVFQRFTFD I  LVL
Sbjct  153  LIPVLEHVSRQEIELDMQDVFQRFTFDNICLLVL  186



>ref|XP_010472325.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=282

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 103/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W  +GMLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S N
Sbjct  70   WLFLGMLPGFLMEIPRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSN  129

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  +          K++ G
Sbjct  130  FANYPKGSEFKKLFDVLGDGIFNADSELWKDLRKSAQSIMRNPEYQRFTLRTSMSKLEKG  189

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+P L+  AE++   DLQD+FQRFTFDT
Sbjct  190  LVPFLNHVAEKKLVVDLQDLFQRFTFDT  217



>gb|KFK30509.1| hypothetical protein AALP_AA7G271200 [Arabis alpina]
Length=447

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 102/143 (71%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLPGLL    R++ F T+IL+++   F FKGP LG LDMLIT DPANIHHI+S NF+NYP
Sbjct  1    MLPGLLVEIPRVYDFATEILEDANLNFPFKGPFLGGLDMLITVDPANIHHIMSSNFANYP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KG +F+++FDVLGDGIFN DS+LW+  RK+  S   +  F          K++ GLLPLL
Sbjct  61   KGTEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQNFSLATSLSKLEKGLLPLL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDT  686
            D  A+++   DLQDVFQRFTFDT
Sbjct  121  DHVAKEKLVVDLQDVFQRFTFDT  143



>emb|CDX72698.1| BnaC07g47200D [Brassica napus]
Length=449

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 116/182 (64%), Gaps = 7/182 (4%)
 Frame = +3

Query  162  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  320
            MI  FL  F        +  + +   +   +P  W+V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWSVLGMLPGLLLQVHRIYDWITELLE  62

Query  321  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  500
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  501  QLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTF  680
             +WE  R ++ + F+   F  L  +    K+  GL+P+LD+  E+    DLQDVFQRF F
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVPILDNAVEKNILVDLQDVFQRFLF  182

Query  681  DT  686
            DT
Sbjct  183  DT  184



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W V+GMLPG+L   HR++ +V ++L+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLIMLHRINDYVAEVLEVSSLTFVFKGPWFSGMNMLITADPANIQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
             S NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK++L   +H  F +     +  K
Sbjct  91   FSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSSLVVLSHQGFQSFSLRTITRK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++ G++P+LD FAE+   FDLQDVFQR  FD    LV
Sbjct  151  IKYGVVPVLDHFAEENKIFDLQDVFQRLAFDVTLTLV  187



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPR---KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            FC++  ++   S+   P     W  +GMLPGL+    R++ F+T++L+     + FKGP 
Sbjct  14   FCFLIFQIFLISKKPHPSFLTNWPFLGMLPGLILEIPRVYDFITEVLEHGNLNYLFKGPF  73

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
            LG LDML T DPANIHHI+S NFSNYPKG +F+++FDVLGDGIFNVDS+LW+  RK+  S
Sbjct  74   LGGLDMLFTVDPANIHHIMSSNFSNYPKGAEFKKLFDVLGDGIFNVDSELWKDLRKSAQS  133

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
               +  F +        K++ GL+PLLD  A+++   DL+D+FQRFTFDT
Sbjct  134  MMMNPEFQSFSIATSLSKLEKGLVPLLDHVAKEKLVVDLEDIFQRFTFDT  183



>gb|KDO55118.1| hypothetical protein CISIN_1g036278mg, partial [Citrus sinensis]
Length=316

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 103/157 (66%), Gaps = 1/157 (1%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            R   V+GMLPGLL N  RLH+F+T D+LK+  GTFEF GP    +D++IT DP N+H+I 
Sbjct  2    RNRPVLGMLPGLLGNTWRLHEFLTHDVLKKKRGTFEFTGPWFAQMDLIITSDPMNVHYIS  61

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S+NFSNYPKGP FR I + LGDG+FN D  LW+  RK   S   H  F + +E     K+
Sbjct  62   SKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHKKFESAVEKVAHQKL  121

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            + GL+P+LD  +E     DLQDV +RF FD I  LVL
Sbjct  122  ETGLIPVLDHASELGTVVDLQDVLKRFAFDNICMLVL  158



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 1/154 (1%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPANIHHILSR  419
            W ++GMLPGLL N  R+H+  T++L++S  GTF F+GP   N+DML T DP NIH+I++ 
Sbjct  34   WPLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVDPENIHYIMTS  93

Query  420  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  599
            NF N+PKGP+FR+IFDVLGDGIFN D   W+  R  + +   H  FH  L      KV+ 
Sbjct  94   NFRNFPKGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFLAVISREKVEK  153

Query  600  GLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            GL+P+L+  A +    DLQD+FQRFTFD+I  LV
Sbjct  154  GLIPVLEKAALENRVLDLQDLFQRFTFDSICQLV  187



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  341
            + F+F+   C +   +  ++   +P  W +VGMLP LL + HR H  VTD+L++S  TF+
Sbjct  9    IFFAFICVLCSLIFCLRKNN--VLPMNWPLVGMLPSLLVHVHRFHDHVTDVLEQSKCTFQ  66

Query  342  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  521
            FKGP  G++D+L+T DPANIH+I+S NFSN+ KG  F + FD+LG GI N D  LW+  R
Sbjct  67   FKGPWFGDMDILVTADPANIHYIMSSNFSNFEKGSDFNKRFDILGHGILNADRDLWKNQR  126

Query  522  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            K   +  NH  F+  L   +  KV+ GL+P+L+   +Q    DLQDVFQRF FD  S +V
Sbjct  127  KVAQALVNHRLFYQRLVKTIQDKVERGLIPVLEHVCKQSLVLDLQDVFQRFAFDATSMIV  186



>gb|KDO37689.1| hypothetical protein CISIN_1g047842mg [Citrus sinensis]
Length=465

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 112/183 (61%), Gaps = 1/183 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGT  335
             +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GT
Sbjct  1    MIIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWYFHEFLAHDVLKKNRGT  60

Query  336  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  515
            FEF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+ 
Sbjct  61   FEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKI  120

Query  516  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*  695
             RK   S   H  F + LE     K++ GL+P+LD  +E     DLQDV +RF FD I  
Sbjct  121  QRKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASELGTVVDLQDVLKRFAFDNICM  180

Query  696  LVL  704
            LVL
Sbjct  181  LVL  183



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 112/183 (61%), Gaps = 1/183 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVT-DILKESGGT  335
             +I  FL  F  + +    S R++  R W V+GMLPGLL N    H+F+  D+LK++ GT
Sbjct  1    MIIAIFLISFLIIVLHWSWSDRNSPMRNWPVLGMLPGLLANTWHFHEFLAHDVLKKNRGT  60

Query  336  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  515
            FEF GP    +D++IT DP N+H+I S+NFSNYPKGP FR I + LGDG+ N D  LW+ 
Sbjct  61   FEFTGPWFAQMDLIITSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKI  120

Query  516  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*  695
             RK   S   H  F + LE     K++ GL+P+LD  +E     DLQDV +RF FD I  
Sbjct  121  QRKIIHSVMKHNKFESALEKVAHQKMETGLIPVLDHASELGTVVDLQDVLKRFAFDNICM  180

Query  696  LVL  704
            LVL
Sbjct  181  LVL  183



>ref|XP_010027235.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
Length=237

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 106/171 (62%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+    +   S   +P+ W +VGMLP L  N  R H + T +L++S   F F+  
Sbjct  10   FLATICFAVFHLLGKSHDGLPKNWPLVGMLPALFLNLGRGHDWATGVLEQSRCNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +D+L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVTADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   F   L T    KV+NGLL +LD  +++  + DLQD+FQRFTFD+
Sbjct  130  VFMNDQRFCRFLATTTRDKVENGLLRVLDELSQRGVEVDLQDLFQRFTFDS  180



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNA-HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
            SR  +   W VVGM+PGLL+     +H F T +L+ SGGT  F+GP    ++ L+T DP 
Sbjct  23   SRGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWFSGMNFLMTSDPM  82

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            N+ +I+S+NF+NYPKGP FRQIF+VLGDGIFNVDS  W   R+   S      FH  +E 
Sbjct  83   NVQYIVSKNFANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRFHLAVER  142

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             V HK+  GL  +LD+ +E  ++ D+QDVFQRFTFD+I  L L
Sbjct  143  TVEHKILKGLFVVLDNVSELASEVDIQDVFQRFTFDSICILAL  185



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 115/183 (63%), Gaps = 10/183 (5%)
 Frame = +3

Query  162  MIFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  332
            ++F+ L CF   C+       S+ + +P  W +VGMLP + ++ +++H    +I ++ GG
Sbjct  11   ILFALLCCFLVWCF-------SNINGMPWNWPLVGMLPSVFWHVNQIHDRCVNIFEQVGG  63

Query  333  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  512
            TF  KGP   N+D++ T DPAN+H I+S NF+N+PKG +F++IFDVLGDGIFN D+ LW 
Sbjct  64   TFLLKGPWFANMDIIATADPANVHFIMSANFANFPKGAEFKKIFDVLGDGIFNSDADLWR  123

Query  513  FHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
              RK   +   H  F   L    W KV+ GL+P+L+  +EQ    DLQD+FQR TFDT  
Sbjct  124  SQRKQARALITHERFRKFLIKTSWEKVEKGLIPVLEHVSEQGMVIDLQDLFQRLTFDTTC  183

Query  693  *LV  701
             LV
Sbjct  184  ILV  186



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 105/149 (70%), Gaps = 0/149 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            M+P L  N HR   ++T+IL+ESGGTFEFKGP   N+DML+T DPAN++HILS++FSN+ 
Sbjct  1    MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F ++FD+LG GIFN + + WE  RKT +   NH  F   +    W+K++ GL+P+L
Sbjct  61   KGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITSWNKLEKGLIPVL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +  A+   + DLQ +F +FTFDT   LVL
Sbjct  121  ELAAKSGMEVDLQQLFAKFTFDTTCILVL  149



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W V+GMLPG+L+  H ++ +V +IL+ S  TF FKGP    ++MLIT DPANI H+
Sbjct  31   LPRNWPVLGMLPGVLFMLHMINDYVAEILEVSNLTFAFKGPWFTGMNMLITADPANIQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
               NFSNY KGP+F+++FD LG+GIF  DS+LWE  RK+ L   +H  F +     +  K
Sbjct  91   FCSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++NGL+P+LD F+E    FDLQDVFQR  FD    LV
Sbjct  151  IKNGLVPVLDHFSEANTVFDLQDVFQRLAFDVTLTLV  187



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W  +G++PGLL   HR++ F+T+IL+ +  T+  KGP    LDML+T DP+NIHHI+
Sbjct  33   PTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIM  92

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNYPKGP+F+++FDVLGDGIFN DS+LW+  RK+  S   H  F          K+
Sbjct  93   SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMSKL  152

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+PLLD  A ++   +L DVFQRFTFDT
Sbjct  153  EKGLVPLLDHAANEKLVVNLGDVFQRFTFDT  183



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  222  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  401
            ++ +P  W ++GMLP LL N HR+H F+ +I ++S  TF F GP   N+ +L+T DPANI
Sbjct  26   KTGLPTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPANI  85

Query  402  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  581
            HH++S+NF NYPKG +F ++FDVLGDGIFN D  +W++HRK    F  H  FH  L    
Sbjct  86   HHVMSKNFGNYPKGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFLVKKT  145

Query  582  WHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
              K++NGL+P+LD  +    + DLQD+F RFTFD 
Sbjct  146  REKLENGLIPVLDHVSLHGIEVDLQDLFARFTFDV  180



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F     T    K
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            ++NGL+PL D FA++    +LQDVFQRFTFDT
Sbjct  151  LKNGLVPLFDHFAKEGTTVNLQDVFQRFTFDT  182



>ref|XP_012075244.1| PREDICTED: alkane hydroxylase MAH1 [Jatropha curcas]
 gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            +++  P  W V GMLP  LY+ HR+HQ  T++L+ +G T  +KGP   N+ +L T DP N
Sbjct  24   NKNGQPINWPVFGMLPDTLYHLHRIHQRTTEVLERAGSTLYYKGPWFSNVKILATVDPTN  83

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            IH+I+S NFSN+PKGP+F +IFD+LGDGIFN DS  W+  RK   +  N   FH  L   
Sbjct  84   IHYIMSSNFSNFPKGPEFSKIFDILGDGIFNSDSNSWKNQRKLAHTLINRGCFHKFLINT  143

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                V+ GLLP+L+  ++Q+ + DLQD+FQRFTFD    LV
Sbjct  144  CQDMVEKGLLPVLEHVSDQDLEVDLQDLFQRFTFDITCALV  184



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA  +LL + + F+ FSFL  +  +  K   S     P KW ++GMLPGLL    R++ +
Sbjct  1    MALLSLLEVSVSFLCFSFLFGYFLISKKPHRS----FPTKWPLLGMLPGLLVEIPRVYDY  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T++L+ S  TF FKGP  G LDMLIT DPANIHHI+S NF+NYPKG +F++IFDVLGDG
Sbjct  57   ITEVLEASNLTFPFKGPSFGGLDMLITVDPANIHHIMSSNFANYPKGSEFKKIFDVLGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN DS LW+  RK+  S  +H  F          K++ GL+PLLD  AE++   DLQDV
Sbjct  117  IFNADSDLWKDLRKSAQSMMSHQEFQRFTLRTSMSKLEKGLVPLLDHVAEKKLVVDLQDV  176

Query  663  FQRFTFDT  686
            FQRFTFDT
Sbjct  177  FQRFTFDT  184



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
              +P  W VVGMLP  ++N HR+H+   ++L+++G TF + GP   N+ +L T DPANIH
Sbjct  26   KGMPINWPVVGMLPDTIFNFHRIHERFAEVLEQNGLTFLYAGPWFSNVKILGTVDPANIH  85

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +++S NF+N+PKG +F +IF++LGDGIFN DS  W+  RKT  +  NH  FH  L     
Sbjct  86   YVMSSNFANFPKGSEFSKIFNILGDGIFNSDSDSWKNQRKTAQALINHQRFHQFLVKTCR  145

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            + V+ GLLP+L+  A+QE+  DLQD+FQRFTFD    LV
Sbjct  146  NMVEKGLLPVLEHVADQESVMDLQDIFQRFTFDITCILV  184



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 112/176 (64%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
             L   C++ +   S+S + +P  W +VGMLP +  N  ++    T++L++S GTF  KGP
Sbjct  10   LLAVICFLLLHRLSNS-NMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFLLKGP  68

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+DMLIT DPAN+H+I+S NFSN+PKGP+F +IFDVLG+GIFN DS LW   RK   
Sbjct  69   WFANMDMLITSDPANVHYIMSTNFSNFPKGPEFLKIFDVLGEGIFNSDSDLWRKQRKLAQ  128

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
               N   F   L     +KV  GL+P+L+  ++Q    DLQD+FQRFTFDT   L+
Sbjct  129  VLINDRQFQQFLVKTTENKVDEGLIPVLEHVSKQGLLVDLQDLFQRFTFDTTCKLI  184



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 105/154 (68%), Gaps = 0/154 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W VVGMLPGLL+ A  +H++ T +LK+SGGTFEFKGP   N+++ +T DP N+ HI + N
Sbjct  33   WPVVGMLPGLLFKAQNIHEYATRLLKQSGGTFEFKGPWFANMNIFLTADPLNVRHISTTN  92

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F NYPKGP++++IF+  GDG+ N D + W+  RK   S      F   LE ++  K+  G
Sbjct  93   FVNYPKGPEYKKIFEPYGDGVLNSDFESWKSFRKLIHSMIKDNKFQVSLERSLREKIVEG  152

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            L+P+L+  + QE + D+QDVFQRFTFD I  LVL
Sbjct  153  LIPVLEHASRQEIELDMQDVFQRFTFDNICLLVL  186



>gb|KCW62188.1| hypothetical protein EUGRSUZ_H04845 [Eucalyptus grandis]
Length=415

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 105/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C++ + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFVVLCLLGKSDDGLPNNWPLVGMLPALCLNLSHVHDWATGILERSRCNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+P GP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPNGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   FH  L      KV+NGLL +LD  +++    DLQD+FQRFTFD+
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQRGVAVDLQDLFQRFTFDS  180



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            M+PGLL   HR++ F+T+IL+ +  T+   GP   NLDML+T DPANIHHI+S NF+NYP
Sbjct  1    MIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F+++FD+LGDGIFN DS+LW+  RK+  S   +  F          K++ GL+PLL
Sbjct  61   KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDT  686
            D  A+++   DLQD+FQRFTFDT
Sbjct  121  DHVAKEKLAVDLQDMFQRFTFDT  143



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            + R W V+GMLP LL   HR++ F+ +IL+ S  TF+FKG     +DMLIT DPANIH+I
Sbjct  31   LARNWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYI  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NFSNY KGP+F+++FDV  D IFN DS+LW+  RK   S  NH  F     T    K
Sbjct  91   LSSNFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            ++NGL+PL D FA++    +LQDVF+RFTFDT
Sbjct  151  LKNGLVPLFDHFAKEGTTVNLQDVFRRFTFDT  182



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 108/171 (63%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C++ +++ S S   IPR W +VGMLP LL N    H + T +++ S G F F+  
Sbjct  10   FLAGICFLVLRLLSKSDDGIPRNWPLVGMLPALLLNLSHFHDWATGVVERSQGNFFFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +++L+T DPAN+H+I+S NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMEILLTADPANVHYIMSTNFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L   +  K +NGLL +LD  +++    DLQD+F RFTFD+
Sbjct  130  VFMKDQRFHQFLSLTIRDKAENGLLRVLDELSKRGVTVDLQDLFHRFTFDS  180



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +3

Query  285  HRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIF  464
            HR H+ +T +L E GGT+  +GP    +++L T DPANI HI S+ FSNYPKG +FR  F
Sbjct  2    HRAHEKITQVLNERGGTYLLRGPWFFRIEILFTSDPANIQHIFSKRFSNYPKGTEFRNKF  61

Query  465  DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQ  644
            ++LGDGIF+ D ++WE  R+T LS  +HA FHT LE NVW K++ GL+P+LD F+ Q   
Sbjct  62   EILGDGIFSSDFEMWELQRRTILSLISHAKFHTSLERNVWEKIETGLIPVLDYFSGQGIV  121

Query  645  FDLQDVFQRFTFDTIS*LVL  704
             DLQ++FQRF FD I  LVL
Sbjct  122  VDLQEIFQRFAFDNICQLVL  141



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 105/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   FH  L      KV+NGLL +LD  +++    DLQD+FQRFTFD+
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQRGVAVDLQDLFQRFTFDS  180



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = +3

Query  207  MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITC  386
            M+   RS  P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T 
Sbjct  26   MKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTV  84

Query  387  DPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL  566
            DPANIHHI+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F   
Sbjct  85   DPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRF  144

Query  567  -LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             L TN+  K++ GL+P+LD FAE++   DLQDVFQRFTFDT
Sbjct  145  TLRTNM-RKLEKGLVPILDHFAEKKLVLDLQDVFQRFTFDT  184



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 105/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  + +   S   +P  W +VGMLP L  N   +H + T IL+ S   F F+  
Sbjct  10   FLAVICFAVLCLLGKSDDGLPNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKGP+F+++FDVLGDGIFN DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   FH  L      KV+NGLL +LD  +++    DLQD+FQRFTFD+
Sbjct  130  VFMNDQRFHRFLAKTTRDKVENGLLRVLDELSQRGVAVDLQDLFQRFTFDS  180



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = +3

Query  207  MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITC  386
            M+   RS  P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T 
Sbjct  26   MKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTV  84

Query  387  DPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL  566
            DPANIHHI+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+  S  +   F   
Sbjct  85   DPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRF  144

Query  567  -LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             L TN+  K++ GL+P+LD FAE++   DLQDVFQRFTFDT
Sbjct  145  TLRTNM-RKLEKGLVPILDHFAEKKLVLDLQDVFQRFTFDT  184



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 108/169 (64%), Gaps = 0/169 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF  +   +        PR W V+GMLPGLL + HRL+ +  +IL+ S  TF  KGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVLGMLPGLLVSLHRLYDYSVEILEISDLTFLLKGPRFF  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +DML+T DPANIHHI+S NFSNY KGP+F  +FDV GDGI   DS+LW   R++  +  
Sbjct  75   GMDMLVTVDPANIHHIMSSNFSNYIKGPEFHDVFDVFGDGILTADSELWRNLRRSYQAMV  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
            +H  F     + +  K+++GL+PLL+ FAE+    DLQD+F RFTFDTI
Sbjct  135  HHQGFQKFSVSTMTSKLKDGLVPLLNHFAEEGTTVDLQDLFGRFTFDTI  183



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 116/176 (66%), Gaps = 0/176 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            F+  F ++      ++++ +PR +  +GM P LL N HR+H+ +T++L ++GGTF  KGP
Sbjct  16   FIAIFFFLVFWAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKTGGTFLLKGP  75

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+DML T DP N+H+I+S N SN+PKGP+F++IFD  GDGIFN D  LW+   K   
Sbjct  76   WFTNMDMLGTVDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDGIFNSDFDLWKKQSKYAK  135

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                +  +H  L   +  KV++GL+P+LD  A+++  FDLQD+F+R TFDTI  +V
Sbjct  136  ELVINQKYHKCLIKTINDKVKDGLIPILDFMAKEDKIFDLQDIFKRLTFDTICKVV  191



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 111/181 (61%), Gaps = 15/181 (8%)
 Frame = +3

Query  165  IFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  341
            +F  +GC +C+ +     SSR+          ML  L+ N H+LH+F T +LK+S GT E
Sbjct  15   LFILIGCLWCFKR-----SSRTR---------MLSTLVLNTHQLHEFATRVLKKSRGTLE  60

Query  342  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  521
            FKGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  R
Sbjct  61   FKGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQR  120

Query  522  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            K   S   H  F + LE  ++ K++NGL+P+LD  +E   + DLQDVFQRFTFD I   V
Sbjct  121  KMIHSVMKHKKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSV  180

Query  702  L  704
            L
Sbjct  181  L  181



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 109/180 (61%), Gaps = 13/180 (7%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +F  +GC    K     SSR+          ML  L+ NAH+LH+F T +L++S GT EF
Sbjct  6    LFILIGCLWSFK----RSSRTR---------MLSTLVLNAHQLHEFATRVLQKSRGTLEF  52

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP    +D +IT DP N+H+I S+NFSNYPKGP  R I +  GDG+F  D  LW+  RK
Sbjct  53   KGPWFAKMDFIITSDPMNVHYISSKNFSNYPKGPDLRMILEPFGDGVFAADGNLWKMQRK  112

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
               S   H  F + LE  ++ K++NGL+P+LD  +E   + DLQDVFQRFTFD I   VL
Sbjct  113  MIHSVMKHNKFESALEKTIYQKLENGLIPVLDHASEVGIKVDLQDVFQRFTFDNICMSVL  172



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 108/183 (59%), Gaps = 11/183 (6%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+ F F+ CF          + + +P  W VVGMLP L  + HR+H    DILK +GGTF
Sbjct  16   FIFFLFVWCF---------RNINGLPWNWPVVGMLPSLFCHLHRVHHRCVDILKLAGGTF  66

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
              KGP   N D++IT DPANIH I+S NF+N+PKGP F++IFDVLGDGIFN DS  W   
Sbjct  67   HLKGPSFANSDIIITADPANIHFIMSSNFANFPKGPHFKEIFDVLGDGIFNADSDSWARQ  126

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQF--DLQDVFQRFTFDTIS  692
            RK   +   H  F   L      KV++ L+P+L+           DLQD+FQRFTFDT  
Sbjct  127  RKQARALITHDSFRRFLIRTTSEKVRHSLIPVLEQVCNNSRGIVVDLQDLFQRFTFDTTC  186

Query  693  *LV  701
             LV
Sbjct  187  VLV  189



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 105/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  +++   S   +P+ W +VGMLP L  N  R+H +VT  L+ S G F F+  
Sbjct  10   FLAAICFAFLRLLGKSHDGLPKNWPLVGMLPALFLNLGRVHDWVTGFLERSHGNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDMWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   F   L      KV+NGLL +LD  +++    DLQD+FQRFTFD 
Sbjct  130  VFMNDRRFCRFLAKTTRDKVENGLLRVLDELSQKGVAVDLQDLFQRFTFDA  180



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 102/148 (69%), Gaps = 0/148 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            M  GLL++ HR+H    +IL+++G TF FKGP   N+DML T DPAN+H+I+S NFSN+P
Sbjct  1    MFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KG +FR++F+VLGDGIFN D + W   RK   S  N+  FH  L    ++KV+ GL+PLL
Sbjct  61   KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            D  +EQ    DLQDVFQR TFDT   LV
Sbjct  121  DHLSEQGRVVDLQDVFQRLTFDTTCMLV  148



>ref|XP_006404644.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
 gb|ESQ46097.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
Length=513

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W ++GMLPG++   HR++ ++ +IL+ S  TF FKGP    ++MLIT DPAN+ H+
Sbjct  31   LPRNWPLLGMLPGVVVMLHRINGYLAEILEVSNLTFVFKGPWFSGMNMLITADPANVQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
             S NFSNY KG +F+++FD LG+GIF  DS+LWE  R+++L   +H  F +     +  K
Sbjct  91   FSSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSLVMLSHQGFQSFSLKTIASK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++NGL P+LD FAE    FDLQDVFQR  FD    LV
Sbjct  151  IKNGLAPVLDHFAEANTVFDLQDVFQRLAFDVTLTLV  187



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 108/174 (62%), Gaps = 1/174 (1%)
 Frame = +3

Query  186  FCYMKM-KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            FC M      +  R  I   + ++GMLP LL+N  R H F T++LK+ GGT EF GP   
Sbjct  16   FCIMYFFHRRACCRYPILTDYPILGMLPQLLFNLSRCHDFFTEVLKQKGGTGEFTGPWFT  75

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
            N++ L+T DP N+HHI+S++F NY KGP FR IF+  G+GIF  DS+ W+++R    S F
Sbjct  76   NMNYLVTSDPLNVHHIMSKSFHNYVKGPVFRDIFEAFGEGIFTADSETWKYNRDLFHSLF  135

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
                F   LE  +  KVQN LLP+LD   +Q +  DLQDVF RFTFD I  +VL
Sbjct  136  KQKSFEMFLEKTIHKKVQNSLLPVLDHVHQQGSVVDLQDVFNRFTFDNICSIVL  189



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 111/182 (61%), Gaps = 10/182 (5%)
 Frame = +3

Query  165  IFSFLGCF---CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  335
            IF  + CF   CY+       +R  IP  W  +GMLP +L + HR H    DIL+ +  +
Sbjct  10   IFLAVVCFFLICYL-------TRHGIPWNWPFLGMLPSILIHLHRTHHRCVDILQGNNCS  62

Query  336  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  515
            F FKGP   N+D L+T DPANI HI+S NF+NYPKG +F +IFD+LG+GIFN D +LW+ 
Sbjct  63   FLFKGPWFANMDFLMTVDPANIQHIMSSNFTNYPKGEEFLKIFDILGNGIFNSDGELWKL  122

Query  516  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*  695
             RK T +  NH  F   L    ++KVQ GL+P+L    +     DLQDVFQR TFDT   
Sbjct  123  QRKITRALINHRSFIRFLVKITYNKVQKGLVPILQHAYKDGLVIDLQDVFQRLTFDTTCL  182

Query  696  LV  701
            LV
Sbjct  183  LV  184



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S  P  + + GMLPGLLYN  ++H+  T  +K SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T S   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFLVKTSC  146

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             KV+ GL+P++D    +    DLQD+FQRFTFDT   LV
Sbjct  147  DKVEKGLIPVIDHVCNKGCVVDLQDLFQRFTFDTTCILV  185



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            + M++TCDPANIH+ILS+NFSNYPKGP+FR+IFD+LGDGIFN DSQLWE HR+ TLS  +
Sbjct  1    MHMVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRRVTLSLMH  60

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            H  F  +LE  VW KV+ GLLP+L + A+  +Q DLQD+FQRF FD+IS LVL
Sbjct  61   HPSFLKVLEVTVWDKVEKGLLPVLQNCAKTGSQLDLQDIFQRFAFDSISKLVL  113



>emb|CDY70656.1| BnaAnng34510D [Brassica napus]
Length=298

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+ F    CF   K     S   A+   W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFVCK----KSHNVALLENWPFLGMLPGILFNLPRIFDWLSEVHEANDMTF  68

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IF++LGDGI   D +LWE  
Sbjct  69   AFKGPWFSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFEILGDGIVAADMELWEDL  128

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RK+  + F+H +F  L  ++   K++N L+PLLD  AE+    DLQDVFQRF FDT S L
Sbjct  129  RKSGHALFHHQNFLKLTVSSTTSKLKNDLVPLLDQAAEENIVIDLQDVFQRFMFDTASIL  188

Query  699  V  701
            +
Sbjct  189  M  189



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = +3

Query  216  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
            + +  +PR W +VGMLP  + N HR ++ + ++++ SGG+F +K     + ++L T DPA
Sbjct  24   NKKKRLPRNWPLVGMLPDSIRNLHRPYERIAEVIQLSGGSFIYKSLWFFSPNVLNTVDPA  83

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            NIH+I+S NFSN+PKG  F +IFD+LGDGIFN DS LW+  RK      NH  F   L  
Sbjct  84   NIHYIMSSNFSNFPKGSMFSRIFDILGDGIFNADSHLWKNQRKLAHVLINHQQFQRFLVK  143

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            + W+KV+ GL+P+L+  A+Q +  DLQDVFQRFTFD  S LV
Sbjct  144  SSWNKVEKGLIPVLEHVAKQGSVVDLQDVFQRFTFDITSILV  185



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 102/161 (63%), Gaps = 0/161 (0%)
 Frame = +3

Query  222  RSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANI  401
            +  I  ++ ++GMLP LL+N  R H + T +L+  GGT EF GP   N+D L+TCDP N+
Sbjct  26   KHPILTEYPIIGMLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINV  85

Query  402  HHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNV  581
            HH+LS+NF NY KGP+FR IF   GDGIF  DS+ W++ R    S F    F   +   +
Sbjct  86   HHMLSKNFHNYVKGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTI  145

Query  582  WHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             +KV NGLLP+LD   +Q    DLQDVF RFTFD I  +VL
Sbjct  146  HNKVHNGLLPILDHVQQQGRVVDLQDVFNRFTFDNICSIVL  186



>emb|CDY53177.1| BnaA06g40560D [Brassica napus]
Length=518

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 101/150 (67%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLK  169

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PLL+ FAE+ A  DLQDVF R TFDT
Sbjct  170  SGLVPLLNHFAEEGAAVDLQDVFGRLTFDT  199



>emb|CDY53182.1| BnaA06g40610D [Brassica napus]
Length=465

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 114/182 (63%), Gaps = 7/182 (4%)
 Frame = +3

Query  162  MIFSFLGCF-------CYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILK  320
            MI  FL  F        +  + +   +   +P  W V+GMLPGLL   HR++ ++T++L+
Sbjct  3    MIIGFLDIFIAFIFFLVFRCLLLYKQTHKPLPTNWPVLGMLPGLLLQVHRIYDWITELLE  62

Query  321  ESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDS  500
             +G TF FKGP L   D+L+T DP NIH+ILS NF NYPKG +F++IF+V+GD IFN+DS
Sbjct  63   ATGMTFCFKGPWLSGTDILLTVDPVNIHYILSSNFVNYPKGMEFKKIFEVIGDAIFNIDS  122

Query  501  QLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTF  680
             +WE  R ++ + F+   F  L  +    K+  GL+ +LD+  E+    DLQDVFQRF F
Sbjct  123  GMWEDMRNSSHAIFSRQDFQRLWVSTSVSKINQGLVHILDNAVEKNILVDLQDVFQRFLF  182

Query  681  DT  686
            DT
Sbjct  183  DT  184



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 105/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  + + S S    PR W +VGMLP L  N  R+H + T +++ S G F F+  
Sbjct  10   FLAGICFAVLCLLSKSDDGFPRNWPLVGMLPALFLNLSRVHDWATGLVERSHGNFFFRSL  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               ++DML+T DPAN H+I+S NF N+PKGP+F+++FD+LGDGI N DS LW   R+   
Sbjct  70   WFSSMDMLVTADPANFHYIMSANFGNFPKGPEFKRVFDILGDGIINSDSNLWSTQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L +    K +NGLL +LD  +++    DLQD+F RFTFD+
Sbjct  130  VFMKDQRFHRFLLSTTRDKAENGLLRVLDELSQRGVTVDLQDLFHRFTFDS  180



>emb|CDX76962.1| BnaC08g35480D [Brassica napus]
Length=510

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR W ++GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DPAN+ H+ 
Sbjct  32   PRNWPILGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F +     +  K+
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +NGL+P+LD FA++   FDLQDVFQR  FD    LV
Sbjct  152  KNGLVPVLDHFAKENMVFDLQDVFQRLAFDVTLTLV  187



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 107/174 (61%), Gaps = 1/174 (1%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF Y         R  +   + ++GMLP LL+N  R H + T +LK+ GGT EF GP   
Sbjct  16   CFLYF-FHRRQCCRHPLFTDFPILGMLPQLLFNLWRAHDYSTQVLKQRGGTAEFTGPWFT  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             ++ L+T DP N+HH++S++F NY KGP FR+IF   GDGIF  DS+ W+++R    S F
Sbjct  75   KMNCLVTGDPINVHHVMSKSFPNYVKGPVFREIFQAFGDGIFTADSEAWKYNRNLFHSLF  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             H  F   LE  + +KVQN LLP+LD+  +Q    DLQDVF RFTFD I  +VL
Sbjct  135  KHRSFEVFLEKTIHNKVQNTLLPMLDNLQQQGRVVDLQDVFNRFTFDNICSMVL  188



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = +3

Query  207  MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITC  386
            M+   RS  P  W  +GMLPGLL    R++ ++T+ L+ S  TF FKGP    ++ML T 
Sbjct  26   MKKPHRS-FPTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTV  84

Query  387  DPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTL  566
            DPANIHHI+S NF+NYPKG +F++IFDVLGDGIFN D  LW   RK+     +   F   
Sbjct  85   DPANIHHIMSSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQCMMSRPEFQRF  144

Query  567  -LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             L TN+  K++ GL+P+LD FA+++   DLQDVFQRFTFDT
Sbjct  145  TLRTNM-RKLEKGLVPILDHFAKKKLVLDLQDVFQRFTFDT  184



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 113/177 (64%), Gaps = 1/177 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKES-GGTFEFKG  350
             L   C++ +    ++    P+ + +VGM+PGLL N HR+H + T+IL+     T+ F+G
Sbjct  10   LLAIICFLFLFCLRNNVHGTPKNFPLVGMMPGLLLNTHRIHDWCTEILERCQCSTYLFQG  69

Query  351  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  530
            P    ++ML+TCDPANIH+I+S NF N+PKG +F++IFD+LGDGIFN D  LW+  RK  
Sbjct  70   PWFAKMNMLVTCDPANIHYIMSSNFCNFPKGSEFKEIFDILGDGIFNADMDLWKKQRKAA  129

Query  531  LSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
              F  H  F+  L      KV+ GL+P+L+  A++    +L+DVFQRF FD+   LV
Sbjct  130  QGFMRHQLFYLFLLRTSRAKVEKGLIPVLEHVAKRGLVLNLEDVFQRFAFDSTCILV  186



>ref|XP_010444891.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=214

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+GM+PG L   HR++ F  +I + +  TF F GP    +DML T DPANIH+ILS
Sbjct  33   RSWPVLGMIPGFLLELHRIYDFGVEIFETADLTFLFTGPWFTGMDMLFTVDPANIHYILS  92

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L  +    K+ 
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQYMLNHQGFQKLSMSTTRRKLY  152

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PLLD   E+E   DLQ+VF+RFTFDT
Sbjct  153  DGLVPLLDQCCEEEKVVDLQEVFKRFTFDT  182



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            RKW V+GMLP LL   HR++++  +I++ S  TF+FKGP    +DML T DPANIHHI+S
Sbjct  33   RKWPVLGMLPSLLMVLHRMYEYGIEIMEFSDLTFQFKGPWFVGMDMLFTVDPANIHHIMS  92

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NF NY KGP F+ +FDV GDGI   DS+LW+  RK+  +  +H  F     + +  K++
Sbjct  93   SNFPNYIKGPDFQDVFDVFGDGIITTDSELWKDLRKSYQAMVHHQGFQRFSMSTMTSKLK  152

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
            +GL+PLLD FAE+    +LQDVF RFTFDTI
Sbjct  153  DGLVPLLDHFAEEGTTVNLQDVFGRFTFDTI  183



>ref|XP_006405689.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
 gb|ESQ47142.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
Length=538

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+GMLPGLL   H++++F   IL++S  TF FKGP    +DML T D ANIHHI+S
Sbjct  46   RNWPVLGMLPGLLVEFHQIYEFTVRILRKSNLTFTFKGPWCSGMDMLFTVDQANIHHIMS  105

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP F+++FDVLGDGI   DS+LW+  RK +   F+H  +     +    K+ 
Sbjct  106  SNFSNYTKGPDFKEVFDVLGDGILTADSELWKNLRKASKVMFSHQGYQRFSMSTTRRKIN  165

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PL D FA++    DLQDVF RFT DT
Sbjct  166  DGLVPLFDHFAKEGTVVDLQDVFVRFTSDT  195



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLP L+  A+ LH   T++ + +GGTF FKGP   N+D L+T DPANIHHI+S NF N+P
Sbjct  1    MLPNLILYANWLHDNCTNVARLAGGTFLFKGPWFFNMDTLLTVDPANIHHIMSGNFPNFP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F+++FDVLGDGIFN D  LW+  RKTT    NH  FH  L      KV+ GL+P+L
Sbjct  61   KGPKFKEMFDVLGDGIFNADMDLWKSQRKTTRFLINHHRFHQFLVKTSRDKVEKGLIPVL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            D   +     DLQD+FQRFTFDT   LV
Sbjct  121  DHLCKTGQVLDLQDLFQRFTFDTTCKLV  148



>emb|CDY29171.1| BnaC09g15680D [Brassica napus]
Length=437

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 4/181 (2%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+ F    CF   K     S   A+ + W  +GMLPG+L+N  R+  +++++ + +  TF
Sbjct  13   FIFFLVFQCFFLCK----KSHNVALLKNWPFLGMLPGILFNIPRIFDWLSEVHEANDMTF  68

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
             FKGP     DML T DP NI+H+LS NF NYPKGP+F++IFD+LGDGI   D +LWE  
Sbjct  69   AFKGPWYSGTDMLFTVDPRNINHMLSSNFPNYPKGPEFKKIFDILGDGIAAADMELWEDL  128

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*L  698
            RK+  + F+H +F  L  ++   K++N L+PLLD  AE+    DLQDVFQRF FDT S L
Sbjct  129  RKSGHALFHHQNFLKLTVSSTTSKLKNDLVPLLDQAAEENVVIDLQDVFQRFMFDTASIL  188

Query  699  V  701
            +
Sbjct  189  M  189



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 104/159 (65%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            S  P  + + GMLPGLLYN  ++H+  T  ++ SGGTF FKG    N+D L T DPAN+H
Sbjct  27   SNYPINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPANVH  86

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +I+S NF N+PKGP+F+++FDVLG+GIFN D  +W+  RK T +   H  F+  L     
Sbjct  87   YIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFLVKTSR  146

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             KV+ GL+P++D    +    DLQD+FQRFTFDT   LV
Sbjct  147  DKVEKGLIPVIDHVCNKGCVVDLQDLFQRFTFDTTCILV  185



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 119/195 (61%), Gaps = 8/195 (4%)
 Frame = +3

Query  117  ITMASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLH  296
            ++MAS  LL + L  +  +   CF   K ++        P  W +VGMLP  + N HR +
Sbjct  7    LSMASLGLLEIFLAIVALAIFRCFGNKKKRL--------PTNWPLVGMLPDSIQNLHRPY  58

Query  297  QFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLG  476
            + + ++++ SGG+F +K     +  +L T DPANIH+I+S NFSN+PKG  F +IFD+LG
Sbjct  59   ERIAEVIQLSGGSFIYKSLWFLSPHVLNTVDPANIHYIMSSNFSNFPKGSMFSRIFDILG  118

Query  477  DGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQ  656
            DGIFN DS LW+  RK      NH  F   L  + W KV+ GL+P+L+  A+Q +  DLQ
Sbjct  119  DGIFNADSHLWKNQRKLAHMLINHQQFQRFLVNSSWSKVEKGLIPVLEQVAKQGSVVDLQ  178

Query  657  DVFQRFTFDTIS*LV  701
            DVFQRFTFD  S LV
Sbjct  179  DVFQRFTFDITSILV  193



>emb|CDY32582.1| BnaC03g15500D [Brassica napus]
Length=435

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 117/179 (65%), Gaps = 7/179 (4%)
 Frame = +3

Query  159  FMIFSFLGC-FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGT  335
            F+ F  L C F +M+      +++  P  W V+GMLPGLL   HR+H ++T +L+ +  T
Sbjct  14   FIFFLVLYCLFLHMR------TQTPFPTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMT  67

Query  336  FEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEF  515
            F  KGP     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE 
Sbjct  68   FRLKGPWGSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWEE  127

Query  516  HRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             R ++ + F+H  F +   +    K++ GL+P+L++ +E+    DLQD+FQRF FDT S
Sbjct  128  MRNSSHAIFSHQDFRSFSVSTSVSKLRQGLVPILENASEKNILVDLQDLFQRFLFDTSS  186



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK+  S  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLK  169

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PLL+ FAE+    DLQDVF R TFDT
Sbjct  170  SGLVPLLNHFAEEGTAVDLQDVFGRLTFDT  199



>emb|CDY38915.1| BnaA03g12640D [Brassica napus]
Length=232

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 115/174 (66%), Gaps = 5/174 (3%)
 Frame = +3

Query  174  FLGCFC-YMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKG  350
            FL  +C ++ M+    +++     W V+GMLPGLL   HR+H ++T +L+ +  TF  KG
Sbjct  17   FLVLYCLFLHMR----TQTPFLTNWPVLGMLPGLLLQIHRIHDWLTQVLEAANMTFRLKG  72

Query  351  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  530
            P     D+L+T DP N+H+ILS +F NYPKG +F++IF+ LGDGIFNVDS LWE  R ++
Sbjct  73   PWRSGTDILVTVDPVNVHYILSSHFVNYPKGEEFQKIFEFLGDGIFNVDSGLWEDMRNSS  132

Query  531  LSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             + F++  F +   +    K++ GL+P+L++ +E+    DLQD+FQRF FDT S
Sbjct  133  HAIFSNKDFQSFSVSTSVSKIRQGLVPVLENASEKNILVDLQDLFQRFLFDTSS  186



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 104/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  +++   S   +P+ W +VGMLP L  N   +H +VT  L+ S G F F+  
Sbjct  10   FLATICFAFLRLLGKSHDGLPQNWPLVGMLPALFLNLGSVHDWVTSFLERSRGNFLFRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML+T DPAN+H+I+S NF N+PKG +F+++FDVLGDGI N DS +W   R+   
Sbjct  70   WFSGMDMLVTADPANVHYIMSTNFENFPKGAEFKRVFDVLGDGILNSDSDVWRMQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   F   L      KV+NGLL +LD  +++    DLQD+FQRFTFD 
Sbjct  130  VFMNDQRFCQFLAKTTRDKVENGLLRVLDELSQRGVAVDLQDLFQRFTFDA  180



>ref|XP_009117361.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
 emb|CDY63371.1| BnaA09g55910D [Brassica napus]
Length=510

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR W V+GMLPG+L   H+++ ++ ++L+ S  TF FKGP    ++MLIT DP N+ H+ 
Sbjct  32   PRNWPVLGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPENVQHVF  91

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KG +F+++FD LG+GIF  DS+LWE  R++++   +H  F +     +  K+
Sbjct  92   SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +NGL+P+LD FA++   FDLQDVFQR  FD    LV
Sbjct  152  KNGLVPVLDHFAKENMVFDLQDVFQRLAFDVTLTLV  187



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 98/155 (63%), Gaps = 0/155 (0%)
 Frame = +3

Query  240  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  419
            ++  VGMLP +L N    H + T +LK+ GGT EF GP   N++ L+TCDP N+HH+LS+
Sbjct  34   EYPFVGMLPQVLCNLWHAHDYSTQVLKQHGGTAEFGGPWFTNMNYLVTCDPLNVHHMLSK  93

Query  420  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  599
            NF NY KGP+FR IF   GDGIF  D + W++ R    S F H  F  LLE  +  KVQN
Sbjct  94   NFHNYVKGPEFRDIFQAFGDGIFTADGEAWKYSRDLFHSLFKHKSFEVLLEKTIHKKVQN  153

Query  600  GLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             LLP+LD   +Q    DLQD+F RFTFD I   VL
Sbjct  154  SLLPVLDHVQQQGRVVDLQDLFNRFTFDNICSTVL  188



>gb|KFK30510.1| hypothetical protein AALP_AA7G271300 [Arabis alpina]
Length=501

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 114/177 (64%), Gaps = 0/177 (0%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  341
            ++ +FL    +        +R  +   W V+GMLPGLL N  R++  +T++L+ +G T+ 
Sbjct  8    ILIAFLFFLVFQGFLHHKKTRRHLATNWPVLGMLPGLLVNLPRIYDCITEVLEAAGMTYH  67

Query  342  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  521
            FKGP L   D+L+T DPANI ++LS NF NY KG +F++IF+ LGDGIFNVDS+LWE  R
Sbjct  68   FKGPWLSRTDILLTADPANIQYVLSSNFVNYHKGLEFQEIFEFLGDGIFNVDSELWEDMR  127

Query  522  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             ++ + F+H  F     +    K++ GL+P+L+S  E+    DLQD+FQRF FDT S
Sbjct  128  NSSHAMFSHQEFQKFSVSTTLSKLKQGLVPILESAVEENIIVDLQDLFQRFLFDTTS  184



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 105/176 (60%), Gaps = 1/176 (1%)
 Frame = +3

Query  177  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            L CF Y         R  +   + ++GMLP LL+N  R H F T+ILK  G T EF GP 
Sbjct  15   LFCFLYF-FHRRLCCRHPLLTDYPILGMLPQLLFNLWRAHDFFTEILKRHGPTGEFTGPW  73

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
              ++D L+TCDP N+HH+LS+NF NY KGP+FR IF   GDGIF  D + W+++R    S
Sbjct  74   FTSMDYLVTCDPINVHHMLSKNFHNYVKGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHS  133

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             F    F   L   + +KV NGLLP+LD   +Q    DLQDVF RFTFD I  +VL
Sbjct  134  LFKQKSFEVFLVKTIHNKVHNGLLPILDHVQQQGRVVDLQDVFNRFTFDNICSIVL  189



>emb|CDY44658.1| BnaA08g06820D [Brassica napus]
Length=502

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F          K
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSK  152

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  GL+P+L++  E+    DLQD+F RF FDT S L+
Sbjct  153  LNQGLVPILENAVEKNIIVDLQDLFHRFLFDTSSILI  189



>ref|XP_009107985.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=502

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +P  W V+GMLPGLL + +R++  +T++L+ S  TF FKGP L   D+LIT DPANI +I
Sbjct  33   LPTNWPVLGMLPGLLVHINRIYDAITELLEASNMTFCFKGPWLSGTDILITVDPANIRYI  92

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NF NYPKG +F+QIF+VLGD IFNVDS+LWE  R ++ + F+H  F          K
Sbjct  93   LSSNFDNYPKGMEFKQIFEVLGDSIFNVDSELWEDMRNSSHAIFSHQDFQRFWVNTSVSK  152

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  GL+P+L++  E+    DLQD+F RF FDT S L+
Sbjct  153  LNQGLVPILENAVEKNIIVDLQDLFHRFLFDTSSILI  189



>emb|CDX72691.1| BnaC07g47130D [Brassica napus]
Length=243

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 105/169 (62%), Gaps = 0/169 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF  +   +        PR W VVGMLP LL + H+L+ +  +IL+ S  TF FKGP   
Sbjct  15   CFLILFYLLFKKPHDRFPRNWPVVGMLPRLLVSLHQLYDYGVEILEISDLTFLFKGPRFF  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +DML T DPANI HI+S NFSNY KG  F+ +FDV GDGI   DS+LW+  RK+  +  
Sbjct  75   GMDMLFTVDPANILHIMSSNFSNYIKGSDFQDVFDVFGDGIITTDSELWKNLRKSYQAMV  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
            +H  F     + +  K+++GL+PLL+ FAE+    DLQD+F R TFDTI
Sbjct  135  HHQEFQRFSMSTMISKLKDGLVPLLNHFAEEGTTVDLQDLFGRLTFDTI  183



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (67%), Gaps = 0/156 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P+ W +VGMLP +L++   +H  +T I+  +GGTF  KGP+   +D+L T DP+N+H+I+
Sbjct  31   PKSWPIVGMLPSMLFHLKHIHDRLTVIMSVTGGTFVPKGPLFAEMDILATVDPSNVHYIM  90

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S+NF N+PKG +F+++FDVLGDGIFN D  LW+  RKTT S   H  F+  L      KV
Sbjct  91   SQNFMNFPKGKKFKELFDVLGDGIFNADMDLWKIQRKTTRSLVTHQQFYKFLIKTSRDKV  150

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            + GL+ +LD    +    DLQD+FQRFTFDT   LV
Sbjct  151  EKGLVNVLDHVCNKGVIVDLQDLFQRFTFDTTCILV  186



>gb|KJB71270.1| hypothetical protein B456_011G113900 [Gossypium raimondii]
Length=506

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 117/188 (62%), Gaps = 8/188 (4%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA   +L +L+ F+ F FLGC          +S+   P  + +VGM+P LL N HR+H +
Sbjct  1    MAFVGILGILIAFICFLFLGCL--------KNSKDGQPINFPLVGMMPQLLLNVHRIHDW  52

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
             T+IL+    T  F GP    ++ L+TCDPAN+H+++  NF N+PKG  F +IF++LGDG
Sbjct  53   CTEILQMCHCTSLFMGPWFTQMNFLLTCDPANVHYVMISNFHNFPKGSDFMEIFEILGDG  112

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN D  LW++ RK    F  H  FH LL T    KV+NGL+P+L+  A++    +L+DV
Sbjct  113  IFNADMDLWKYQRKVAQEFVRHQLFHRLLSTASRAKVENGLIPVLEHVAKRGLVVNLEDV  172

Query  663  FQRFTFDT  686
             QRFTFD+
Sbjct  173  LQRFTFDS  180



>ref|XP_011658477.1| PREDICTED: alkane hydroxylase MAH1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 0/158 (0%)
 Frame = +3

Query  228  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  407
            A+P  W +VGM P ++ + HR H  +T++++E G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIVGMTPSVVTHIHRSHDRITEVIQEVGSTFFFKGVWFSGMDFLLTADPSNIHH  93

Query  408  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  587
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +   F   LE    +
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDEKFLQFLEKITLN  153

Query  588  KVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            KV+ G++P+LD   E  +  DLQD+FQRF+FD+   +V
Sbjct  154  KVKTGIVPVLDGVCENGSVLDLQDLFQRFSFDSTCMMV  191



>ref|XP_012075243.1| PREDICTED: alkane hydroxylase MAH1-like [Jatropha curcas]
 gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 109/161 (68%), Gaps = 0/161 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            +++ +P  W + GMLP  LY+ HRL++++T+ ++ +G TF +KGP   N+ +LIT DP N
Sbjct  24   NKNGLPINWPIFGMLPETLYHLHRLYEWLTEKIERAGLTFFYKGPWFSNVKILITVDPTN  83

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            +H+++S NFSN+PKG +F +IFD+LGDGIFN DS  W+  RK   +  N   FH  L   
Sbjct  84   VHYVMSSNFSNFPKGSEFSKIFDILGDGIFNADSHSWKTQRKLVQTLINRGCFHNFLIEA  143

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                V+ GL+P+++  ++Q++  DLQD+FQRFTFD    LV
Sbjct  144  CQEMVEKGLVPVIEHASDQDSVVDLQDLFQRFTFDITCELV  184



>ref|XP_009783405.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=520

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 107/159 (67%), Gaps = 0/159 (0%)
 Frame = +3

Query  225  SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIH  404
            + +PR +  +GM PGLL +  ++H+    +L  +GGTF  KG    N D L T DPAN+H
Sbjct  35   NGLPRNYPFLGMFPGLLLHIQKIHESSAKLLPRAGGTFLLKGLWFTNTDTLCTLDPANVH  94

Query  405  HILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVW  584
            +I+S NFSN+PKGP+F++IFD LGDGIFN D  LWE  RK       +  +H  L   + 
Sbjct  95   YIMSTNFSNFPKGPEFKKIFDFLGDGIFNSDFDLWENQRKYARELIINQRYHKCLVKTIE  154

Query  585  HKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +KV++GL+P+L+  A+++  FDLQDVF+RFTFDTI  +V
Sbjct  155  NKVKDGLIPILEFMAKEDRIFDLQDVFKRFTFDTICKIV  193



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +P  W ++GM P +  + HR+H  VTDIL++SG TF  KGP   N+D+L+T DPAN+H+I
Sbjct  43   LPWNWPLLGMFPSVFLHLHRIHDRVTDILEKSGCTFLVKGPWFCNMDLLVTTDPANVHYI  102

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            +S +FSN+PKG +F +IFD LGDGIFN D++ W   RK      N+   +  L     +K
Sbjct  103  MSSHFSNFPKGSEFSKIFDFLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFLGKITQNK  162

Query  591  VQNGLLPLLDSFAEQEAQ-FDLQDVFQRFTFDTIS*LV  701
            V+ GLLP+LD  +EQE +  DLQDVFQR TFDT   LV
Sbjct  163  VEKGLLPILDYLSEQEDRAMDLQDVFQRLTFDTTCMLV  200



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            F Y+  K    +  + P  W V+GMLPG+L   HR++ F  ++L+ S  TF+FKGP    
Sbjct  28   FSYLLTK---KTLGSYPWNWPVLGMLPGILLRLHRIYDFSVEVLENSNLTFQFKGPWFVA  84

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +D L T DPAN+HHI+S NFSNY KGP F +IF+  GDGI N DS+LW   R +    FN
Sbjct  85   MDALATVDPANVHHIMSSNFSNYIKGPIFHEIFEAYGDGIINSDSELWRNWRNSAQIIFN  144

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFD  683
            H  +     +    K+++GL+PLL+ FA++E   DLQDVFQRF FD
Sbjct  145  HQRYQNFSTSTTRSKLKDGLVPLLNHFADEEMVVDLQDVFQRFMFD  190



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 110/178 (62%), Gaps = 5/178 (3%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+ F    CF   K      ++   P  W V+GMLP LL+   R++  +T++L+ +  TF
Sbjct  14   FIFFLVFQCFLLHK-----KTQRPFPTNWPVLGMLPALLHQVPRIYDCITEVLEAADMTF  68

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
             FKGP L   D+LIT DPANIH+ILS NF NYPKG +FR IF  LGD IFNVD +LWE  
Sbjct  69   HFKGPWLSRTDILITVDPANIHYILSSNFVNYPKGMEFRNIFKELGDSIFNVDWELWEDL  128

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
            R +  + F+H  F  +  +    K++ GL+P+L++  E+    DLQD+FQRF +DT S
Sbjct  129  RNSAHAIFSHQEFQKISVSTSMSKLKQGLVPILENAVEENILVDLQDLFQRFLYDTSS  186



>gb|EYU27555.1| hypothetical protein MIMGU_mgv1a020397mg [Erythranthe guttata]
Length=503

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 114/173 (66%), Gaps = 1/173 (1%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
             CY K+   +      P  W V+GMLPG L N  R H+++T++L+++GGTF  KGP   N
Sbjct  10   LCYGKI-FHARKEKRTPTNWPVLGMLPGALANIGRPHEYITEVLQQNGGTFYHKGPWFTN  68

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            L+++ TCDP N+H+I ++NFSN+ KGP+F+++FD++G+GI   +S+ WE  R++  S  N
Sbjct  69   LNIMFTCDPVNVHYIQAKNFSNFQKGPEFKKMFDIMGEGILTAESESWENQRRSAKSLIN  128

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            +  F   + T   +K++  L+P+L+  +E   + D+Q++F+R TFD+   LVL
Sbjct  129  NTSFLEFVATTTSNKMETALIPILEVASETGLEVDMQELFERLTFDSSCILVL  181



>emb|CDY39927.1| BnaA09g15090D [Brassica napus]
Length=496

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKNWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLELS  145

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             ++   K++ GL+P LD+ A ++   DLQDVF+RF FDT S L+
Sbjct  146  VSSNTSKLKEGLVPFLDNAAHEKIVIDLQDVFKRFMFDTSSILM  189



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 105/176 (60%), Gaps = 1/176 (1%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F + S L   C+    +   + +  P  W  +GMLP LL   H+++ +  D+L+ S  TF
Sbjct  25   FFLISLLAI-CFFFFFINKKTHAVFPTNWPFLGMLPALLQMLHQIYDYSADLLESSNMTF  83

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
              KGP    +DMLIT DPANIHHI+S NF NY KGP+F ++F+V G+ IFN DS LW+  
Sbjct  84   LLKGPWFAGIDMLITVDPANIHHIMSSNFLNYTKGPEFNEVFEVFGEAIFNTDSDLWKDK  143

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            RK+     NH  F     +   +K++ GL+PLLD  A+     DLQDVFQRF FDT
Sbjct  144  RKSAQVMLNHHGFQRFTLSTTVNKIKKGLVPLLDHAAKLNVALDLQDVFQRFAFDT  199



>emb|CDX83711.1| BnaC07g24510D [Brassica napus]
Length=222

 Score =   155 bits (393),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 98/143 (69%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLPGLL   HR++ F  ++L+ S  TF+FKGP+L  +DML+T DPANIH++LS NF NY 
Sbjct  1    MLPGLLMVLHRIYDFTVELLENSNLTFQFKGPLLSGMDMLVTVDPANIHYMLSSNFLNYN  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F++IFDV  D IFNVD++LW   RK       H  F  L  +    K++NGL+P+ 
Sbjct  61   KGPEFKEIFDVFKDVIFNVDAELWYNSRKAAEGILRHQGFARLSVSATRSKLKNGLVPVF  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDT  686
            D FA++    + QDVF+RFTFDT
Sbjct  121  DHFAKEGMVLNFQDVFRRFTFDT  143



>ref|XP_010526618.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=513

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR    +GMLPGLL    R +    D+L++S  TF FKGP    +D+L T DPANIHH++
Sbjct  32   PRNLPFLGMLPGLLVAFDRFYDLAVDVLEKSNMTFPFKGPWFMGMDVLATVDPANIHHVM  91

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NF NYPKG  F++IFDV+GDGI NVD +LWE  RK+TL+ F+H  F          KV
Sbjct  92   SSNFGNYPKGDDFKEIFDVIGDGIINVDGELWENLRKSTLAIFSHEGFKRFSIIANVKKV  151

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            + GL+P LD  A++    DLQDV +R+ FDT
Sbjct  152  KKGLIPFLDHVAKENMVVDLQDVLERYVFDT  182



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 103/171 (60%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  +++ S     +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKRDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSRGNFFLRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +DML T DPAN+H+ILS NF N+PKGP+F+++FD+LGDGIFN DS LW   R+   
Sbjct  70   WFSGMDMLFTADPANVHYILSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L      K++NGLL +LD  +++    DLQD+FQRF  D+
Sbjct  130  VFMKDLRFHRFLLMTTRDKLENGLLRVLDELSQRGVTVDLQDLFQRFALDS  180



>ref|XP_009113344.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 110/164 (67%), Gaps = 0/164 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NIHHILS NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSVDLELWEDLRKSNHAMFHHPDFLELS  145

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             ++   K++ GL+P LD+ A +    DLQDVF+RF FDT S L+
Sbjct  146  VSSNTSKLKEGLVPFLDNAAHENIVIDLQDVFKRFMFDTSSILM  189



>ref|XP_007150920.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
 gb|ESW22914.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
Length=457

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 103/163 (63%), Gaps = 0/163 (0%)
 Frame = +3

Query  216  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
            S R  +   + ++GMLP +L N   +H F  ++LK  GGT EF GP   NL+ L+T DP 
Sbjct  26   SCRYPLYTDYPILGMLPEVLCNLWHIHDFSAEMLKSHGGTAEFIGPWFTNLNFLVTSDPL  85

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            N+HH+LS+NF+NY KGP+FR+IF   GDGIF  D++ W+++R    S F H  F   +E 
Sbjct  86   NVHHVLSKNFNNYIKGPEFREIFQAFGDGIFTTDAEAWKYNRDLFHSLFKHRSFEVFMEK  145

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             +   VQN LLP+LD   +Q    DLQD+F RFTFD I  +VL
Sbjct  146  TIRKTVQNSLLPILDHVQQQGRVVDLQDLFNRFTFDNICSIVL  188



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 104/171 (61%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C++   +   S   +P+ W +V MLP L  N  R H + T +L++S   F F+ P
Sbjct  10   FLAAICFVVFHLLGKSHDGLPKNWPLVRMLPALFLNLGRAHDWGTSVLEQSRCNFFFRSP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +D+L+  DPAN+H+I+S NF N+PKGP+F+++FD+LGDGI N DS +W   R+   
Sbjct  70   WFSGMDVLVAADPANVHYIMSTNFENFPKGPEFKRVFDILGDGILNSDSDMWRAQRRDAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F N   F   L      KV+NGLL +LD  +++  + DLQD+FQRFT D+
Sbjct  130  VFMNDQRFCRFLAKTTRDKVENGLLRVLDDLSQRGVEVDLQDLFQRFTLDS  180



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+ MLP L    HR++ +   IL+ S  TF FKGP    +DMLIT DPANIHHI++
Sbjct  33   RNWPVLRMLPALHMALHRIYDYSVKILEISNMTFPFKGPRFAGMDMLITVDPANIHHIMT  92

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP F+ +FDV GDGI   DS+LW+  RK+  +  +   F     + +  K++
Sbjct  93   SNFSNYIKGPAFQDVFDVFGDGIITTDSELWKNLRKSYQAMIHRQEFQRFSMSTMTRKLK  152

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
            +G++PLLD FAE+    DLQDVF RFTFDTI
Sbjct  153  DGIVPLLDHFAEKGTSVDLQDVFGRFTFDTI  183



>ref|XP_011657793.1| PREDICTED: alkane hydroxylase MAH1-like [Cucumis sativus]
 gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 103/157 (66%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG     +D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHI  94

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H +F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNK  154

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            V+ GL+P+LDS  E  +  DLQD+FQRF+FD+   +V
Sbjct  155  VKTGLVPILDSVCENGSVLDLQDLFQRFSFDSTCMMV  191



>emb|CDY13727.1| BnaA06g31960D [Brassica napus]
Length=463

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (63%), Gaps = 3/178 (2%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  332
            M F  +   C++ +    ++  + S I   W ++GMLPGL    HR++ F  ++L+ S  
Sbjct  1    MAFICIPIVCFLILLHFFIKKPNMSFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNL  60

Query  333  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  512
            TF+FKGP L  +DML T DPANIH++LS NF NY KGP+F++IFDV  D IFNVD++LW 
Sbjct  61   TFQFKGPWLSGMDMLATVDPANIHYMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWY  120

Query  513  FHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
              RK       H  F  +  +    K++NGL+P+ D FA++    +LQDVF+RFTFDT
Sbjct  121  NSRKAAEGILRHQGFPRVSMSATRRKLKNGLVPVFDHFAKEGMVMNLQDVFRRFTFDT  178



>ref|XP_004142037.2| PREDICTED: alkane hydroxylase MAH1-like [Cucumis sativus]
 gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 103/161 (64%), Gaps = 0/161 (0%)
 Frame = +3

Query  204  KMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLIT  383
            +  S+    +P  W ++GM+P L+ + HR+H  + ++L ES   F FKG    + D L+T
Sbjct  28   RWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFLLT  87

Query  384  CDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHT  563
             DP+N++HILS +F  YPKGP F  IFD+LGDGIFN DS +W+  RKT LS   H  FH 
Sbjct  88   ADPSNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESFHK  147

Query  564  LLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             LE     KV+ GL+P+L S  E  +  DLQD+FQRF+FD+
Sbjct  148  FLEKITLKKVKEGLVPVLQSACENGSVLDLQDLFQRFSFDS  188



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLP LL+N  R H + T +L+  GGT EF GP   N+D L+TCDP N+HH+LS+NF NY 
Sbjct  1    MLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+FR IF   GDGIF  DS+ W++ R    S F    F   +   + +KV NGLLP+L
Sbjct  61   KGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVHNGLLPIL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            D   +Q    DLQDVF RFTFD I  +VL
Sbjct  121  DHVQQQGRVVDLQDVFNRFTFDNICSIVL  149



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLPG L    R++ ++T++L+ S  T+ FKGP  GNLDML T DPANIHHI+S NF+NYP
Sbjct  1    MLPGFLMEISRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSNFANYP  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KG +F+++FDVLGDGIFN DS+LW+  R++  S  ++  +          K++ GL+P L
Sbjct  61   KGSEFKKLFDVLGDGIFNADSKLWKDLRQSAQSIMSNPEYQRFTLRTSMSKLEKGLVPFL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDT  686
            +  AE++   DLQD+FQRFTFDT
Sbjct  121  NHVAEKKLVVDLQDLFQRFTFDT  143



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +   L CF  ++   +     A  R W +VGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLRNNGGTSKF  68

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPKNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQ--FDLQDVFQRFTFDT  686
                F  +  +  L+E  +  K+  GL P+LD  + +E     D+QDV QRF +D+
Sbjct  129  MIQLFMKNNKYKELVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDS  184



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 108/181 (60%), Gaps = 1/181 (1%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  341
            +I + + C  Y   +         P  + ++GMLP +L N  R H  ++D+LK+ GGT E
Sbjct  9    VIVTAVLCMLYFLHRKRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGE  67

Query  342  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  521
            F GP    ++ LI+ DP N+HH++S+NF NY KGP FR IF   GDGIF  DS+ W+++R
Sbjct  68   FTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNR  127

Query  522  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                S F +  F   LE  + +KVQN LLP+LD   +Q    DLQDVF RFTFD I  LV
Sbjct  128  DLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLDHMHQQRKVVDLQDVFGRFTFDNICSLV  187

Query  702  L  704
            L
Sbjct  188  L  188



>gb|KFK32856.1| hypothetical protein AALP_AA6G295800 [Arabis alpina]
Length=509

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 102/157 (65%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            +PR W ++GMLPG+L   HR++ +V + L+ S  TF FKGP    ++ML+T DPANI H+
Sbjct  31   LPRNWPILGMLPGVLVVFHRINDYVAEALEVSNMTFAFKGPWFSGMNMLVTADPANIQHV  90

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
             S NFS+Y KG +F++IFD LG+GIF  DS+LWE  RK+ L   +H  F +        K
Sbjct  91   FSSNFSSYDKGSEFKEIFDFLGEGIFTADSKLWEELRKSALVMLSHQGFQSFSFRTFTSK  150

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            ++N L+P+LD FAE    FDLQ VFQR  FD    LV
Sbjct  151  IKNRLIPVLDHFAEANTVFDLQGVFQRLAFDVTLTLV  187



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 107/179 (60%), Gaps = 1/179 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            + SF+ CF +     +   RS +P  W V GMLPGLL    R++ +   +++E G TF F
Sbjct  14   LLSFV-CFVFCYYFCQIFRRSNVPVNWPVAGMLPGLLLRCRRIYDWGACLVREVGCTFVF  72

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            +GP L  ++ ++TCDPAN+ HI S  FSNYPKG +F +IFDVLGDGIFN D +LW+  R 
Sbjct  73   RGPWLLGMNYVLTCDPANLQHIFSAGFSNYPKGEEFSEIFDVLGDGIFNSDGELWKKQRM  132

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                  +   F + +  +   KV+ GL+PLLD  A Q    DLQDVF R TFD    LV
Sbjct  133  RAHGLISSRSFRSFVAGSSRRKVEQGLIPLLDGIARQGTVVDLQDVFLRLTFDNTCHLV  191



>gb|EAY88475.1| hypothetical protein OsI_09946 [Oryza sativa Indica Group]
Length=507

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 111/193 (58%), Gaps = 4/193 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFNVD   W   R           F   +      KV+  LLPLL  FA      +LQDV
Sbjct  117  IFNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFAATGESCNLQDV  176

Query  663  FQRFTFDTIS*LV  701
            F R TFDT + +V
Sbjct  177  FMRLTFDTTTMVV  189



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 101/151 (67%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            P  W V+GMLPG+L   HR++    ++L+ S  TF+FKGP    +D+L+T  PANIH+IL
Sbjct  41   PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  100

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KGP+F++IF+  GDGI N D +LW   RK +   F+H  +    ++    K+
Sbjct  101  SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKL  160

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            ++GLLP+L  FA +E   DLQDVFQRF FDT
Sbjct  161  KDGLLPILSHFAFEEMVVDLQDVFQRFMFDT  191



>gb|ABF93892.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
 gb|EAZ25522.1| hypothetical protein OsJ_09346 [Oryza sativa Japonica Group]
Length=507

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 111/193 (58%), Gaps = 4/193 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA A++L L L F+ FS    F Y  +K +  + +AIP  W ++GMLP LL N HR+H +
Sbjct  1    MAFASILQLALCFLCFSI---FSYNHIKSKRKN-TAIPVCWPLIGMLPDLLANRHRIHDW  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T +L  S   F F GP   N+ + ITCDPAN+ H+ + NFSNYPKGP F +IFD+ GDG
Sbjct  57   ITSLLTASQLNFRFTGPPSSNMRLFITCDPANVRHVFTSNFSNYPKGPDFTEIFDIFGDG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFNVD   W   R           F   +      KV+  LLPLL  FA      +LQDV
Sbjct  117  IFNVDGDSWRRQRAKAQLLTCRPRFRAFVSRCSRAKVEKALLPLLAHFAATGESCNLQDV  176

Query  663  FQRFTFDTIS*LV  701
            F R TFDT + +V
Sbjct  177  FMRLTFDTTTMVV  189



>ref|XP_009151941.1| PREDICTED: cytochrome P450 86A7-like [Brassica rapa]
Length=518

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (63%), Gaps = 3/178 (2%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMK---MESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGG  332
            M F  +   C++ +    ++  + S I   W ++GMLPGL    HR++ F  ++L+ S  
Sbjct  1    MAFICIPIVCFLILLHFFIKKPNMSFITTNWPLIGMLPGLFMVLHRVYDFTVELLESSNL  60

Query  333  TFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWE  512
            TF+FKGP L  +DML T DPANIH++LS NF NY KGP+F++IFDV  D IFNVD++LW 
Sbjct  61   TFQFKGPWLSGMDMLATVDPANIHYMLSSNFLNYNKGPEFKEIFDVFEDVIFNVDAELWY  120

Query  513  FHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
              RK       H  F  +  +    K++NGL+P+ D FA++    +LQDVF+RFTFDT
Sbjct  121  NSRKAAEGILRHQGFPRVSMSATRRKLKNGLVPVFDHFAKEGMVMNLQDVFRRFTFDT  178



>emb|CDY39926.1| BnaA09g15080D [Brassica napus]
Length=496

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             ++   K++ GL+P LD+ A +    DLQDVF+RF FDT S
Sbjct  146  ASSNTLKLKEGLVPFLDNAAHENIVIDLQDVFKRFMFDTSS  186



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 106/173 (61%), Gaps = 0/173 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF  +   +        PR W V+ MLP +L   HR++ +  +IL+ S  TF FKGP   
Sbjct  15   CFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVEILETSDLTFPFKGPRFT  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +DML+T DPANIHHI+S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  
Sbjct  75   GMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAML  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +   F     + +  K++ GL+PLL+ FAE+    DLQ VF RFTFDTI  LV
Sbjct  135  HSQEFQRFSMSTMTSKLKYGLVPLLNHFAEEGTTLDLQSVFGRFTFDTIFILV  187



>ref|XP_009113345.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=496

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 107/161 (66%), Gaps = 0/161 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    I + W V+GMLPG+L +  R+ ++  ++L+ +  TF FKGP L   DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFEWTFEVLEATNLTFFFKGPWLSGTDMLFTAD  85

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             ++   K++ GL+P LD+ A +    DLQDVF+RF FDT S
Sbjct  146  ASSNTLKLKEGLVPFLDNAAHENIVIDLQDVFKRFMFDTSS  186



>ref|XP_010432764.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DML+T DPANIHHI++
Sbjct  34   RNWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMT  93

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K++
Sbjct  94   SNFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRYSMSTMTRKLK  153

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +GL+PLLD FAE+    DLQDVF RFTFD I  LV
Sbjct  154  DGLVPLLDHFAEKGTTVDLQDVFGRFTFDIILILV  188



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 101/157 (64%), Gaps = 0/157 (0%)
 Frame = +3

Query  231  IPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHI  410
            IP  W +VGM P ++ + HR H  VT++L+++  TF FKG      D L T DP+NIHHI
Sbjct  35   IPWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHHI  94

Query  411  LSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHK  590
            LS NF  YPKGP F+ IF+VLGDGIFN DS +W+  RKT      H  F   LE    +K
Sbjct  95   LSANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKSQRKTAHHLVRHESFLQFLEKITLNK  154

Query  591  VQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            V+ GL+P+LDS  E  +  DLQD+FQRF+FD+   +V
Sbjct  155  VKTGLVPVLDSVCENGSVLDLQDLFQRFSFDSTCMMV  191



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +3

Query  288  RLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFD  467
            R++ +VT++L+ S  T+  KGP  G LDML+T DPANIH+I+S NF NYPKG +F++IFD
Sbjct  52   RVYDYVTELLEASNLTYPLKGPCFGGLDMLVTIDPANIHYIMSSNFENYPKGSEFKKIFD  111

Query  468  VLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQF  647
            VLGDGIFN DS+LW+  RK+T S  +H  F          K++ GL+PLLD  AE++   
Sbjct  112  VLGDGIFNADSELWKDLRKSTQSMMSHHDFQRFTLRTSMSKLEKGLVPLLDYVAEKKLVI  171

Query  648  DLQDVFQRFTFDT  686
            DLQDVFQRFTFDT
Sbjct  172  DLQDVFQRFTFDT  184



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 3/179 (2%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMKMESSSR-SAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            +I +FL  F +    +   SR S + + W ++GMLPGLL    R+     ++L+ S  TF
Sbjct  10   VIIAFLSFFVFQCFFLHKKSRESPLLKNWPILGMLPGLLVRIPRIFDCTAEVLEASNLTF  69

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
              KG  L   D+L+T DP NI+HILS NF NYPKGP+FR+IFD+LGDGI   DS+LWE  
Sbjct  70   AIKGAWLSGTDLLLTADPRNINHILSSNFRNYPKGPEFRKIFDILGDGILAADSELWEDL  129

Query  519  RKTTLSFFNHAHFHTL-LETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
            RK+  + F+H     + L +NV  K++ GL+P LD+ A++    DLQDV QRF FDT S
Sbjct  130  RKSGHTIFHHQDILEISLSSNV-SKLKKGLIPFLDNAADKNIIIDLQDVLQRFMFDTAS  187



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 108/181 (60%), Gaps = 1/181 (1%)
 Frame = +3

Query  162  MIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFE  341
            +I + + C  Y   +         P  + ++GMLP +L N  R H  ++D+LK+ GGT E
Sbjct  9    VIVTAVLCMLYFLHRKRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGE  67

Query  342  FKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHR  521
            F GP    ++ LI+ DP N+HH++S+NF NY KGP FR IF   GDGIF  DS+ W+++R
Sbjct  68   FTGPWFTIMNCLISSDPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNR  127

Query  522  KTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                S F +  F   LE  + +KVQN LLP+LD   +Q    DLQDVF RFTFD I  LV
Sbjct  128  DLFHSLFKNRSFEFFLEKTIQNKVQNSLLPMLDHMHQQRKVVDLQDVFGRFTFDNICSLV  187

Query  702  L  704
            L
Sbjct  188  L  188



>ref|XP_006405349.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
 gb|ESQ46802.1| hypothetical protein EUTSA_v10028238mg, partial [Eutrema salsugineum]
Length=544

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 106/167 (63%), Gaps = 3/167 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            FCY    +   +  + P  W V+GMLPG+L   HR + F  ++L+ S  TF+FKG     
Sbjct  52   FCY---SLIQKTLKSYPWNWPVLGMLPGVLVRLHRSYAFGVEVLESSNLTFQFKGLWFAG  108

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +DML+T DPANI++IL+ NFSNY KGP+F++IF+  GDGI N DS+LW   RK   + FN
Sbjct  109  MDMLVTVDPANINYILTSNFSNYIKGPEFKEIFEAFGDGILNTDSELWRELRKVAQATFN  168

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            H  +  L       K+ +GL+PL + FA++E   DLQD+F RF FDT
Sbjct  169  HQAYPNLSTFTTRSKLTDGLVPLFNHFAKEELVVDLQDLFMRFMFDT  215



>ref|XP_006405350.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
 gb|ESQ46803.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
Length=519

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 107/167 (64%), Gaps = 3/167 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            FC + ++    +  + P  W V+GMLPG+L   H ++ +  ++L+ S  TF+FKGP    
Sbjct  28   FCCLLIQ---KTHKSYPWNWPVLGMLPGVLLRLHHIYDYSVEVLECSNLTFQFKGPWFAG  84

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +D L+T D ANIH++L+ NFSNY KGP+F +IF+V GDGI N DS LW   RK + + FN
Sbjct  85   MDTLVTVDSANIHYMLTSNFSNYIKGPEFHEIFEVFGDGIVNSDSDLWRNLRKLSQATFN  144

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            H  F          K+ +GL+PLL+ FAE+E   DLQDVFQRF FDT
Sbjct  145  HQGFQNFSTFTTRSKLTDGLVPLLNHFAEEEMVVDLQDVFQRFMFDT  191



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DML+T DPANIHHI++
Sbjct  34   RNWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMT  93

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K++
Sbjct  94   SNFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAVLHRQEFQRFSMSTMTRKLK  153

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +GL+PLLD FAE+    DLQDVF RFTFD I  LV
Sbjct  154  DGLVPLLDHFAEKGTTVDLQDVFGRFTFDIILILV  188



>ref|XP_010681237.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=249

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +3

Query  315  LKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNV  494
            +++S  TF FKGP   N+ +L T DPANIHH++S+NF NYPKG  F +IFD+LGDGIFN 
Sbjct  1    MEKSRMTFVFKGPWFTNMHILATVDPANIHHVMSKNFGNYPKGSIFNEIFDILGDGIFNT  60

Query  495  DSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRF  674
            DS +W++HRK   SF  +  FH  L    W KV+NGL+P+LD  ++   + DLQD+F RF
Sbjct  61   DSTVWQYHRKMAQSFLGNPKFHEFLIKKTWDKVENGLIPILDHVSKHAIEIDLQDLFARF  120

Query  675  TFDTIS*LVL  704
            TFDTI  +V+
Sbjct  121  TFDTICTIVM  130



>ref|XP_006392374.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
 gb|ESQ29660.1| hypothetical protein EUTSA_v10023421mg [Eutrema salsugineum]
Length=497

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 102/153 (67%), Gaps = 0/153 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W  +GMLPG+L    R++ +  ++L+ +  TF FKGP     DML T DP NIHHIL+ N
Sbjct  37   WPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGTDMLFTADPKNIHHILNSN  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F NYPKGP+F++IFDVLGDGI   DS+LWE  RK+  + F+H  F  L  ++   K++ G
Sbjct  97   FGNYPKGPEFKKIFDVLGDGILTADSELWEELRKSNNTIFHHQDFMNLSVSSNTSKLKEG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            L+P LD+ A +    DLQDVF+RF FDT S L+
Sbjct  157  LVPFLDNAARENLTIDLQDVFKRFMFDTSSILM  189



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLP LL+N  R H F T+ILK  G T EF GP   N+D L+TCDP N+HH+LS+NF NY 
Sbjct  1    MLPQLLFNLWRAHDFFTEILKLHGPTGEFTGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+FR IF   GDGIF  D + W+++R    S F    F   L   + +KV NGLLP+L
Sbjct  61   KGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHSLFKQKSFEVFLVKTIHNKVHNGLLPIL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            D   +Q    DLQDVF RFTFD I  +VL
Sbjct  121  DHVQQQGRVVDLQDVFNRFTFDNICSIVL  149



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 105/173 (61%), Gaps = 0/173 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF  +   +        PR W V+ MLP +L   HR++ +   IL+ S  TF FKGP   
Sbjct  15   CFLILHYFLFKKPHGRYPRNWPVLRMLPAMLKALHRIYDYSVKILETSDLTFPFKGPRFT  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +DML+T DPANIHHI+S NFSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  
Sbjct  75   GMDMLLTVDPANIHHIMSSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAML  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +   F     + +  K++ GL+PLL+ FAE+    DLQ VF RFTFDTI  LV
Sbjct  135  HSQEFQRFSMSTMTSKLKYGLVPLLNHFAEEGTTLDLQSVFGRFTFDTIFILV  187



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 1/175 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            I + L CF Y+      S +  + R + ++GMLP +L+N  R+H F T++LK+ GGT EF
Sbjct  10   ITASLFCFLYL-FHRRRSCKHPLMRDYPILGMLPPILFNLWRIHDFCTEVLKKQGGTGEF  68

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP    +  LITCD  N+ H+L ++F NY KGP+FR+IF+  GDG+   DS+ W++ R 
Sbjct  69   KGPWFTKMHYLITCDSLNVQHMLCKSFDNYIKGPEFREIFEPFGDGVVTADSETWKYFRT  128

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
               S      F T ++  V  KV   LLP+LD   +Q    DLQDVF RFTFD I
Sbjct  129  VLHSLIKQRRFETFVDKTVQKKVHTSLLPILDHVQQQGEMVDLQDVFNRFTFDNI  183



>emb|CDX72690.1| BnaC07g47120D [Brassica napus]
Length=507

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R   V+ MLPGLL   HR+H F   IL+ SG TF FKGP    +DML+T DP NIHHI+S
Sbjct  50   RNLPVLRMLPGLLMTLHRVHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMS  109

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KGP  ++IFDV GDGIF  DS++W+  RK++ +  +H  F     + +  K++
Sbjct  110  SNFSNYIKGPGLQEIFDVYGDGIFTTDSEMWKNLRKSSQAMLHHQEFQRFSVSTMTSKLK  169

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             GL+PLL+ FA +    DLQDVF R TFDT
Sbjct  170  CGLVPLLNHFAVEGTAVDLQDVFGRLTFDT  199



>gb|KFK30522.1| hypothetical protein AALP_AA7G273500 [Arabis alpina]
Length=506

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 105/168 (63%), Gaps = 0/168 (0%)
 Frame = +3

Query  183  CFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLG  362
            CF   +  +         R W V+GMLPG L   HR++ F  ++L+++  TF FKGP   
Sbjct  15   CFLIFRFLIFKKPHDRFLRNWPVLGMLPGFLMVLHRIYDFSVEVLEKTDLTFPFKGPWFT  74

Query  363  NLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFF  542
             +D+L+T DPANIH+ILS NFSNY KG  F+++F+V G+ IFN D++LW+  RK      
Sbjct  75   GMDLLVTVDPANIHYILSSNFSNYTKGADFKEVFEVFGEMIFNSDAELWKNQRKAAQFML  134

Query  543  NHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            NH  F  L  +    K+++GL+PL +  +E+E   DLQDVFQR TFDT
Sbjct  135  NHQGFQKLSLSATRSKLKDGLVPLFNHLSEEEMVVDLQDVFQRLTFDT  182



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+ MLP LL   HR++ +   IL+ S  TF FKGP    +DMLIT DPANIHHI+S
Sbjct  33   RNWPVLRMLPALLKALHRIYDYSVKILETSDLTFPFKGPRFAGIDMLITVDPANIHHIMS  92

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             +FSNY KGP+F+ +FDVLGD     DS+LW+  RK+  +  +   F     + +  K++
Sbjct  93   SSFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHTQEFQRFSMSTMTSKLK  152

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +GL+PLL+ FAE+    DLQ VF RFTFDTI  LV
Sbjct  153  DGLVPLLNHFAEEGTTLDLQGVFGRFTFDTICILV  187



>ref|XP_010911437.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=523

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 105/172 (61%), Gaps = 4/172 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            +CY K K        IP  W  VGM P LL + H LH + T +LKESG TF F+GP    
Sbjct  30   YCYQKTK----KGPGIPVNWPFVGMFPALLAHLHHLHDWGTMVLKESGCTFFFRGPWFSG  85

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +DML TCDPAN+HH+ + NF NYPKG  F +IFD+LGDGIFN D++ W   R    S  +
Sbjct  86   MDMLFTCDPANVHHVFNANFLNYPKGDDFSEIFDILGDGIFNSDAESWRSQRMKAHSLIS  145

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
               F + +  +  +KV+ G++PLLD  A+QE   DLQDVF R TFD    LV
Sbjct  146  DQRFRSFVSQSSRNKVEKGVIPLLDQLAKQEVAVDLQDVFLRLTFDATCYLV  197



>ref|NP_001117509.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 gb|AEE33459.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=436

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 115/179 (64%), Gaps = 1/179 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  + F++  F  L  ++   K++ GL+P LD+ A++    +LQDVFQRF FDT S L+
Sbjct  130  SNHALFHNQDFIELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQDVFQRFMFDTSSILM  188



>gb|KEH22137.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 109/177 (62%), Gaps = 0/177 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
             L  F ++ +   S +R+    KW V+GMLPGLLYN   +H ++  +LK++GGTF F+GP
Sbjct  10   LLAVFLFLAIHYWSLNRNTPITKWPVLGMLPGLLYNMSNIHDYLNLVLKQNGGTFIFEGP  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
             L N+++L T DP N+ HI S  F NY KG  F +IF++LGDGIF  DS +W+++R    
Sbjct  70   WLTNMNILCTSDPMNVQHITSTKFENYGKGNDFSEIFEILGDGIFRSDSHIWKYNRTLLH  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            S F    F   +   +  K+ +GLL  LD   ++  Q DLQD+FQR TFD I  +VL
Sbjct  130  SIFKKESFQVFIHKTIEKKLFSGLLVFLDHACKKGMQVDLQDIFQRLTFDNICYIVL  186



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 109/172 (63%), Gaps = 2/172 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDIL-KESGGTFEFKG  350
            FL    +M + +  + R A+   W V+GMLP LL +  R+H   T+I+ K   GTF F+G
Sbjct  10   FLSVMWFMALWVWLNYR-ALAWNWPVIGMLPTLLLHVSRIHDNCTEIMGKSRRGTFHFRG  68

Query  351  PVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTT  530
            P L ++DM+ T DP N+H+I+S NF N+PKGP+FR+IFDVLGDGIFN DS+ W   R+  
Sbjct  69   PWLADMDMMGTADPENVHYIMSANFQNFPKGPKFREIFDVLGDGIFNADSESWRDQRRVA  128

Query  531  LSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             +  +H  F   L      KV+ GL+P+L++   +    DLQD+FQR TFDT
Sbjct  129  RALISHHGFLRFLAKISREKVEKGLIPVLETVCLENRVVDLQDLFQRLTFDT  180



>ref|XP_009123569.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
 emb|CDY41980.1| BnaA01g05520D [Brassica napus]
Length=503

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            + W V+GMLPG L   HR++ F  ++L+++  TF FKGP    +D+L+T DPANIH+ILS
Sbjct  33   KNWPVLGMLPGFLIVLHRIYDFSVEVLEQTNLTFPFKGPWFTGMDILVTVDPANIHYILS  92

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KG  F+++FDV G+ IFN D  +W   R+      NH  F  L  +    K+ 
Sbjct  93   SNFSNYTKGADFKEVFDVFGEMIFNSDGDMWRNQRRAAQYMLNHQGFQKLSMSATRAKLD  152

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PL D F+++E   DLQ+VFQRFTFDT
Sbjct  153  DGLVPLFDRFSKKEMVVDLQNVFQRFTFDT  182



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 106/176 (60%), Gaps = 2/176 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            +   L CF  ++   +     A    W VVGMLP LL N+  ++++ T  L+ +GGT +F
Sbjct  9    VVGVLVCFLLLRCWDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALRNNGGTSKF  68

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP   N+D +IT DP N+HHILS NF+NYPKGP +++IF+ LGDGI N DS+ W   RK
Sbjct  69   KGPWFANMDFVITSDPRNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRK  128

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQ--FDLQDVFQRFTFDT  686
                F  +  +  L+E  +  K+  GL P+LD  + +E     D+QDV QRF +D+
Sbjct  129  MIQLFMKNNKYKGLVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDS  184



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 105/162 (65%), Gaps = 0/162 (0%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            +R+    KW V+GMLPGLL+N   +H +V   LK++GGTF F+GP L N+++L T DP N
Sbjct  25   NRNTPMTKWPVLGMLPGLLHNVSNIHGYVDLTLKQNGGTFIFEGPWLTNMNILCTSDPMN  84

Query  399  IHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETN  578
            + HI S  F NY KG  FR+IF+VLG+GIF  DS +W+++RK   S F   +F   ++  
Sbjct  85   VQHITSTKFENYGKGNDFREIFEVLGEGIFRSDSHIWKYNRKLLHSIFKQGNFQVFIQKT  144

Query  579  VWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            V  K+ N LL  LD  ++   Q DLQD+FQR TFD I  +VL
Sbjct  145  VEKKICNYLLVFLDHASKNGVQVDLQDIFQRLTFDNICSVVL  186



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 104/169 (62%), Gaps = 2/169 (1%)
 Frame = +3

Query  177  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            L CF  +  ++  + R  +P  W VVG LP +  NA R+H++VT+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFRRL--NQRDGLPTNWPVVGALPAITVNAGRMHEWVTEFLRAAGLSYVMKGPW  78

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
               +D+++T DPAN+ H+ + NF NYPKG +F  +FDVLGDGIFN D + W F R+   +
Sbjct  79   GSPVDVIMTADPANVAHVFTSNFGNYPKGQEFAALFDVLGDGIFNADGESWAFQRRKAHA  138

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFD  683
              + A F   +  +   K+++ L+PLLD  A   A  DLQDVF R TFD
Sbjct  139  LLSDARFRAGVAASTARKLRDALVPLLDGIAASGAVVDLQDVFVRLTFD  187



>ref|XP_002868908.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45167.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
Length=994

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 0/158 (0%)
 Frame = +3

Query  216  SSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPA  395
            ++   +PR W V+GMLP LL    R++ ++ +IL+ S  TF FKGP+   +DML+T DPA
Sbjct  511  TTHGRLPRNWPVLGMLPCLLAVLRRIYDYIVEILEISDLTFSFKGPLFAGMDMLLTVDPA  570

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            NIHHI++ NFSNY KG  F+++FDV GDGI   DS LW+  RK+  +  +H  F     +
Sbjct  571  NIHHIMNSNFSNYIKGSDFKEVFDVFGDGIITTDSDLWKNLRKSYQAMLHHQAFQKFSLS  630

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
                K+ +GL+PLL+ FAE+    DLQDV  RFTFDT+
Sbjct  631  TTRSKLMDGLVPLLNHFAEEGTIVDLQDVLGRFTFDTV  668


 Score =   149 bits (375),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 1/150 (1%)
 Frame = +3

Query  237  RKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILS  416
            R W V+GM+ G L   HR++ F  + L+ S  TF FKGP    +DML T DPANIH+ILS
Sbjct  33   RNWPVIGMI-GFLMVLHRMYNFGVEALEISHLTFPFKGPWFAGMDMLFTVDPANIHYILS  91

Query  417  RNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQ  596
             NFSNY KG  F+++FDV G+ IF+ DS+LW+  RK      NH  F  L  +    K+ 
Sbjct  92   SNFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHHEFQKLSMSATRTKLY  151

Query  597  NGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +GL+PL + + E+E   DLQ VFQRFTFDT
Sbjct  152  DGLVPLFNQYCEEEKVVDLQQVFQRFTFDT  181



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 103/158 (65%), Gaps = 0/158 (0%)
 Frame = +3

Query  228  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  407
            A+P  W ++GM P ++ + +R H  +T++++E+G TF FKG     +D L+T DP+NIHH
Sbjct  34   AVPWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWFSGMDFLLTVDPSNIHH  93

Query  408  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  587
            ILS NF  YPKGP F+ IF+VLGDGIFN DS  W+  RKT  S  +  +F   LE     
Sbjct  94   ILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDENFLQFLEKITLK  153

Query  588  KVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            KV+  L+P+L S  E  +  DLQD+FQRF+FD+   +V
Sbjct  154  KVKTALVPVLQSVCENGSVLDLQDLFQRFSFDSTCMMV  191



>ref|NP_176713.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
 gb|AAC27155.1| Similar to cytochrome P450 gb|X90458 from A. thaliana [Arabidopsis 
thaliana]
 gb|AEE34360.1| cytochrome P450, family 96, subfamily A, polypeptide 3 [Arabidopsis 
thaliana]
Length=503

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W  +GMLPGLL    R++ ++T++L+ +  TF FKGP L  +D+L+T DP NIH+ILS N
Sbjct  37   WPALGMLPGLLLQVPRIYDWITEVLEATDMTFCFKGPCLSGMDILLTVDPVNIHYILSSN  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NYPKG +F++IF+V+GD IFNVDS LWE  R ++ + F++  F     +    K++ G
Sbjct  97   FANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQDFQMFWVSTSVRKLRQG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            L+P+L++ A++    DLQD+FQRF FDT
Sbjct  157  LVPILENAADKNILVDLQDLFQRFLFDT  184



>ref|XP_009132532.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=498

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 104/150 (69%), Gaps = 0/150 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W V+GMLPGLL   HR+H ++T +L+ +  TF FKGP     D+L+T DP N+H+ILS +
Sbjct  37   WPVLGMLPGLLLQIHRIHDWLTQVLEAANMTFRFKGPWRSGTDILVTVDPVNVHYILSSH  96

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F NYPKG +F++IF+ LGDGIFNVDS LWE  R ++ + F++  F +   +    K++ G
Sbjct  97   FVNYPKGEEFQKIFEFLGDGIFNVDSGLWEDMRNSSHAIFSNKDFQSFSVSTSVSKLRQG  156

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
            L+P+L++  E+    DLQD+FQRF FDT S
Sbjct  157  LVPVLENAYEKNILVDLQDLFQRFLFDTSS  186



>gb|KJB44293.1| hypothetical protein B456_007G244800 [Gossypium raimondii]
Length=499

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 105/176 (60%), Gaps = 2/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C++ +          P+ + +VGM+P  L N  RLH + TD L+    TF FKG 
Sbjct  10   FLPLVCFLLLYCLRDKYHGPPKSFPLVGMMPQFLSNIPRLHDWFTDTLEICHCTFLFKG-  68

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                 ++L+TCDP+NIH+I+S NF+N+PKGP F+QIFD+LGDGIFNVD  LW   R    
Sbjct  69   -FAKTNVLVTCDPSNIHYIMSSNFNNFPKGPGFKQIFDILGDGIFNVDMDLWRKQRIAAQ  127

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             F  H  F+  L      KV+ GL+PLLD  A+Q    +L+DVFQRF FD    LV
Sbjct  128  GFMRHQLFYRFLSRTTGAKVEEGLIPLLDHVAKQGLVVNLEDVFQRFAFDATCILV  183



>ref|XP_003555023.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Glycine max]
Length=509

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  240  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  419
            KW ++GMLPG+  N   +  ++T +LK  GGTF F+GP L N++++ T DP N+ HI S 
Sbjct  32   KWPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITST  91

Query  420  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  599
             F NY KG  FR+IF++LGDGIF  DSQLW ++R    S F  A F   +   + +K+++
Sbjct  92   KFQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIES  151

Query  600  GLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             LLP LD   ++  + DLQDVFQR TFD I  +VL
Sbjct  152  CLLPFLDRGWKEGMEVDLQDVFQRLTFDNICSIVL  186



>ref|NP_176086.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
 sp|Q9FVS9.1|C96AF_ARATH RecName: Full=Alkane hydroxylase MAH1; AltName: Full=Cytochrome 
P450 96A15; AltName: Full=Protein MID-CHAIN ALKANE HYDROXYLASE 
1 [Arabidopsis thaliana]
 gb|AAG50737.1|AC079733_5 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAL31942.1|AF419610_1 At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AAM13991.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64745.1| At1g57750/T8L23_21 [Arabidopsis thaliana]
 gb|AEE33458.1| alkane hydroxylase CYP96A15 [Arabidopsis thaliana]
Length=497

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 115/179 (64%), Gaps = 1/179 (1%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            IF  +  F Y  ++ +   +  I + W  + MLPG+L+   R++ +  ++L+ +  TF F
Sbjct  11   IFFLVCLFTYFFLQKKPQGQ-PILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYF  69

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            KGP L   DML T DP NIHHILS NF NYPKGP+F++IFDVLG+GI  VD +LWE  RK
Sbjct  70   KGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRK  129

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  + F++  F  L  ++   K++ GL+P LD+ A++    +LQDVFQRF FDT S L+
Sbjct  130  SNHALFHNQDFIELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQDVFQRFMFDTSSILM  188



>ref|XP_012075242.1| PREDICTED: alkane hydroxylase MAH1-like [Jatropha curcas]
 gb|KDP35253.1| hypothetical protein JCGZ_09412 [Jatropha curcas]
Length=498

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 103/171 (60%), Gaps = 1/171 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWSKALIERSGGTFLFKGP  68

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +  NH  FH+ L    ++K+   L P+L+   ++   FD QD+  RFTFD 
Sbjct  129  ALINHDRFHSFLVKTTYNKLAKELHPVLELLCKENKVFDFQDLIDRFTFDV  179



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 108/171 (63%), Gaps = 2/171 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            F+  FC+  +  +   R +    W  +GM P L+++ HR+H+   ++L  + GTF  KG 
Sbjct  16   FVAIFCFFVLAFQG--RGSFIWNWPFLGMFPSLVFHIHRIHERSVEVLSRTRGTFLLKGL  73

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+D+L T DPAN+ +I+S NF+N+PKG + R+IFDVLGDGIF+ D  LW+  RK   
Sbjct  74   WFTNMDILGTVDPANVQYIMSANFTNFPKGRELRKIFDVLGDGIFSSDMDLWKNQRKLAR  133

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            +   H  FH  L      KV+NGL+P+L+  A+++   DLQDVF+RFTFDT
Sbjct  134  ALITHQRFHKCLTKISLDKVKNGLIPILELIAKEDRIVDLQDVFKRFTFDT  184



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 105/162 (65%), Gaps = 1/162 (1%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG-GTFEFKGPVLGNLDMLITCDPA  395
            ++  I   W ++GMLP LL++  R+H   T+IL+ +  GTF FKGP    +++L T +PA
Sbjct  20   NKKRIAWNWPLIGMLPALLHHVGRIHDGCTEILRRTRRGTFHFKGPWFSGMEILGTVNPA  79

Query  396  NIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            N+H+I+S NF N+PKGP+FR+IFDVLGDGIFN D+  W   R+    F +H  FH  L  
Sbjct  80   NVHYIMSANFHNFPKGPKFREIFDVLGDGIFNSDADSWRHQRRAARGFLSHRRFHRFLVK  139

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                KV  GL+P+L+  +++    DLQD+FQR TFDT   LV
Sbjct  140  ISRDKVAYGLVPVLEMASKENWVLDLQDIFQRLTFDTTCALV  181



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 112/188 (60%), Gaps = 6/188 (3%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MAS +LL   +  +   F  CF + K K E+       R W V+GM+PG L   HR++ F
Sbjct  1    MASISLLDASIAIVCLVFFQCFFFKKPKNEAF------RNWPVLGMIPGFLLVLHRIYNF  54

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
              + L+ +  TF FKGP    +DML T DPANIH+ILS NFSNY KG  F+++FDV G+ 
Sbjct  55   GVETLEATDLTFFFKGPWFTGMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVFGEM  114

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IF+ DS+LW+  RK      NH  F  L  +    K+ +GL+PL D   E+    DLQ+V
Sbjct  115  IFSSDSELWKNQRKAAQFMLNHQGFQKLSMSATRSKLYDGLVPLFDQCCEEGKVVDLQEV  174

Query  663  FQRFTFDT  686
            F+RFTFDT
Sbjct  175  FKRFTFDT  182



>emb|CDY39035.1| BnaA02g17240D [Brassica napus]
Length=509

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR W V+GMLPG L   HRL+ +  D+L+ +  TF+F GP L  +D+LIT DP NI++IL
Sbjct  37   PRNWPVLGMLPGALVILHRLYDWSVDVLENANLTFQFIGPWLSGMDILITVDPENINYIL  96

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KGP+++++F+  GDGI N D +LW   RK +   F    F     +    K+
Sbjct  97   SSNFSNYIKGPEYQEVFEAYGDGIVNSDLELWRNLRKASQVIFGDQGFQNFTTSTTRSKL  156

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            ++GL+PL + FA++E   DLQDVFQRF FDT
Sbjct  157  KDGLVPLFNHFAKEEMVVDLQDVFQRFMFDT  187



>ref|XP_006604019.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Glycine max]
Length=530

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 100/155 (65%), Gaps = 0/155 (0%)
 Frame = +3

Query  240  KWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSR  419
            KW ++GMLPG+  N   +  ++T +LK  GGTF F+GP L N++++ T DP N+ HI S 
Sbjct  32   KWPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITST  91

Query  420  NFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQN  599
             F NY KG  FR+IF++LGDGIF  DSQLW ++R    S F  A F   +   + +K+++
Sbjct  92   KFQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIES  151

Query  600  GLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
             LLP LD   ++  + DLQDVFQR TFD I  +VL
Sbjct  152  CLLPFLDRGWKEGMEVDLQDVFQRLTFDNICSIVL  186



>ref|XP_009128105.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=526

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 0/151 (0%)
 Frame = +3

Query  234  PRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL  413
            PR W V+GMLPG L   HRL+ +  D+L+ +  TF+F GP L  +D+LIT DP NI++IL
Sbjct  54   PRNWPVLGMLPGALVILHRLYDWSVDVLENANLTFQFIGPWLSGMDILITVDPENINYIL  113

Query  414  SRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKV  593
            S NFSNY KGP+++++F+  GDGI N D +LW   RK +   F    F     +    K+
Sbjct  114  SSNFSNYIKGPEYQEVFEAYGDGIVNSDLELWRNLRKASQVIFGDQGFQNFTTSTTRSKL  173

Query  594  QNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
            ++GL+PL + FA++E   DLQDVFQRF FDT
Sbjct  174  KDGLVPLFNHFAKEEMVVDLQDVFQRFMFDT  204



>gb|KFK43173.1| hypothetical protein AALP_AA1G089200 [Arabis alpina]
Length=732

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 0/148 (0%)
 Frame = +3

Query  258  MLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYP  437
            MLPG+L   HR+H +V + L+ S  TF FKGP    ++ L+T DPANIHH  + NFS Y 
Sbjct  1    MLPGVLVMLHRIHDYVAEGLEVSDLTFAFKGPWFSGMNTLVTADPANIHHAFNTNFSIYD  60

Query  438  KGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLL  617
            KGP+F++IFD LG+GIF  DS+LWE  R++ L FF+H  F +     +  K++NGL+P+L
Sbjct  61   KGPEFKEIFDFLGEGIFTADSKLWEELRRSALVFFSHQRFQSFSLKTIASKIKNGLVPVL  120

Query  618  DSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            D FAE    FDLQDV  RFTFD    LV
Sbjct  121  DHFAEANRVFDLQDVLHRFTFDVTLTLV  148



>ref|XP_006285226.1| hypothetical protein CARUB_v10006585mg [Capsella rubella]
 gb|EOA18124.1| hypothetical protein CARUB_v10006585mg [Capsella rubella]
Length=513

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 110/186 (59%), Gaps = 5/186 (3%)
 Frame = +3

Query  132  AAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTD  311
            A++ L+     I S + CF Y   K          R W V+GMLP LL   HR++ F  +
Sbjct  2    ASISLVQASIAIVSLILCFFYHFKK----PHKGFLRNWPVLGMLPSLLMEFHRIYDFSVE  57

Query  312  ILKESGGTFEFKGPVLGNLDMLITCDPANIHHIL-SRNFSNYPKGPQFRQIFDVLGDGIF  488
            IL+ S  TF FKGP    +DM+ T D  NI HI+ S N SNY KGP F+++FDVLGDGI 
Sbjct  58   ILENSNLTFAFKGPWYSGMDMVFTADDKNIRHIMNSSNSSNYTKGPDFKEVFDVLGDGIL  117

Query  489  NVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQ  668
              DS+LW+  RK + +  +H  F  L  +    K+++GL+PL D   E+E   DLQDVF+
Sbjct  118  TADSELWKSLRKVSKAMVDHQGFQKLSMSTTRKKLKDGLVPLFDHIVEKEKVVDLQDVFR  177

Query  669  RFTFDT  686
            RFTFDT
Sbjct  178  RFTFDT  183



>emb|CDY58383.1| BnaC09g51620D [Brassica napus]
Length=496

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 105/161 (65%), Gaps = 0/161 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    I + W V+GMLPG+L +  R+  +  ++L+ +  TF FKGP     DML T D
Sbjct  26   KKSPGQPILKSWPVLGMLPGMLPHIPRIFDWTFEVLEATNLTFFFKGPWFSGTDMLFTAD  85

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NIHHILS NF NYPKGP+F++IFDVLGDGI + D +LWE  RK+  + F+H  F  L 
Sbjct  86   PRNIHHILSLNFGNYPKGPEFKKIFDVLGDGILSADLELWEDLRKSNHAIFHHPDFLKLS  145

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
             ++   K++ GL+P LD+ A +    DLQDVF+RF FDT S
Sbjct  146  ASSNTIKLKEGLVPFLDNAAHENIVIDLQDVFKRFMFDTSS  186



>ref|XP_010447431.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=508

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 98/149 (66%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  WAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRN  422
            W V+ MLP LL   HR++ +   IL+ S  TF F+GP    +DML+T DPANIHHI++ N
Sbjct  35   WPVLRMLPALLRALHRIYDYSVKILEISNLTFPFEGPQFAGMDMLVTVDPANIHHIMTSN  94

Query  423  FSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNG  602
            F+NY KGP F+ +FDV GDGI   D +LW+  RK+  +  +   F     + +  K+++G
Sbjct  95   FTNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRFSMSTMTRKLKDG  154

Query  603  LLPLLDSFAEQEAQFDLQDVFQRFTFDTI  689
            L+PLLD FAE+    DLQDVF RFTFDTI
Sbjct  155  LVPLLDHFAEKGTTVDLQDVFGRFTFDTI  183



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 0/171 (0%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
            FL   C+  +++ S S   +P+ W +VGMLP LL N    H++ T  L+ S G F  +  
Sbjct  10   FLAGICFAVLRLLSKSDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSHGNFFLRFH  69

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
                +D+L T DP N+H+ILS NF N+PKGP+F+++FDVLGDGIFN DS LW   R+   
Sbjct  70   WFSGMDILFTADPVNVHYILSANFGNFPKGPEFKRVFDVLGDGIFNSDSNLWSTQRRVAQ  129

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
             F     FH  L      K++NGLL +LD  ++     DLQ +FQRF  D+
Sbjct  130  VFMKDLRFHRFLLMTTRDKLENGLLRVLDELSQSGVTVDLQVLFQRFALDS  180



>gb|KDP35254.1| hypothetical protein JCGZ_09413 [Jatropha curcas]
Length=498

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 105/176 (60%), Gaps = 1/176 (1%)
 Frame = +3

Query  174  FLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGP  353
             L   CY  +    S+R  +   W  +GMLP L+ +    H +   +++ SGGTF FKGP
Sbjct  10   LLAVICY-SIGFWLSNRYELLWNWPFLGMLPSLVAHVPDFHDWNKALIERSGGTFLFKGP  68

Query  354  VLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTL  533
               N+D++ TCDPAN+ H LS NF NYPKG +F+++FDVLGDGIFN DS LW+  RK   
Sbjct  69   WFSNMDIVATCDPANVKHTLSTNFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNAS  128

Query  534  SFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            +  NH  F + L    ++K+   L P+L+   ++   FDLQD+  RFTFD    LV
Sbjct  129  ALINHDRFRSFLVKTTYNKLAKELHPVLELLCKENKVFDLQDLIDRFTFDVAMILV  184



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = +3

Query  288  RLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFD  467
            R++ F+T++L++    + FKGP LG +DML T DPANIHHI+S NF+NYPKG +F+++FD
Sbjct  51   RVYDFITEVLEDGNLNYLFKGPFLGGIDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFD  110

Query  468  VLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQF  647
            VLGDGIFNVDS+LW+  RK++ S  N   F          K++ GL+PLLD  A+++   
Sbjct  111  VLGDGIFNVDSELWKDLRKSSQSMMNDPDFQRFSLATSLSKLEKGLVPLLDHAAKEKLVV  170

Query  648  DLQDVFQRFTFDT  686
            DLQDVFQRFTFDT
Sbjct  171  DLQDVFQRFTFDT  183



>emb|CDY42628.1| BnaC01g00400D [Brassica napus]
Length=557

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 103/170 (61%), Gaps = 0/170 (0%)
 Frame = +3

Query  177  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            L CF      +         + W V+GMLPG L   HR++ F  ++L+++  TF FKGP 
Sbjct  13   LLCFLIFHHLLSKKPHDRFLKNWPVLGMLPGFLIVLHRIYDFSVEVLEQTNLTFPFKGPW  72

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
               +D+L+T DPANIH+ILS NFSNY KG  F+++FDV G+ IFN D  LW   R+    
Sbjct  73   FTGMDILVTVDPANIHYILSSNFSNYTKGANFKEVFDVFGEMIFNSDGDLWRNQRRAAQY  132

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDT  686
              NH  F  L  +    K+ +GL+PL D F+++E   DLQ++FQRFT+DT
Sbjct  133  MLNHQGFQKLSMSATRTKLDDGLVPLFDRFSKEEMVVDLQNLFQRFTYDT  182



>ref|XP_002894062.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70321.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 6/178 (3%)
 Frame = +3

Query  159  FMIFSFL---GCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESG  329
            F+IF +      F Y+ +K    +  + P  W V+GMLPG+L    R++    +IL+ S 
Sbjct  16   FLIFYYFLVKKPFSYLPIK---KTLESYPWNWPVLGMLPGVLLRLQRIYDCSVEILENSN  72

Query  330  GTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLW  509
             TF+FKGP    + +L T DPANIHHI+S NFSNY KGP F +IF+  GDGI N DS+LW
Sbjct  73   LTFQFKGPWFVGMGILATVDPANIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINSDSELW  132

Query  510  EFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFD  683
               R  +   FNH  +     +    K+++GL+PL   FA++E   DLQDVFQRF FD
Sbjct  133  RDWRNASQIIFNHQRYQNFSASTTKSKLKDGLVPLFSHFADEEMVVDLQDVFQRFMFD  190



>ref|XP_006392376.1| hypothetical protein EUTSA_v10023422mg [Eutrema salsugineum]
 gb|ESQ29662.1| hypothetical protein EUTSA_v10023422mg [Eutrema salsugineum]
Length=496

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 106/164 (65%), Gaps = 0/164 (0%)
 Frame = +3

Query  210  ESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCD  389
            + S    + + W  +GMLPG+L    R++ +  ++L+ +  TF FKGP    +DML T D
Sbjct  24   KKSQGQPVLKNWPFLGMLPGMLPYIPRIYDWTVEVLEATNLTFLFKGPWFSGMDMLFTAD  83

Query  390  PANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLL  569
            P NI HIL+ NF NYPKGP+F++IFDVLGDGI +VD +LWE  RK+  + F+H  F  L 
Sbjct  84   PRNIQHILNSNFGNYPKGPEFKKIFDVLGDGILSVDLELWEELRKSNHAIFHHQDFLNLS  143

Query  570  ETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
             ++   K++ GL+P  D+ A +    DLQDVF+RF FDT S L+
Sbjct  144  VSSNTRKLKEGLVPFFDNAARENLTIDLQDVFKRFMFDTSSILM  187



>ref|XP_006651021.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=506

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 106/193 (55%), Gaps = 4/193 (2%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA A  L L L F+ FS    F Y  M  +  SR AIP  W +VGMLP LL N HR+H +
Sbjct  1    MAFACTLHLALCFLCFSV---FYYHHMVSKRKSR-AIPLCWPLVGMLPELLANRHRIHGW  56

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
            +T +L  S   F F GP   ++ + ITCDPAN+ H+ + NF NYPKGP F +IFD+ G G
Sbjct  57   ITSLLAVSKLNFRFTGPTSSSMRLFITCDPANVRHVFTSNFCNYPKGPDFAEIFDIFGGG  116

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFNVD   W   R           F   +      KV+  LLPLL  FA      +LQDV
Sbjct  117  IFNVDGDAWRRQRAKAQLLMCRPQFRAFVSRCSRAKVETSLLPLLAHFAATGEACNLQDV  176

Query  663  FQRFTFDTIS*LV  701
            F R TFDT + +V
Sbjct  177  FMRLTFDTTTMMV  189



>ref|XP_009400927.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +3

Query  165  IFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEF  344
            IF F+  FCY         RS+ P  W + GMLPGLL N   LH + TD+L+  G  F F
Sbjct  30   IFCFV-FFCYFGRVFR---RSSFPVDWPLAGMLPGLLLNLDHLHDWCTDLLRVVGCNFFF  85

Query  345  KGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRK  524
            +GP    +D L+TCDPAN+ H+ S NFSNYPKG +F +IFD+LGDGIFN D + W+  R 
Sbjct  86   RGPWFLGMDYLVTCDPANLQHVFSANFSNYPKGGEFSEIFDILGDGIFNSDGESWKKQRM  145

Query  525  TTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
                  N   F + + +++ +KV+ GL+PL+D    + A  DLQDVF R TFD  S LV
Sbjct  146  KAHGLMNGRRFRSFVASSIRNKVEKGLIPLVDDVVRRGAVVDLQDVFMRLTFDATSYLV  204



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +3

Query  177  LGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPV  356
            L CF  +  +++   R  +P  W VVG+LP +  NA R+H+++T+ L+ +G ++  KGP 
Sbjct  21   LACFLLLFHRLKR--RDGLPTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLSYVIKGPW  78

Query  357  LGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLS  536
               +D+++T DPAN+ H+ + NF NYPKG +F ++FDVLGDGIFN D   W F R+   +
Sbjct  79   GSPVDVIVTADPANVAHVFTANFGNYPKGEEFAELFDVLGDGIFNADGDSWAFQRRKAHA  138

Query  537  FFNHAHFHTLLETNVWHKVQNGLLPLLDSFAE--QEAQFDLQDVFQRFTFD  683
              + A F   +  +   K+++GL+PLLD  A     A  DLQDVF R TFD
Sbjct  139  LLSDARFRAGVAASTARKLRDGLVPLLDGLAASGSGAAVDLQDVFVRLTFD  189



>ref|XP_002322211.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
 gb|EEF06338.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
Length=508

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = +3

Query  219  SRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPAN  398
            +RS++   W VVGMLPGL  N+ R+H+FVT +L++ GGTF FKGP  G LD L+T +PAN
Sbjct  21   NRSSVIINWPVVGMLPGLFRNSSRVHEFVTYVLRQCGGTFVFKGPWFGGLDFLVTSNPAN  80

Query  399  IHHILSRNFSNYPKGPQFRQIF-DVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLET  575
            +HHIL +   NY KG +F++IF +  G+GIF  D   W+  R+T  SF  ++ F    E 
Sbjct  81   VHHILRKKAFNYHKGLEFKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAAER  140

Query  576  NVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LVL  704
            N+  KV +G+  +L+ F+EQ  + D+QDV +RF FD    L+L
Sbjct  141  NIQRKVLHGIFVILEHFSEQRKEVDMQDVLKRFMFDYSCLLLL  183



>gb|KFK40984.1| hypothetical protein AALP_AA2G070000 [Arabis alpina]
Length=493

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 112/178 (63%), Gaps = 5/178 (3%)
 Frame = +3

Query  159  FMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTF  338
            F+ F    CF   K      +   +   W V+GMLPGL+    R++ ++T++L+ +  TF
Sbjct  3    FVFFIVFQCFLLHK-----KTHKPLVTNWPVLGMLPGLILQVPRIYDWITEVLEATDMTF  57

Query  339  EFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFH  518
             FKGP L   D+L T DPANI +ILS NF NYPKG + ++IF+VLGD IFNVDS+LWE  
Sbjct  58   CFKGPWLSGTDILATVDPANIQYILSSNFVNYPKGIESKKIFEVLGDSIFNVDSELWEDM  117

Query  519  RKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS  692
            R ++ + F+H  F  +  +    K++ GL+P+L++  ++    DLQD+F+RF FDT S
Sbjct  118  RSSSHAIFSHQEFQKISVSTTISKLKQGLVPILENAIKKNILVDLQDLFRRFMFDTSS  175



>gb|KJB44331.1| hypothetical protein B456_007G246400 [Gossypium raimondii]
Length=507

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 116/193 (60%), Gaps = 9/193 (5%)
 Frame = +3

Query  123  MASAAlllllllFMIFSFLGCFCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQF  302
            MA  ++   +L  + F FL C       + + +RS  P+ + +VGMLP L+ N HR+H +
Sbjct  1    MALVSVFEAVLALICFLFLCC-------LRNKNRS--PKSFPIVGMLPELILNIHRIHDW  51

Query  303  VTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDG  482
             T+  +    TF F GP    +++L TCDPAN+H+I+S NF+N+PKGP+F+Q+FDVLGDG
Sbjct  52   CTETFERCHYTFLFNGPWFAKMNILGTCDPANVHYIMSSNFNNFPKGPEFKQLFDVLGDG  111

Query  483  IFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDV  662
            IFN D  LW   R     F  +  F   L      KV+ GL+ ++D  A+Q    +L+D+
Sbjct  112  IFNTDMDLWRKQRIVAQEFMRNHLFLKFLLMTTRDKVEKGLIHVIDYVAKQGLVVNLEDI  171

Query  663  FQRFTFDTIS*LV  701
            FQRFTFDT   LV
Sbjct  172  FQRFTFDTTCILV  184



>gb|KGN48430.1| hypothetical protein Csa_6G487020 [Cucumis sativus]
Length=516

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 100/158 (63%), Gaps = 0/158 (0%)
 Frame = +3

Query  228  AIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHH  407
             IP  W V+GM+P +++N +R+H  +T+IL+++  TF F G    N   L+T DP+NIHH
Sbjct  32   GIPWNWPVLGMIPTVIHNIYRVHDRITEILQQTSCTFYFNGIWFTNTGFLMTVDPSNIHH  91

Query  408  ILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWH  587
            I+S NF NYPKGP+F+ IFDVLGDGIFN DS  W+  RK   S   H  F   +      
Sbjct  92   IMSTNFQNYPKGPEFKYIFDVLGDGIFNSDSDSWKSQRKIAQSLIVHEKFLEFMARAAKE  151

Query  588  KVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFDTIS*LV  701
            KV+ GL+P+L+ F E +   DL+D+F R  FD+   +V
Sbjct  152  KVEKGLVPILEYFCESKKVVDLKDLFLRLAFDSTCMMV  189



>ref|NP_195658.3| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB44683.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80611.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87077.1| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=516

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +3

Query  288  RLHQFVTDILKESGGTFEFKGPVLGNLDMLITCDPANIHHILSRNFSNYPKGPQFRQIFD  467
            R++ F+T++L++    + F GP LG +DML T DPANIHHI+S NF+NYPKG +F+++FD
Sbjct  51   RVYDFITEVLEDGNLNYLFIGPFLGGIDMLFTVDPANIHHIMSSNFANYPKGTEFKKLFD  110

Query  468  VLGDGIFNVDSQLWEFHRKTTLSFFNHAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQF  647
            VLGDGIFN DS LW+  RK++ S  NH  F          K++ GL+PLLD  A+++   
Sbjct  111  VLGDGIFNADSDLWKDLRKSSQSMMNHPDFQRFSLATSLSKLEKGLVPLLDHVAKEKLVV  170

Query  648  DLQDVFQRFTFDT  686
            DLQDVFQRFTFDT
Sbjct  171  DLQDVFQRFTFDT  183



>ref|NP_175193.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 gb|AAD46023.1|AC007519_8 Strong simlarity to gb|286426 F10M6.190 cytochrome p450 homolog 
from Arabidopsis thaliana BAC gb|AL021811 [Arabidopsis thaliana]
 gb|AAQ89636.1| At1g47620 [Arabidopsis thaliana]
 dbj|BAD44042.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44086.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32195.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=520

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +3

Query  186  FCYMKMKMESSSRSAIPRKWAVVGMLPGLLYNAHRLHQFVTDILKESGGTFEFKGPVLGN  365
            F Y+ +K    +  + P  W V+GMLPG+L    R++    ++L+ S  TF+FKGP    
Sbjct  28   FSYLLIK---KTLQSYPWNWPVLGMLPGVLLRLQRIYDCSVEVLENSNMTFQFKGPWFVG  84

Query  366  LDMLITCDPANIHHILSRNFSNYPKGPQFRQIFDVLGDGIFNVDSQLWEFHRKTTLSFFN  545
            +D+L T DPANIHHI+S NFSNY KGP F +IF+  GDGI N D++LW   R  +   FN
Sbjct  85   MDVLATVDPANIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFN  144

Query  546  HAHFHTLLETNVWHKVQNGLLPLLDSFAEQEAQFDLQDVFQRFTFD  683
            H  +     +    KV +GL+PL + FA +E   DL+DVFQRF +D
Sbjct  145  HQRYQNFSASTTKTKVNDGLVPLFNHFANEEIVVDLEDVFQRFMYD  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140