BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6206

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN66483.1|  hypothetical protein VITISV_015390                     172   4e-46   Vitis vinifera
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             172   6e-46   Vitis vinifera
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        169   5e-45   Nicotiana sylvestris
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        169   6e-45   Populus euphratica
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        169   7e-45   Prunus mume [ume]
ref|XP_012091044.1|  PREDICTED: vacuolar-sorting receptor 1-like        169   7e-45   Jatropha curcas
gb|KJB71519.1|  hypothetical protein B456_011G126800                    167   1e-44   Gossypium raimondii
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               167   2e-44   Gossypium arboreum [tree cotton]
gb|KJB71518.1|  hypothetical protein B456_011G126800                    167   2e-44   Gossypium raimondii
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                166   2e-44   
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   2e-44   Solanum tuberosum [potatoes]
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             167   3e-44   Prunus persica
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                166   5e-44   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    166   6e-44   Solanum tuberosum [potatoes]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   7e-44   Nicotiana tomentosiformis
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        166   9e-44   Fragaria vesca subsp. vesca
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    166   1e-43   Nicotiana tomentosiformis
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    166   1e-43   Solanum lycopersicum
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    166   1e-43   Solanum lycopersicum
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    165   1e-43   Nicotiana tomentosiformis
emb|CDP06387.1|  unnamed protein product                                165   1e-43   Coffea canephora [robusta coffee]
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  160   3e-43   Citrus sinensis [apfelsine]
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    164   4e-43   
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    164   5e-43   
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    163   6e-43   Solanum tuberosum [potatoes]
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  160   8e-43   Citrus sinensis [apfelsine]
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  160   9e-43   Citrus sinensis [apfelsine]
gb|AAN60346.1|  unknown                                                 154   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        160   5e-42   Populus euphratica
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    160   7e-42   Ricinus communis
ref|XP_002309184.1|  vacuolar sorting receptor family protein           160   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             159   1e-41   Citrus clementina [clementine]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               159   3e-41   Gossypium arboreum [tree cotton]
gb|KJB29887.1|  hypothetical protein B456_005G122400                    158   3e-41   Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    158   4e-41   Gossypium raimondii
gb|KJB29888.1|  hypothetical protein B456_005G122400                    158   4e-41   Gossypium raimondii
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    157   6e-41   Nelumbo nucifera [Indian lotus]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                157   7e-41   Erythranthe guttata [common monkey flower]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    157   8e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        157   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    148   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    156   2e-40   Nicotiana sylvestris
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    156   2e-40   Nicotiana sylvestris
emb|CDY38157.1|  BnaA07g02260D                                          153   2e-40   Brassica napus [oilseed rape]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    155   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    155   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        155   3e-40   Solanum lycopersicum
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    155   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        155   5e-40   
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        154   6e-40   Phoenix dactylifera
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        154   7e-40   Morus notabilis
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        154   9e-40   Phoenix dactylifera
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    154   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    154   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        153   3e-39   Elaeis guineensis
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             153   3e-39   
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             153   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             152   6e-39   Tarenaya hassleriana [spider flower]
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    152   7e-39   Arabis alpina [alpine rockcress]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             152   7e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             151   8e-39   Capsella rubella
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             151   9e-39   Arabidopsis lyrata subsp. lyrata
gb|AAK82551.1|  AT3g52850/F8J2_20                                       151   9e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       150   9e-39   Cucumis sativus [cucumbers]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             151   1e-38   
gb|AAB72111.1|  vacuolar sorting receptor homolog                       151   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           151   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        151   1e-38   Camelina sativa [gold-of-pleasure]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    151   1e-38
gb|EEE52644.1|  hypothetical protein OsJ_35003                          151   1e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDY04821.1|  BnaAnng00030D                                          151   1e-38   
gb|EEE51529.1|  hypothetical protein OsJ_32728                          151   1e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68730.1|  hypothetical protein OsI_37233                          151   1e-38   Oryza sativa Indica Group [Indian rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          151   1e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             150   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1             150   2e-38   Cucumis sativus [cucumbers]
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             150   2e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    150   2e-38   
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             150   2e-38   Cucumis melo [Oriental melon]
ref|NP_001065992.1|  Os12g0116000                                       151   2e-38   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        150   2e-38   
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             150   2e-38   
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              149   5e-38   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        149   6e-38   Zea mays [maize]
emb|CDY13344.1|  BnaC06g14130D                                          149   6e-38   Brassica napus [oilseed rape]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             149   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        149   7e-38   
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        149   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        149   8e-38   Camelina sativa [gold-of-pleasure]
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    149   9e-38   Arabis alpina [alpine rockcress]
emb|CDX67539.1|  BnaA07g15790D                                          149   9e-38   
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        148   9e-38   
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             149   1e-37   
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        148   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        148   1e-37   Brassica rapa
dbj|BAK00302.1|  predicted protein                                      148   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           147   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        147   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        147   2e-37   Sesamum indicum [beniseed]
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          147   4e-37   Sorghum bicolor [broomcorn]
emb|CDX78128.1|  BnaA09g33230D                                          146   5e-37   
ref|NP_001060643.1|  Os07g0680000                                       146   6e-37   
ref|XP_003626680.1|  Vacuolar sorting receptor                          146   8e-37   Medicago truncatula
gb|EEC82690.1|  hypothetical protein OsI_27347                          145   1e-36   Oryza sativa Indica Group [Indian rice]
dbj|BAK03786.1|  predicted protein                                      146   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        145   2e-36   Cicer arietinum [garbanzo]
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    145   2e-36   Brassica rapa
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               145   2e-36   Gossypium arboreum [tree cotton]
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        145   2e-36   Eucalyptus grandis [rose gum]
emb|CDX73599.1|  BnaC08g24040D                                          145   2e-36   
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             144   2e-36   
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             144   3e-36   Brassica rapa
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    144   4e-36   
ref|NP_001169650.1|  hypothetical protein precursor                     143   4e-36   
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        144   4e-36   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             144   4e-36   Glycine soja [wild soybean]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             143   8e-36   Brachypodium distachyon [annual false brome]
ref|XP_006842496.1|  PREDICTED: vacuolar-sorting receptor 1             143   1e-35   Amborella trichopoda
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        143   1e-35   Glycine max [soybeans]
gb|KJB32253.1|  hypothetical protein B456_005G231800                    142   2e-35   Gossypium raimondii
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                142   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        142   2e-35   Sesamum indicum [beniseed]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    142   2e-35   Gossypium raimondii
ref|XP_011652916.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    141   4e-35   Cucumis sativus [cucumbers]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    141   4e-35   Cucumis sativus [cucumbers]
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788              133   4e-35   
gb|KJB32254.1|  hypothetical protein B456_005G231800                    140   7e-35   Gossypium raimondii
gb|KJB32252.1|  hypothetical protein B456_005G231800                    140   7e-35   Gossypium raimondii
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   1e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     132   2e-34   Ziziphus jujuba [Chinese jujube]
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        139   3e-34   Oryza brachyantha
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        138   5e-34   Oryza brachyantha
ref|XP_002527509.1|  zinc finger protein, putative                      138   7e-34   Ricinus communis
gb|KJB12290.1|  hypothetical protein B456_002G010300                    137   8e-34   Gossypium raimondii
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        137   1e-33   Oryza brachyantha
gb|KJB12295.1|  hypothetical protein B456_002G010300                    135   2e-33   Gossypium raimondii
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        136   2e-33   Brassica rapa
emb|CDY37219.1|  BnaA09g08400D                                          136   2e-33   Brassica napus [oilseed rape]
emb|CDX81459.1|  BnaC09g08700D                                          136   3e-33   
gb|EPS73119.1|  hypothetical protein M569_01632                         136   3e-33   Genlisea aurea
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             138   3e-33   Triticum urartu
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             136   3e-33   Phaseolus vulgaris [French bean]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             136   3e-33   Eutrema salsugineum [saltwater cress]
gb|KJB12294.1|  hypothetical protein B456_002G010300                    135   5e-33   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    135   6e-33   Gossypium raimondii
gb|KJB12292.1|  hypothetical protein B456_002G010300                    135   6e-33   Gossypium raimondii
gb|EPS72005.1|  hypothetical protein M569_02753                         134   8e-33   Genlisea aurea
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             134   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             133   1e-32   
ref|NP_001050034.1|  Os03g0335300                                       134   1e-32   
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        134   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_003623631.1|  Vacuolar sorting receptor                          134   2e-32   Medicago truncatula
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    134   2e-32   Cucumis melo [Oriental melon]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        134   2e-32   
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    134   2e-32   Cucumis melo [Oriental melon]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             134   2e-32   
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        133   3e-32   Oryza brachyantha
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             133   3e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             133   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             133   4e-32   Theobroma cacao [chocolate]
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        126   4e-32   
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        133   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        132   5e-32   Sesamum indicum [beniseed]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             132   5e-32   Capsella rubella
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             132   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        132   5e-32   Nicotiana tomentosiformis
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        132   5e-32   Nicotiana sylvestris
ref|NP_179079.1|  vacuolar-sorting receptor 4                           132   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    132   6e-32   Arabis alpina [alpine rockcress]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           132   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    132   6e-32   Arabis alpina [alpine rockcress]
ref|XP_002885935.1|  VSR-2                                              132   6e-32   
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        132   6e-32   Cicer arietinum [garbanzo]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             132   7e-32   Tarenaya hassleriana [spider flower]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             132   7e-32   
emb|CDY65441.1|  BnaCnng47180D                                          132   7e-32   Brassica napus [oilseed rape]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             132   8e-32   Brassica rapa
emb|CDX91478.1|  BnaC04g06720D                                          132   8e-32   
ref|XP_012093114.1|  PREDICTED: vacuolar-sorting receptor 3             132   9e-32   Jatropha curcas
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        132   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        131   1e-31   Brassica rapa
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             132   1e-31   Triticum urartu
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        131   1e-31   Camelina sativa [gold-of-pleasure]
dbj|BAK05589.1|  predicted protein                                      132   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    131   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    130   2e-31   Camelina sativa [gold-of-pleasure]
gb|ABR17683.1|  unknown                                                 130   3e-31   Picea sitchensis
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            130   4e-31   Populus trichocarpa [western balsam poplar]
emb|CDY60753.1|  BnaA05g34780D                                          130   4e-31   Brassica napus [oilseed rape]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        130   4e-31   Solanum tuberosum [potatoes]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        130   4e-31   Populus euphratica
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             130   4e-31   Solanum lycopersicum
ref|NP_001292791.1|  vacuolar sorting receptor homolog1 precursor       130   6e-31   Zea mays [maize]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             129   6e-31   Populus euphratica
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        129   8e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             129   8e-31   Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   8e-31   Glycine max [soybeans]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             129   9e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        129   1e-30   
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        129   1e-30   Nelumbo nucifera [Indian lotus]
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  127   2e-30   Medicago truncatula
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                128   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        128   2e-30   Cicer arietinum [garbanzo]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             128   2e-30   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    128   2e-30   Glycine max [soybeans]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        128   3e-30   Brachypodium distachyon [annual false brome]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        128   3e-30   Morus notabilis
gb|AAB72112.1|  vacuolar sorting receptor homolog                       127   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        127   4e-30   Nelumbo nucifera [Indian lotus]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  127   4e-30   Medicago truncatula
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          127   4e-30   Sorghum bicolor [broomcorn]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        127   5e-30   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        127   5e-30   Pyrus x bretschneideri [bai li]
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   125   5e-30   Citrus sinensis [apfelsine]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        127   5e-30   
emb|CBI32834.3|  unnamed protein product                                120   5e-30   Vitis vinifera
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             127   5e-30   Phaseolus vulgaris [French bean]
emb|CDO97275.1|  unnamed protein product                                127   6e-30   Coffea canephora [robusta coffee]
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             127   6e-30   Prunus mume [ume]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             127   7e-30   Glycine soja [wild soybean]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        127   7e-30   Glycine max [soybeans]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          126   8e-30   
ref|XP_006849341.2|  PREDICTED: vacuolar-sorting receptor 3 isofo...    126   1e-29   Amborella trichopoda
ref|XP_011625221.1|  PREDICTED: vacuolar-sorting receptor 3 isofo...    126   1e-29   
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             126   1e-29   Prunus persica
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    125   1e-29   Glycine max [soybeans]
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        125   2e-29   Cucumis melo [Oriental melon]
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        125   2e-29   Cucumis sativus [cucumbers]
gb|AGV54776.1|  vacuolar-sorting receptor                               125   2e-29   Phaseolus vulgaris [French bean]
dbj|BAB64531.1|  vacuolar sorting receptor                              125   2e-29   Vigna mungo [urad dal]
gb|ERN10922.1|  hypothetical protein AMTR_s00164p00059220               125   3e-29   Amborella trichopoda
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     124   3e-29   Eucalyptus grandis [rose gum]
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   124   3e-29   Citrus sinensis [apfelsine]
emb|CAN79862.1|  hypothetical protein VITISV_021998                     124   4e-29   Vitis vinifera
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   5e-29   Eucalyptus grandis [rose gum]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             124   5e-29   Fragaria vesca subsp. vesca
emb|CBI22461.3|  unnamed protein product                                124   5e-29   Vitis vinifera
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             124   6e-29   Vitis vinifera
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             124   6e-29   Citrus clementina [clementine]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             124   6e-29   Phaseolus vulgaris [French bean]
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   124   6e-29   Citrus sinensis [apfelsine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   124   6e-29   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        124   7e-29   Citrus sinensis [apfelsine]
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   7e-29   Eucalyptus grandis [rose gum]
ref|NP_001169232.1|  hypothetical protein precursor                     124   8e-29   Zea mays [maize]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        124   9e-29   Sesamum indicum [beniseed]
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    123   1e-28   Setaria italica
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    123   2e-28   
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    123   2e-28   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    123   2e-28   
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             122   2e-28   Phaseolus vulgaris [French bean]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             122   2e-28   Glycine soja [wild soybean]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    122   3e-28   Glycine max [soybeans]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             122   3e-28   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    122   4e-28   Glycine max [soybeans]
ref|XP_003610620.1|  Vacuolar-sorting receptor                          122   4e-28   
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          121   6e-28   Sorghum bicolor [broomcorn]
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like        119   1e-27   
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    120   2e-27   Cicer arietinum [garbanzo]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    120   2e-27   
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849              119   3e-27   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             119   3e-27   Triticum aestivum [Canadian hard winter wheat]
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    119   4e-27   Pisum sativum [garden pea]
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             117   1e-26   
gb|KJB38063.1|  hypothetical protein B456_006G235500                    115   2e-26   Gossypium raimondii
gb|EEC66779.1|  hypothetical protein OsI_33169                          112   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        115   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             115   1e-25   Selaginella moellendorffii
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             115   1e-25   
gb|EPS57970.1|  hypothetical protein M569_16845                         114   2e-25   Genlisea aurea
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        113   3e-25   
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849              107   5e-25   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        113   5e-25   Elaeis guineensis
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             113   5e-25   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             113   5e-25   Selaginella moellendorffii
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        112   8e-25   Elaeis guineensis
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                    112   1e-24   
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   112   1e-24   Zea mays [maize]
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849              109   2e-24   
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     111   2e-24   
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    111   2e-24   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    111   2e-24   
gb|ACN30885.1|  unknown                                                 111   2e-24   
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        110   6e-24   
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              109   1e-23   
ref|NP_001064400.1|  Os10g0346600                                       109   1e-23   
gb|EMT28756.1|  hypothetical protein F775_27608                         103   1e-23   
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        108   2e-23   
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040        103   3e-23   
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        107   6e-23   
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        106   1e-22   
gb|ABR17707.1|  unknown                                                 105   2e-22   
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        105   2e-22   
ref|XP_001759820.1|  predicted protein                                  103   1e-21   
gb|KHN42446.1|  Vacuolar-sorting receptor 4                           96.3    2e-21   
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        102   2e-21   
ref|XP_001751750.1|  predicted protein                                  101   6e-21   
ref|XP_001759928.1|  predicted protein                                  100   2e-20   
ref|XP_001776090.1|  predicted protein                                97.4    1e-19   
gb|EMT00254.1|  hypothetical protein F775_19349                       90.9    3e-19   
ref|XP_001765481.1|  predicted protein                                95.5    8e-19   
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  94.7    9e-19   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                  94.7    1e-18   
gb|EMS45035.1|  hypothetical protein TRIUR3_18121                     89.7    1e-18   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  94.4    2e-18   
ref|XP_006853456.1|  PREDICTED: vacuolar-sorting receptor 6           94.4    2e-18   
ref|XP_001785165.1|  predicted protein                                93.6    3e-18   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like      93.6    4e-18   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like      93.6    4e-18   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like      92.8    6e-18   
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                     92.4    7e-18   
gb|AFW87686.1|  vacuolar sorting receptor 7                           92.4    7e-18   
gb|ACN28195.1|  unknown                                               92.4    7e-18   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor            92.4    8e-18   
gb|EEC81131.1|  hypothetical protein OsI_24020                        91.7    1e-17   
ref|NP_001058298.1|  Os06g0664300                                     91.7    1e-17   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like      91.7    2e-17   
dbj|BAJ91572.1|  predicted protein                                    91.7    2e-17   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544        91.3    2e-17   
emb|CBI27239.3|  unnamed protein product                              91.7    3e-17   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like      90.1    4e-17   
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                88.6    5e-17   
gb|AFK35926.1|  unknown                                               86.3    7e-17   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  89.4    9e-17   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  89.4    9e-17   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g           89.4    9e-17   
dbj|BAJ97179.1|  predicted protein                                    89.4    1e-16   
gb|EMT30552.1|  hypothetical protein F775_21497                       89.0    1e-16   
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                88.2    1e-16   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like      89.0    1e-16   
ref|XP_001777810.1|  predicted protein                                89.0    1e-16   
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                87.8    2e-16   
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        82.8    2e-16   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg           87.4    4e-16   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg           87.4    4e-16   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7           87.4    4e-16   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like      87.0    5e-16   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg           87.0    5e-16   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                87.0    6e-16   
emb|CDX93144.1|  BnaA03g38660D                                        86.3    1e-15   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7           85.9    1e-15   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like      85.1    2e-15   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like      84.7    3e-15   
dbj|BAK00261.1|  predicted protein                                    84.7    3e-15   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180        84.3    4e-15   
emb|CDP18160.1|  unnamed protein product                              84.3    5e-15   
ref|XP_002304606.1|  vacuolar sorting receptor family protein         84.0    5e-15   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6           84.0    5e-15   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                      84.0    5e-15   
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                78.2    6e-15   
gb|KEH37345.1|  vacuolar-sorting receptor                             83.6    7e-15   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                           83.2    9e-15   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  83.2    9e-15   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6           83.2    1e-14   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like      83.2    1e-14   
ref|XP_012065972.1|  PREDICTED: vacuolar-sorting receptor 6-like      82.8    1e-14   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  82.8    1e-14   
dbj|BAJ88964.1|  predicted protein                                    82.8    2e-14   
gb|KJB48042.1|  hypothetical protein B456_008G051500                  81.3    3e-14   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6           81.3    5e-14   
gb|KJB48041.1|  hypothetical protein B456_008G051500                  80.9    5e-14   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6           80.9    5e-14   
gb|KJB48040.1|  hypothetical protein B456_008G051500                  80.9    5e-14   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7           80.9    5e-14   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein             80.9    6e-14   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like      80.5    8e-14   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like      80.1    9e-14   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like      80.1    1e-13   
gb|EEE61664.1|  hypothetical protein OsJ_16123                        80.1    1e-13   
ref|XP_003603017.1|  Vacuolar sorting receptor                        74.7    1e-13   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6           80.1    1e-13   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                  79.7    1e-13   
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like      77.0    1e-13   
emb|CAE03573.2|  OSJNBa0085I10.18                                     79.7    1e-13   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g           79.7    1e-13   
ref|NP_001053838.1|  Os04g0611400                                     79.3    2e-13   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like      79.3    2e-13   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                           79.7    2e-13   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg              79.3    2e-13   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6           79.0    2e-13   
emb|CDY43178.1|  BnaCnng11060D                                        79.0    2e-13   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg           78.6    3e-13   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  78.6    4e-13   
emb|CDY02347.1|  BnaA09g25550D                                        78.2    4e-13   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6           78.2    4e-13   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like      78.2    4e-13   
gb|AAF98196.1|AC000107_19  F17F8.23                                   78.2    5e-13   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like      77.8    5e-13   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733           77.8    6e-13   
ref|NP_174375.1|  vacuolar sorting receptor 6                         77.8    6e-13   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like      77.4    7e-13   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg           77.0    1e-12   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like      76.6    2e-12   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg           76.3    2e-12   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like      75.9    2e-12   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like      75.9    3e-12   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like      75.9    3e-12   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6           75.9    3e-12   
gb|ACS91931.1|  vacuolar sorting receptor protein                     75.1    4e-12   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7           75.1    4e-12   
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                   74.7    4e-12   
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg             72.4    5e-12   
gb|AES73268.2|  vacuolar sorting receptor protein, putative           69.3    6e-12   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like      74.7    6e-12   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           74.7    6e-12   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  74.3    7e-12   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  74.3    8e-12   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6           74.3    8e-12   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                   74.3    9e-12   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6           73.9    9e-12   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            74.3    1e-11   
ref|XP_003064631.1|  predicted protein                                73.6    1e-11   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7           72.4    4e-11   
emb|CDY50060.1|  BnaCnng18670D                                        72.4    4e-11   
emb|CDX78975.1|  BnaA01g10420D                                        72.4    4e-11   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                      71.6    7e-11   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                71.2    7e-11   
ref|NP_193744.1|  vacuolar-sorting receptor 7                         71.2    7e-11   
emb|CAA16619.1|  vacuolar sorting receptor-like protein               71.2    7e-11   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                      70.5    1e-10   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857           70.1    2e-10   
ref|XP_003057973.1|  predicted protein                                70.5    2e-10   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                  70.1    2e-10   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg           70.1    2e-10   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7           69.7    3e-10   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like      69.7    3e-10   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like      69.3    3e-10   
ref|XP_002501193.1|  predicted protein                                67.4    1e-09   
ref|XP_007513418.1|  predicted protein                                66.2    4e-09   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  66.2    4e-09   
gb|AEW09228.1|  hypothetical protein UMN_755_01                       60.8    4e-09   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       59.7    1e-08   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5           62.8    5e-08   
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                      62.4    5e-08   
ref|NP_181040.1|  vacuolar-sorting receptor 5                         61.6    1e-07   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg           61.6    1e-07   
ref|XP_006387140.1|  hypothetical protein POPTR_1723s00200g           56.2    3e-07   
ref|XP_002323673.2|  hypothetical protein POPTR_0016s14450g           56.2    3e-07   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5           60.1    4e-07   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  59.7    5e-07   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  59.7    5e-07   
emb|CDY64650.1|  BnaAnng19540D                                        58.9    7e-07   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210           58.9    8e-07   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like      58.9    1e-06   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site     58.5    1e-06   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg           58.2    1e-06   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)        58.2    2e-06   
emb|CDY43647.1|  BnaA04g20440D                                        57.8    2e-06   
ref|XP_001419041.1|  predicted protein                                56.6    5e-06   
gb|EJY73103.1|  Vacuolar sorting receptor                             55.5    1e-05   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg           55.1    2e-05   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like      55.1    2e-05   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                  53.5    6e-05   
ref|XP_002501531.1|  predicted protein                                53.1    8e-05   
gb|KDD75638.1|  hypothetical protein H632_c577p0                      52.8    1e-04   
ref|XP_005848848.1|  hypothetical protein CHLNCDRAFT_144184           50.1    8e-04   
ref|XP_005643046.1|  hypothetical protein COCSUDRAFT_49231            50.1    8e-04   



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 95/100 (95%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+KD+YECAIGNFG+PQYGG+MVGTVV
Sbjct  5    LGLLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACKSF+D ++SFKSKPGG+P F++ DRG+C+FT
Sbjct  64   YPKANQKACKSFEDVEISFKSKPGGLPTFLLADRGDCFFT  103



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 95/100 (95%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL+VC+ WF+L GSC+GRFVVEKNSL+VTSPES+KD+YECAIGNFG+PQYGG+MVGTVV
Sbjct  5    LGLLVCV-WFVLWGSCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACKSF+D ++SFKSKPGG+P F++ DRG+C+FT
Sbjct  64   YPKANQKACKSFEDVEISFKSKPGGLPTFLLADRGDCFFT  103



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+L  +LCGSCLGRFVVEKNSL+VTSP SIKD+YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCIL-CVLCGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVM  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CK+F DFD+SFKSKPG MP+F++VDRG+CYFT
Sbjct  64   YPKANQKSCKNFADFDISFKSKPGAMPVFLLVDRGDCYFT  103



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFLLCG C GRFVVEKNSLK+TSPES+K +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLVCV-WFLLCGFCFGRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PGG+P FV+ DRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDISFKSRPGGLPTFVLADRGDCYFT  103



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  +WFLLCG C+GRFVVEKNSLKVTSP S+K +YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACKSFDDFDVSFKSKPGG+P F++VDRG+C+FT
Sbjct  64   YPKANQKACKSFDDFDVSFKSKPGGLPTFLLVDRGDCFFT  103



>ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like [Jatropha curcas]
 gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  +WFLLCGSC GRFVVEKNSLKVTSP+S++ +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLV-FVWFLLCGSCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D SFKSKPGG+P FV+VDRG+CYFT
Sbjct  64   YPKANQKACKEFDEADGSFKSKPGGLPTFVLVDRGDCYFT  103



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQ ACKSFDDFD+SFKSKPGG+P F++VDRG+C+FT
Sbjct  66   KANQGACKSFDDFDISFKSKPGGLPTFLLVDRGDCFFT  103



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQ ACKSFDDFD+SFKSKPGG+P F++VDRG+C+FT
Sbjct  66   KANQGACKSFDDFDISFKSKPGGLPTFLLVDRGDCFFT  103



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
             ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYP
Sbjct  7    FLICM-WVLLVGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQ ACKSFDDFD+SFKSKPGG+P F++VDRG+C+FT
Sbjct  66   KANQGACKSFDDFDISFKSKPGGLPTFLLVDRGDCFFT  103



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGFLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FDDFD+SFKSKPGG+P F++VDRG+C+FT
Sbjct  64   YPKANQGACKIFDDFDISFKSKPGGLPTFLLVDRGDCFFT  103



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WF++ GSCLGRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG+MVG VV
Sbjct  5    LGFLVCV-WFIVIGSCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CK F D D+SFK+K GGMP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKDFADSDISFKTKAGGMPVFVLVDRGDCYFT  103



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  +WFLLCG C+GRFVVEKNSLKVTSP S+K +YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FDDFDVSFKSKPGG+P F++VDRG+C+FT
Sbjct  64   YPKANQKACKGFDDFDVSFKSKPGGLPTFLLVDRGDCFFT  103



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G ++C+ W LL G+CLGRFVVEKNSLKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGFLICV-WILLWGNCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FDDFD+SFKSKPGG+P F++VDRG+C+FT
Sbjct  64   YPKANQGACKIFDDFDISFKSKPGGLPTFLLVDRGDCFFT  103



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +G +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  3    VGFLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVM  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQK+CK+F DFD+ +KSKPGGMP+F++VDRG+C+FT
Sbjct  62   YPKTNQKSCKNFSDFDIFYKSKPGGMPVFLLVDRGDCFFT  101



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+L  +L GSCLGRFVVEKNSL+VTSP SIKD+YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCIL-CVLSGSCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVM  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CK+F DFD+SFKSKPG MP+F++VDRG+CYFT
Sbjct  64   YPKANQKSCKNFTDFDISFKSKPGAMPVFLLVDRGDCYFT  103



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            +WFLLCG C+GRFVVEKNSLKVTSP S+K++YECAIGNFG+PQYGG++VGTV YPKANQK
Sbjct  11   VWFLLCGFCVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVFYPKANQK  70

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            ACK F+DFD+SFKSKPGG+P F++ DRG+CYFT
Sbjct  71   ACKGFEDFDISFKSKPGGLPTFLLADRGDCYFT  103



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFL+ GSC GRFVVEKNSL+VTSPESIKD+YECAIGNFG+PQYGG++VG V 
Sbjct  5    LGFLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVA  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CKSF+  D+SFKSK G MP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKSFESADISFKSKAGSMPVFVLVDRGDCYFT  103



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVM  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CK F D D+SFK+K GGMP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKDFADSDISFKTKAGGMPVFVLVDRGDCYFT  103



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFL+ GSCLGRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  5    LGFLVCV-WFLVIGSCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVM  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CK F D D+SFK+K GGMP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKDFADSDISFKTKAGGMPVFVLVDRGDCYFT  103



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFL+ GSC GRFVVEKNSL+VTSPESIKD+YECAIGNFG+PQYGG++VG V 
Sbjct  5    LGFLVCI-WFLVIGSCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVA  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CKSF+  D+SFKSK G MP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKSFESADISFKSKAGSMPVFVLVDRGDCYFT  103



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = +3

Query  399  LIVCLLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  575
            L+V LLWFL L GSC GRFVVEKNSLK+TSP+S+K +YECAIGNFG+PQYGG+M+GTVVY
Sbjct  9    LVVYLLWFLFLLGSCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVY  68

Query  576  PKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            PKA+QKACKSFDD D+SFKSKPGG P F++ DRG+CYFT
Sbjct  69   PKADQKACKSFDDVDISFKSKPGGRPTFLLADRGDCYFT  107



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PGG+P F++VDRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFT  103



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL+V  +WFLLCG C+GRFVVEKNSLKVTSP S+K LYECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGLLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQKACK F+DFD SFK KPGG+P F++VDRG+CYFT
Sbjct  64   YPKTNQKACKGFEDFDESFKPKPGGLPTFLLVDRGDCYFT  103



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL+V  +WFLLCG C+GRFVVEKNSLKVTSP S+K LYECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGLLV-GVWFLLCGVCVGRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQKACK F+DFD SFK KPGG+P F++VDRG+CYFT
Sbjct  64   YPKTNQKACKGFEDFDESFKPKPGGLPTFLLVDRGDCYFT  103



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +G +VC+ WF+LCG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG+MVG V+
Sbjct  3    VGFLVCI-WFVLCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVM  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQK+CK+F DFD+ +KSKPGGMP+F++VDR +C+FT
Sbjct  62   YPKTNQKSCKNFSDFDIFYKSKPGGMPVFLLVDRRDCFFT  101



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PGG+P F++VDRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFT  103



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PGG+P F++VDRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFT  103



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  62   YPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFT  101



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  +W LLCG CLGRFVVEKNSLK+TSP+S+K +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    LGFLV-GVWLLLCGFCLGRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PG +P FV+ DRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDISFKSRPGWLPTFVLADRGDCYFT  103



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
             +LCGSCLGRFVVEKNSL+VTSP+S+K ++ECAIGNFG+PQYGG++VGTVVYPKANQKAC
Sbjct  13   LMLCGSCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKAC  72

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K FD+ D+SFKSKPGG+P F++ DRG+CYFT
Sbjct  73   KGFDEVDISFKSKPGGLPTFLLADRGDCYFT  103



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  +W LLCG C GRFVVEKN+LK+TSP+S+K +YECAIGNFG+PQYGG++VGTV+
Sbjct  5    LGFLV-GVWLLLCGFCFGRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVI  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD  D+SFKS+PGG+P FV+VDRG+CYFT
Sbjct  64   YPKANQKACKGFDGVDISFKSRPGGLPTFVLVDRGDCYFT  103



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V +L FLLCG   GRFVVEKNSLKVTSPE IK +YECAIGNFG+PQYGG+++GTVV
Sbjct  5    LGFLVGIL-FLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK FD+ D+SFKS+PGG+P F++VDRG+CYFT
Sbjct  64   YPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFT  103



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FD+FD+SFKSKPGG+P F++V+RG+C+FT
Sbjct  64   YPKANQGACKIFDEFDISFKSKPGGLPTFLLVNRGDCFFT  103



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FD+FD+SFKSKPGG+P F++V+RG+C+FT
Sbjct  64   YPKANQGACKIFDEFDISFKSKPGGLPTFLLVNRGDCFFT  103



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FD+FD+SFKSKPGG+P F++V+RG+C+FT
Sbjct  64   YPKANQGACKIFDEFDISFKSKPGGLPTFLLVNRGDCFFT  103



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G+++C+ W +L G+CLGRFVVE+NSLKVTSP SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  5    FGVLICV-WIMLLGNCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQ ACK FD+FD+SFKSKPGG+P F++V+RG+C+FT
Sbjct  64   YPKANQGACKIFDEFDISFKSKPGGLPTFLLVNRGDCFFT  103



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +3

Query  411  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
             +W L LCGSCLGRFVVEKNSL+VTSP+S+K +YECAIGNFG+PQYGG+MVGTVVYPK N
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVN  67

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            QKAC  FD+ D+SFKSKPGG+P F++ DRG+C+FT
Sbjct  68   QKACNDFDEVDLSFKSKPGGLPTFLLADRGDCFFT  102



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             G+  C+ WF+L  SCLGRFVVEKNSLKVTSP+S+KD+YECAIGNFG+P YGGSM G+V 
Sbjct  5    FGIWACV-WFVLVVSCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVF  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+N+KACK+F DFD++ K+KPGG+PIF++ DRGEC+FT
Sbjct  64   YPKSNEKACKNFQDFDIALKTKPGGLPIFLLADRGECFFT  103



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +3

Query  411  LLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
             +W L LCGSCLGRFVVEKNSL+VTSP+S+K +YECAIGNFG+PQYGG+MVGTVVYPK N
Sbjct  8    FIWALFLCGSCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVN  67

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            QKAC  FD+ D+SFKSKPGG+P F++ DRG+C+FT
Sbjct  68   QKACNDFDEVDLSFKSKPGGLPTFLLADRGDCFFT  102



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 6/100 (6%)
 Frame = +3

Query  411  LLW------FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +LW      FLL GSC GRFVVEKNSLKVTSP+S+K +YECAIGNFG+PQYGG+MVG V 
Sbjct  5    MLWISVWVLFLLWGSCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVA  64

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQKACKSF DFD+S+KSKPGG P F++VDRG+CYFT
Sbjct  65   YPKDNQKACKSFRDFDISYKSKPGGFPTFLLVDRGDCYFT  104



>pdb|4TJV|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vacuolar Sorting Receptor 1
 pdb|4TJX|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vsr1 In Complex With Aleurain Peptide
Length=165

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +3

Query  447  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  626
            RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKACKS+ DFD+S
Sbjct  3    RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDIS  62

Query  627  FKSKPGGMPIFVVVDRGECYFT  692
            FKSKPG +P FV++DRG+CYFT
Sbjct  63   FKSKPGRLPTFVLIDRGDCYFT  84



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ W L+ G   GRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG++VG VV
Sbjct  5    LGFLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CKSF+  D+SFKSK G MP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKSFESADISFKSKAGSMPVFVLVDRGDCYFT  103



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ W L+ G   GRFVVEKNSL+VTSP+SIKD+YECAIGNFG+PQYGG++VG VV
Sbjct  5    LGFLVCV-WCLVIGCSYGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVV  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQK+CKSF+  D+SFKSK G MP+FV+VDRG+CYFT
Sbjct  64   YPKANQKSCKSFESADISFKSKAGSMPVFVLVDRGDCYFT  103



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  417  WFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKA  596
            W +  GSC+G FVVEKNSL+VTSPESI+ +YECA+GNFG+PQYGGSM G+VVYPKANQKA
Sbjct  39   WVMWWGSCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKA  98

Query  597  CKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            CK+F+DFD+SF S+  G+P FV+VDRG+CYFT
Sbjct  99   CKNFEDFDISFISRVAGLPTFVLVDRGDCYFT  130



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+K  YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQ ACK F+D D SFK KPGG+P FV+VDRG+CYFT
Sbjct  64   YPKTNQMACKGFEDTDESFKPKPGGLPTFVLVDRGDCYFT  103



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFLLCG C+ RFVVEK+SLKVTSP S+K  YECAIGNFG+PQYGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCGVCVARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQ ACK F+D D SFK KPGG+P FV+VDRG+CYFT
Sbjct  64   YPKTNQMACKGFEDTDESFKPKPGGLPTFVLVDRGDCYFT  103



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +G +VC+L F++CG C+GRFVVEKNSL+VTSP+SIK++YECAIGNFG+PQYGG++VG V+
Sbjct  3    VGFLVCIL-FVMCGCCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTLVGNVM  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+N+K+C +F DFD+ +KSKPGG P+F++VDRG+C+FT
Sbjct  62   YPKSNKKSCNNFSDFDIFYKSKPGGRPVFLLVDRGDCFFT  101



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +3

Query  399  LIVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  575
            L+   +W L   GSCLGRFVVEKNSLKVTSPE +K +YECAIGNFG+PQYGG+M+GTV+Y
Sbjct  5    LLPIFIWALFFWGSCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIY  64

Query  576  PKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            PKANQKACK FD+ D+SFKSKPGG+P F++ DRG+C+FT
Sbjct  65   PKANQKACKDFDEVDLSFKSKPGGLPTFLLADRGDCFFT  103



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 5/98 (5%)
 Frame = +3

Query  414  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            LWF      L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYP
Sbjct  5    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYP  64

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAN+KAC++F DFD+SFKSKPGG P F++VDRG+CYFT
Sbjct  65   KANKKACRNFADFDISFKSKPGGFPTFLLVDRGDCYFT  102



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = +3

Query  414  LWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            +W L L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYPKAN+
Sbjct  9    VWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANR  68

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAC+SFDDFD+SFK KPGG P F++VDRG+C+FT
Sbjct  69   KACQSFDDFDISFKPKPGGFPTFLLVDRGDCFFT  102



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 90/101 (89%), Gaps = 1/101 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTV  569
            LG++VC+L F+   SC+ GRFVVEKNSLKVTSP  +K +YECAIGNFG+PQYGG++VGTV
Sbjct  5    LGILVCVLVFVSWSSCVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTV  64

Query  570  VYPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            VYP+ANQKACK+F+DF VSFKSKPGG+P F++ DRG+C+FT
Sbjct  65   VYPQANQKACKNFEDFSVSFKSKPGGLPTFLLADRGDCFFT  105



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 5/98 (5%)
 Frame = +3

Query  414  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            LWF      L GS LGRFVVEKNSLKVTSPES+K +YECAIGNFG+PQYGG+MVG VVYP
Sbjct  9    LWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYP  68

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAN+KAC  FDDFD+SFKSKPG  P F++VDRG+CYFT
Sbjct  69   KANRKACSKFDDFDISFKSKPGSFPTFLLVDRGDCYFT  106



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+ G+ LGRFVVEKN+LKVTSP+SI+ +YECAIGNFG+PQYGG++VGTVVYP +NQ
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQ  69

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACK+F+DFDVSFKSKPG +P FV++DRG+CYFT
Sbjct  70   KACKNFEDFDVSFKSKPGHLPTFVLIDRGDCYFT  103



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+ G+ LGRFVVEKN+LKVTSP+SI+ +YECAIGNFG+PQYGG++VGTVVYP +NQ
Sbjct  10   LSFVLILGTALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQ  69

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACK+F+DFDVSFKSKPG +P FV++DRG+CYFT
Sbjct  70   KACKNFEDFDVSFKSKPGHLPTFVLIDRGDCYFT  103



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 83/98 (85%), Gaps = 5/98 (5%)
 Frame = +3

Query  414  LWF-----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            LWF      L GS  GRFVVEKNSLKVTSPES+K  +ECAIGNFG+PQYGG+MVG V YP
Sbjct  5    LWFSVWVLFLWGSSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYP  64

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAN+KACKSFDDFD+SFKSKPGG P F+++DRG+CYFT
Sbjct  65   KANRKACKSFDDFDISFKSKPGGFPTFLLLDRGDCYFT  102



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            +LWF   GSC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYPKAN 
Sbjct  16   MLWFT--GSCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANH  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K+CK+FDDFD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  74   KSCKNFDDFDISFRSRVAGLPTFVLVDRGDCYFT  107



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            I  L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK
Sbjct  8    IFTLSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPK  67

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  68   SNQKACKSYTDFDISFKSKPGRLPTFVLIDRGDCYFT  104



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGS-CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTV  569
            +G  V + W ++ G  C GRFVVEKN+L+VTSPESI+ +YECAIGNFG+PQYGGSM G V
Sbjct  5    IGYGVMMSWVMVMGWWCEGRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEV  64

Query  570  VYPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            V+PKANQK C+SFD FD+SF SKPGG+P FV+VDRG+CYFT
Sbjct  65   VFPKANQKGCQSFDQFDISFSSKPGGLPTFVLVDRGDCYFT  105



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +GL+V  L  +  G C GRFVVEKN+L+VTSPE+I+ +YECA+GNFG+PQYGGSM G VV
Sbjct  7    VGLVVMGLVMVWLGPCTGRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVV  66

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKANQKACK+F+DFD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  67   YPKANQKACKNFNDFDISFRSRLAGLPTFVLVDRGDCYFT  106



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQKACK+FDDFD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   KANQKACKNFDDFDISFRSRVAGLPTFVLVDRGDCYFT  105



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS++DFD+SFKSKPG +P FV++DRG+C+FT
Sbjct  71   KACKSYNDFDISFKSKPGRLPTFVLIDRGDCFFT  104



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            +V ++W +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYPK
Sbjct  8    LVVIVWVMGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPK  67

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            ANQK CK+FDDF++SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   ANQKGCKNFDDFEISFRSRLAGLPTFVLVDRGDCYFT  104



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  62   YPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFT  101



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YP
Sbjct  9    LFVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQKACKSFDD  +SFKSKPG +P FV+ DRG+CYFT
Sbjct  66   KANQKACKSFDDAGISFKSKPGSLPTFVLADRGDCYFT  103



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 81/94 (86%), Gaps = 3/94 (3%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LLW   CG C  RFVVEKNSL+VT+PE++K  YECAIGNFG+PQYGG+MVG V YPKAN+
Sbjct  18   LLW---CGGCDARFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANR  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACK FDDFDVSFK++PG +P F++VDRG+CYFT
Sbjct  75   KACKGFDDFDVSFKARPGALPTFLLVDRGDCYFT  108



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  62   YPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFT  101



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL   L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  3    LGLFT-LSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVV  61

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  62   YPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFT  101



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LGL   L + L+    LGRFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVV
Sbjct  6    LGLFT-LSFLLILNLALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVV  64

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKACKS+ DFD+SFKSKPG +P FV++DRG+CYF 
Sbjct  65   YPKSNQKACKSYTDFDISFKSKPGRLPTFVLIDRGDCYFA  104



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
            FLLC SC GRFVVEKNSLKVT P+SIK +YECAIGNFG+P+YGG+M G V YPKANQKAC
Sbjct  13   FLLCVSCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKAC  72

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KSFDD  +SFKSKPG +P FV+ DRG+CYFT
Sbjct  73   KSFDDVGISFKSKPGSLPTFVLADRGDCYFT  103



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  608
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  609  DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  82   DDFDISYKAKPGSLPTFLLVDRGDCFFT  109



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            SC+GRFVVEKNSL+VTSPESI+ +YECA+GNFG+PQYGGSM G+VVYPKANQKACK+F+D
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
            FD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  89   FDISFRSRVSGLPTFVLVDRGDCYFT  114



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  608
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  609  DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  82   DDFDISYKAKPGSLPTFLLVDRGDCFFT  109



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  608
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  609  DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  82   DDFDISYKAKPGSLPTFLLVDRGDCFFT  109



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  608
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  22   CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  81

Query  609  DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  82   DDFDISYKAKPGSLPTFLLVDRGDCFFT  109



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L V  +  LL GSC G+FVVEKNSLKVTSP+S+K +YECAIGNFG+PQYGG+MVG V YP
Sbjct  8    LRVVWVSVLLWGSCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAN+K C+ FD+FD+S+KSKPGG P F++VDRG+CYFT
Sbjct  68   KANRKGCQGFDNFDISYKSKPGGFPTFLLVDRGDCYFT  105



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis sativus]
Length=624

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            I+  + F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YPK
Sbjct  7    ILLFVCFILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPK  66

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            ANQKACKSFDD  +SFKSKPG +P FV+ DRG+CYFT
Sbjct  67   ANQKACKSFDDAGISFKSKPGSLPTFVLADRGDCYFT  103



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  8    LSFLLILNLSMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  67

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  68   KACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFT  101



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  396  GLIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             ++  L+W  LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  8    AMLQLLVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKAN+KACKSFDDFD+S+K+KPG  P F++VDRG+CYFT
Sbjct  68   YPKANKKACKSFDDFDISYKAKPGAFPTFLLVDRGDCYFT  107



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L VC   F+L  SCLGRFVVEKNSLK+TSP+SIK +YECAIGNFG+P+YGG+M G V YP
Sbjct  9    LYVC---FILSVSCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQKACKSFDD  +SFKSKPG +P FV+ DRG+CYFT
Sbjct  66   KANQKACKSFDDAGISFKSKPGSLPTFVLADRGDCYFT  103



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  429  CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSF  608
            CGSC GRFVVEKNSLKVTSP  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSF
Sbjct  124  CGSCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSF  183

Query  609  DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  184  DDFDISYKAKPGSLPTFLLVDRGDCFFT  211



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  396  GLIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             ++  L+W  LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  8    AMLRLLVWAALLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKAN+KACKSFDDFD+S+K+KPG  P F++VDRG+CYFT
Sbjct  68   YPKANKKACKSFDDFDISYKAKPGAFPTFLLVDRGDCYFT  107



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 89/101 (88%), Gaps = 2/101 (2%)
 Frame = +3

Query  393  LGLIVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTV  569
            +GL+V ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFGIPQYGGSM G V
Sbjct  4    VGLVV-IVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAV  62

Query  570  VYPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +YPKANQKACK+F DFD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  63   LYPKANQKACKNFADFDISFRSRVAGLPTFVLVDRGDCYFT  103



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            L L+VC    LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  10   LRLLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKAN+KACKSFDDFD+S+K+KPG  P F++VDRG+CYF 
Sbjct  68   YPKANRKACKSFDDFDISYKAKPGAFPTFLLVDRGDCYFA  107



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            L L+VC    LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V 
Sbjct  10   LRLLVCAA--LLLGCCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVA  67

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPKAN+KACKSFDDFD+S+K+KPG  P F++VDRG+CYF 
Sbjct  68   YPKANRKACKSFDDFDISYKAKPGAFPTFLLVDRGDCYFA  107



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YPK+NQ
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS++DFD+SFKSKPGG+P FV++DRG+C+FT
Sbjct  71   KACKSYNDFDISFKSKPGGLPTFVLIDRGDCFFT  104



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS+ DFD+SFKS+PG +P FV++DRG+C+FT
Sbjct  71   KACKSYSDFDISFKSRPGRLPTFVLIDRGDCFFT  104



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    L RFVVEKN+LKVTSPESIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILNLALCRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS+ DFD+SFKSKPG +P FV++DRG+CYFT
Sbjct  71   KACKSYTDFDISFKSKPGRLPTFVLIDRGDCYFT  104



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQKACK+FD FD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   KANQKACKNFDGFDISFRSRVAGLPTFVLVDRGDCYFT  105



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            ++ ++W ++   SC+GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G V+YP
Sbjct  8    LIVMVWIIVGWSSCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KANQKACK+FD FD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   KANQKACKNFDGFDISFRSRVAGLPTFVLVDRGDCYFT  105



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + ++    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LFFLVILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS++DFD+SFKSKPG  P FV++DRG+C+FT
Sbjct  71   KACKSYNDFDISFKSKPGQKPTFVLIDRGDCFFT  104



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YP++NQ
Sbjct  11   LSFLLISSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS++DFD+SFKSKPGG+P FV++DRG+C+FT
Sbjct  71   KACKSYNDFDISFKSKPGGLPTFVLIDRGDCFFT  104



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +VC+ WFLLC  C+GRFVVEKN LKVTSP S+K  YECAIGNFG+P YGG++VGTV 
Sbjct  5    LGFLVCV-WFLLCRVCVGRFVVEKNRLKVTSPSSMKGDYECAIGNFGVPPYGGTLVGTVY  63

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQ ACK F+D D +FK KP G+P FV+VDRG+CYFT
Sbjct  64   YPKTNQMACKGFEDTDETFKPKPRGLPTFVLVDRGDCYFT  103



>ref|XP_006403762.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45215.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=654

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    LGRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQ
Sbjct  11   LSFLLILSLALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS+ DFD+SFKS+PG +P FV++DRG+C+FT
Sbjct  71   KACKSYSDFDISFKSRPGRLPTFVLIDRGDCFFT  104



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 5/98 (5%)
 Frame = +3

Query  411  LLWFL-----LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVY  575
            +LW L     LCG+C GRFVVEKNSLKVTSP S+K +YE AIGNFG+PQYGG+MVG V Y
Sbjct  5    MLWLLVPVLFLCGTCWGRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAY  64

Query  576  PKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYF  689
            PK N KAC +F DFD+S+KSKPGG P F++VDRG+CYF
Sbjct  65   PKVNWKACHNFKDFDISYKSKPGGFPTFLLVDRGDCYF  102



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L + L+    L RFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTV YP++NQ
Sbjct  11   LSFLLILSPALCRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQ  70

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKS++DFD+SFKSKPGG+P FV++DRG+C+FT
Sbjct  71   KACKSYNDFDISFKSKPGGLPTFVLIDRGDCFFT  104



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 3/94 (3%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LLW   CG C  RFVVEKNSL+VT+P ++K  YECAIGNFG+PQYGG+MVG V YPKAN+
Sbjct  35   LLW---CGGCDARFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANR  91

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACK FDDFDVSFK++PG +P F++VDRG+CYFT
Sbjct  92   KACKGFDDFDVSFKARPGALPTFLLVDRGDCYFT  125



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +V ++W  +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYP
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K NQKACK+FDDF++SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   KTNQKACKNFDDFEISFRSRVAGLPTFVLVDRGDCYFT  105



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 84/98 (86%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +V ++W  +   SC GRFVVEKN+L+VTSPESI+ +YECA+GNFG+PQYGGSM G VVYP
Sbjct  8    LVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYP  67

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K NQKACK+FDDF++SF+S+  G+P FV+VDRG+CYFT
Sbjct  68   KTNQKACKNFDDFEISFRSRVAGLPTFVLVDRGDCYFT  105



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
            FLL  SC GRFVVEKNSLKV SP+S+K L+ECAIGNFG+PQYGG++VG+V YPK+NQKAC
Sbjct  13   FLLLASCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKAC  72

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             +F D D+SF++KPGG+PIF++ DRG+CYFT
Sbjct  73   TNFQDVDLSFQTKPGGIPIFLLADRGDCYFT  103



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +3

Query  423  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  602
            LL G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACK
Sbjct  21   LLLGCCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACK  80

Query  603  SFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            SFDDFD+S+K+KPG  P F++VDRG+CYF 
Sbjct  81   SFDDFDISYKAKPGAFPTFLLVDRGDCYFA  110



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
             L+ G  +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILGLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KS+ DFD++FKSK G +P FV++DRG+C+FT
Sbjct  74   KSYSDFDITFKSKAGRLPTFVLIDRGDCFFT  104



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  426  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  605
            + G   GRFVVEKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KAC+S
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRS  75

Query  606  FDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            FDDFD+SFK KPGG+PIF++VDRG+CYFT
Sbjct  76   FDDFDLSFKPKPGGLPIFLLVDRGDCYFT  104



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            +W  LCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+GTVVYPK N+ 
Sbjct  11   VWIYLCGSCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKN  70

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             C  F+D D S  SKPG  P FV+VDRG+CYFT
Sbjct  71   GCTKFNDADTSLNSKPGSFPTFVLVDRGDCYFT  103



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  426  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  605
            + G   GRFVVEKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KAC+S
Sbjct  16   MAGEAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRS  75

Query  606  FDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            FDDFD+SFK KPGG+P+F++VDRG+CYFT
Sbjct  76   FDDFDLSFKPKPGGLPVFLLVDRGDCYFT  104



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  426  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  605
             C  C GRFVVEKNSLKVT+P+S+K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKS
Sbjct  90   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKS  149

Query  606  FDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            FDDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  150  FDDFDISYKAKPGSLPTFLLVDRGDCFFT  178



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            L  ++C+ W  LCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+GTVV
Sbjct  7    LTFLLCV-WIFLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVV  65

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK N+  C  F+D D S  SKPG  P FV+VDRG+CYFT
Sbjct  66   YPKFNRNGCNKFNDGDTSLTSKPGSFPTFVLVDRGDCYFT  105



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            SC+GRFVVEKNSL+VTS E I+ +YECA+GNFG+PQYGGSM G+VVYPKANQKACK+F+D
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
            FD+SF+S+  G+P FV+VDRG+CYFT
Sbjct  90   FDISFRSRVSGLPTFVLVDRGDCYFT  115



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +V   W LLC  C  GRFVVEKNSL VTSPE IK  Y+ AIGNFGIPQYGGSM GTVVYP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYP  68

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K NQKACK+FD+F +SF+SKPG +P FV+VDRG+C+F 
Sbjct  69   KDNQKACKAFDEFSISFQSKPGSLPTFVLVDRGDCFFA  106



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G C GRFVV+KNSLKVTSP S+K  +ECAIGNFG+PQYGG++VGTVVYP ANQ ACK F 
Sbjct  23   GGCEGRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFR  82

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +FD+SFK+KPGG+P+FV+ DRG+CYFT
Sbjct  83   EFDLSFKTKPGGLPVFVLADRGDCYFT  109



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
             L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILSLAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KS+ DFD+SFKSK G +P FV++DRG+C+FT
Sbjct  74   KSYSDFDISFKSKAGRLPTFVLIDRGDCFFT  104



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  426  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  605
             C  C GRFVVEKNSLKVT+P+S+K  YECAIGNFG+PQYGG+MVG V YPK+N+KACKS
Sbjct  15   FCCCCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKS  74

Query  606  FDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            FDDFD+S+K+KPG +P F++VDRG+C+FT
Sbjct  75   FDDFDISYKAKPGSLPTFLLVDRGDCFFT  103



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
             L+    +GRFVVEKN+LKVTSP+SIK +YECAIGNFG+PQYGG++VGTVVYPK+NQKAC
Sbjct  14   LLILSVAVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKAC  73

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KS+ DFD++FKSK G +P FV++DRG+C+FT
Sbjct  74   KSYSDFDITFKSKAGRLPTFVLIDRGDCFFT  104



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFD
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFD  79

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DFD+S+K+KPG  P F++VDRG+CYF 
Sbjct  80   DFDISYKAKPGAFPTFLLVDRGDCYFA  106



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G C GRFVVEKNSLKVT+P+ +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFD
Sbjct  20   GCCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFD  79

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DFD+S+K+KPG  P F++VDRG+CYF 
Sbjct  80   DFDISYKAKPGAFPTFLLVDRGDCYFA  106



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            LW LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  13   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  72

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             C+   +FD S  SKPG  P FV+VDRG+CYFT
Sbjct  73   GCR---NFDASLSSKPGTFPTFVLVDRGDCYFT  102



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            LW LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  11   LWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  70

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             C+   +FD S  SKPG  P FV+VDRG+CYFT
Sbjct  71   GCR---NFDASLSSKPGTFPTFVLVDRGDCYFT  100



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C GRFVVEKNSLKVT+P++++  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDDF
Sbjct  23   CEGRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDF  82

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
            D+S+K+KPG  P F++VDRG+C+FT
Sbjct  83   DISYKAKPGSFPTFLLVDRGDCFFT  107



>ref|XP_006842496.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 ref|XP_011622665.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  396  GLIVCLLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
             L+  L+W  L+     GRFVVEKNSL+VTSP+S+KD YECAIGNFG+PQYGG+MVGTV 
Sbjct  3    NLLCLLVWASLIWVPVYGRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVT  62

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK+NQKAC+ + + ++SFKSKPGG+P  V+ DRG+CYFT
Sbjct  63   YPKSNQKACREYKEVEISFKSKPGGLPTIVLADRGDCYFT  102



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            +W LLCGSC+GRFVVEKN+LK+TSP+S++ +YECAIGNFG+P+YGG+M+G+VVYPK+NQ 
Sbjct  13   VWILLCGSCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQN  72

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             C+   +FD S  SKPG  P FV+VDRG+CYFT
Sbjct  73   GCR---NFDASLSSKPGTFPTFVLVDRGDCYFT  102



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  82   DFGISFKSKPGALPAFVLVDRGDCFFA  108



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            CLGRFVVEKN+LKVTSPES++ +YECAIGNFG+PQYGG MVG+V YPK NQK C +F D 
Sbjct  22   CLGRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDS  81

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
            D+S K+KPGG+P+FV+ DRGECYFT
Sbjct  82   DLSSKTKPGGIPLFVLADRGECYFT  106



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 86/102 (84%), Gaps = 4/102 (4%)
 Frame = +3

Query  396  GLIVCLLWFLLCGS---CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGT  566
            G++ C+   LL GS   C GRFVVEKN+L+VTSP S++ +YECAIGNFG+PQYGG+M+G+
Sbjct  10   GVLACICLILL-GSLPCCWGRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGS  68

Query  567  VVYPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            V YPKANQKAC +F D D+++K+KPGG+PIF++ DRG+CYFT
Sbjct  69   VFYPKANQKACNTFQDSDITWKNKPGGIPIFLLADRGDCYFT  110



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  402  IVCLLWFLLCGSCL-GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +V   W LLC  C  GRFVVEKNSL VTSPE IK  Y+ AIGNFGIPQYGGSM GTVVYP
Sbjct  9    VVLSFWLLLCIGCSDGRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYP  68

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K NQK CK+FD+F +SF SKPG +P FV+VDRG+C+F 
Sbjct  69   KDNQKGCKAFDEFSISFPSKPGSLPTFVLVDRGDCFFA  106



>ref|XP_011652916.1| PREDICTED: vacuolar-sorting receptor 4 isoform X1 [Cucumis sativus]
Length=633

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LLW  L   C+GRFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQ
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK F DF +SF+SKPG +PIFV+VDRG+C F 
Sbjct  74   KGCKDFGDFHISFQSKPGSLPIFVMVDRGDCLFA  107



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 4 isoform X2 [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LLW  L   C+GRFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQ
Sbjct  14   LLWLSLVPLCMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK F DF +SF+SKPG +PIFV+VDRG+C F 
Sbjct  74   KGCKDFGDFHISFQSKPGSLPIFVMVDRGDCLFA  107



>tpg|DAA39320.1| TPA: hypothetical protein ZEAMMB73_030788 [Zea mays]
Length=143

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            L L+VC    LL G C GRFVV+KN+LKVT+P+ +K  YECAIGNF +PQYG +MVG V 
Sbjct  10   LQLLVCAT--LLLGCCHGRFVVDKNNLKVTAPDDLKGTYECAIGNFEVPQYGDTMVGFVA  67

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYF  689
            YPKAN+KACKSF+DFD+++K+KPG  P F++VDRGE  F
Sbjct  68   YPKANRKACKSFEDFDINYKAKPGAFPTFLLVDRGEKQF  106



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  82   DFGISFKSKPGALPAFVLVDRGDCFFA  108



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G+C  RFVVEKNSL++TSPE IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CKSFD
Sbjct  22   GNCYARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFD  81

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
            DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  82   DFGISFKSKPGALPAFVLVDRGDCFFA  108



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +IV LL  ++   CLGRFVVEKNSLKVTSP S++ +YECAIGNFG+PQYGG+M G V +P
Sbjct  11   VIVSLL-MMMISLCLGRFVVEKNSLKVTSPSSLRGVYECAIGNFGVPQYGGAMGGIVAFP  69

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K+NQK CK F D D+SFK KPGG+P+F++V+RGEC+FT
Sbjct  70   KSNQKGCKPFSDDDISFKPKPGGLPVFLLVERGECFFT  107



>gb|AIY30334.1| vacuolar-sorting receptor 3 protein, partial [Ziziphus jujuba]
Length=155

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKN+L+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYPK NQK CK F DF +
Sbjct  28   ARFVVEKNNLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFTDFGI  87

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSKPG +P FV+VDRG+C+F 
Sbjct  88   SFKSKPGALPTFVLVDRGDCFFA  110



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            +C G FVVEKNSL+VT+P  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDD
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  110

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
            FD+S+K KPG +P F++VDRG+C+FT
Sbjct  111  FDISYKPKPGSLPTFLLVDRGDCFFT  136



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  426  LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKS  605
            + G   GRFV EKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKAN+KACK+
Sbjct  20   MAGEAAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKA  79

Query  606  FDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            FD+FD+SFK K GG+P+F++VDRG+CYFT
Sbjct  80   FDEFDLSFKPKSGGLPVFLLVDRGDCYFT  108



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L+  SC+GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YPK N+
Sbjct  18   LVACLMVSSCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNK  77

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK FDDF VSFKS+PG +P FV++DRG+C+F 
Sbjct  78   KGCKEFDDFGVSFKSRPGALPTFVLLDRGDCFFA  111



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKSF DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  74   KACKSFGDFGISFKSKPGSLPTFVLVDRGDCFFA  107



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C G F+VEKNSL+VT+P  +K  YECAIGNFG+PQYGG+MVG V YPKAN+KACKSFDDF
Sbjct  97   CHGGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDF  156

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
            D+S+K KPG +P F++VDRG+C+FT
Sbjct  157  DISYKPKPGSLPTFLLVDRGDCFFT  181



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKSF DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  74   KACKSFGDFGISFKSKPGSLPTFVLVDRGDCFFA  107



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F++VDRG+C+F 
Sbjct  78   SISFKSQPGALPTFLLVDRGDCFFA  102



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F++VDRG+C+F 
Sbjct  78   SISFKSQPGALPTFLLVDRGDCFFA  102



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSP+SIK  ++CAIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  18   CESRFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  77

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F++VDRG+C+F 
Sbjct  78   SISFKSQPGALPTFLLVDRGDCFFA  102



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L+ C+ WF + G+C GRFVVEKN L VTSP S+  +YE AIGNFG+P+YGG+M+G+V YP
Sbjct  1    LLTCV-WFAVFGACFGRFVVEKNRLTVTSPGSLSGVYETAIGNFGVPKYGGTMLGSVFYP  59

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             +NQKAC++F D   S K+KPGG+PIF++ DRGECYFT
Sbjct  60   SSNQKACQNFQDIATSMKTKPGGIPIFLLADRGECYFT  97



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   138 bits (347),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +3

Query  456  VEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVSFKS  635
            +EKNSL+VT+PE++K  YECAIGNFG+PQYGG+MVG V YPKAN+KACK FD+FDVSFK+
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  636  KPGGMPIFVVVDRGECYF  689
            +PG +P F++VDRG+CYF
Sbjct  390  RPGALPTFLLVDRGDCYF  407



>ref|XP_007134557.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
 gb|ESW06551.1| hypothetical protein PHAVU_010G057200g [Phaseolus vulgaris]
Length=625

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = +3

Query  414  LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQK  593
            +W LLCGSC+G FVVEKN+LK+TSP S+K +YECAIGNFG+P+YGG+M+G+VVYPK +Q 
Sbjct  14   VWILLCGSCVGTFVVEKNNLKITSPNSLKGIYECAIGNFGVPKYGGTMIGSVVYPKTDQN  73

Query  594  ACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             CK FD    S  SKPG  P FV++DRGEC+FT
Sbjct  74   GCKPFDS---SLSSKPGTFPSFVLIDRGECFFT  103



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            SC  RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F D
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
            F +SFKS+PG +P F++VDRG+C+F 
Sbjct  79   FSISFKSQPGALPTFLLVDRGDCFFA  104



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKSF DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  74   KACKSFGDFGISFKSKPGSLPTFVLVDRGDCFFA  107



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKSF DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  74   KACKSFGDFGISFKSKPGSLPTFVLVDRGDCFFA  107



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL F+   +C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G VVYPK NQ
Sbjct  16   LLSFI--SNCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQ  73

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACKSF DF +SFKSKPG +P FV+VDRG+C+F 
Sbjct  74   KACKSFGDFGISFKSKPGSLPTFVLVDRGDCFFA  107



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            SC  RFVVEKN+LKVTSPES+K LYECAIGNFG+PQYGG+M G+V YPK+N+ AC  F  
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
             D+++++KPGG+P F++VDRGECYFT
Sbjct  75   SDITWRNKPGGIPAFLLVDRGECYFT  100



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            ++ L + L+    LG+F+VEKN+LKVTSPE+IK +YECAIGNFGIP+YGG++VG VV+P 
Sbjct  7    VITLSFVLILQLALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPV  66

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +N KACKSF +F VSFKS PG +P F+++DRG+CYFT
Sbjct  67   SNHKACKSFSEFGVSFKSTPGRLPTFLLIDRGDCYFT  103



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L+V  +   + G+C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYP  66

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K N+K CK FD+F +SF+SKPG +P FV++DRG+C+F 
Sbjct  67   KENRKGCKGFDEFGISFQSKPGALPTFVLLDRGDCFFA  104



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSPE IK  YECAIGNFG+PQYGG++ G V YPK+NQKACKSF+DFD+
Sbjct  22   GRFVVEKNSLRVTSPEGIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNQKACKSFEDFDI  81

Query  624  SFKS-KPGGMPIFVVVDRGECYFT  692
            SFKS + GG P FV++DRG+CYFT
Sbjct  82   SFKSTRSGGRPKFVLIDRGQCYFT  105



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSPESIK  ++ AIGNFG+PQYGGSM GTVVYPK NQKACK F DF
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDF  88

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F+++DRG+C+F 
Sbjct  89   SISFKSQPGALPTFLLLDRGDCFFA  113



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C GRF+VEKNSL++TSP+S+K  YECAIGNFG+PQYGG++VG+VVYP  NQK CK+F DF
Sbjct  20   CFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFTDF  79

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
              SF S PG  P FV+VDRG+CYFT
Sbjct  80   SASFHSMPGNFPTFVLVDRGDCYFT  104



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C+ RFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQK CK F DF
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SF+SKPG +PIFV+VDRG+C F 
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFA  107



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL+VTSP +++ +YECAIGNFG+PQYGG+M G VVYPKAN KACK F DF +
Sbjct  32   ARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANGKACKPFADFGL  91

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFK KPGG+P+F++VDRG+CYFT
Sbjct  92   SFKPKPGGLPVFLLVDRGDCYFT  114



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C+ RFVVEKNSL+VTSPE I+  Y+ AIGNFGIPQYGGS+ G VVYPK NQK CK F DF
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SF+SKPG +PIFV+VDRG+C F 
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFA  107



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +PIF++VDRG+C+F 
Sbjct  154  SFKSQPGALPIFLLVDRGDCFFA  176



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            +  GRFVVEKNSL+VTSP+SIK  YECAIGNFG+PQYGG++ G V YPK+N+KACKSF+D
Sbjct  21   TAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFED  80

Query  615  FDVSFKS-KPGGMPIFVVVDRGECYFT  692
            FD+SFKS + GG P FV++DRG+CYFT
Sbjct  81   FDISFKSTRSGGRPKFVLIDRGDCYFT  107



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  25   CKARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  84

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F++VDRG+C+F 
Sbjct  85   SISFKSQPGALPTFLLVDRGDCFFA  109



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFA  104



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L+V  +   + G+C  RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  7    LLVGFVLLSVIGNCYARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYP  66

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K N+K CK FD+F +SF+SKPG +P FV++DRG+C+F 
Sbjct  67   KENRKGCKGFDEFGISFQSKPGALPTFVLLDRGDCFFA  104



>ref|XP_010039169.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
Length=195

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            +I   +W +   SC GRF V KNSL+VTSPES+K  Y+ +IG+FG+P+ GG+M GT+VYP
Sbjct  6    MISVWVWCIFFESCSGRFTVAKNSLEVTSPESMKGFYDSSIGSFGVPKRGGTMAGTIVYP  65

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K+N+KACKSF DF +SF S  GG+P F++ DRG+C+F+
Sbjct  66   KSNRKACKSFGDFGLSFNSNSGGLPTFLLADRGDCFFS  103



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K+CK F DF +
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDFSI  84

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +PIF++VDRG+C+F 
Sbjct  85   SFKSQPGALPIFLLVDRGDCFFA  107



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  414  LWFLL-CGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
             W L+   + +GRFVVEKNSL+VTSPESIK  ++ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   FWVLIFTQAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNR  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK+FDDF +SFK+K G MP FV+VDRG+C+F 
Sbjct  75   KGCKNFDDFGISFKAKAGAMPNFVLVDRGDCFFA  108



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  25   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  84

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  85   SFKSQPGALPTFLLVDRGDCFFA  107



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFA  104



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  411  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
             LW  LL  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGN  74

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            QK C++FDD  +SFKSK G MP FV+VDRG+C+F 
Sbjct  75   QKGCRNFDDSGISFKSKSGAMPTFVLVDRGDCFFA  109



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  411  LLWF-LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
             LW  LL  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N
Sbjct  15   FLWLNLLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGN  74

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            QK C++FDD  +SFKSK G MP FV+VDRG+C+F 
Sbjct  75   QKGCRNFDDSGISFKSKSGAMPTFVLVDRGDCFFA  109



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFA  106



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFA  105



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFA  106



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFA  105



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFA  105



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRF+VEKNSLK+TSP+S+K  YECAIGNFG+PQYGG++VG+VVYP  NQK C +F D + 
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCDNFTDVNA  80

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SF+SKPGG P F++VDRG+CYFT
Sbjct  81   SFQSKPGGFPTFLLVDRGDCYFT  103



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  438  CLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
            C  RFVVEKNSL VTSPESIK  ++ AIGNFG+PQYGGSM GTVVYPK N KACK F DF
Sbjct  29   CDARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDF  88

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F+++DRG+C+F 
Sbjct  89   SISFKSQPGALPTFLLLDRGDCFFA  113



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFA  105



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTV+YPK NQK+CK F DF +
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFA  109



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTV+YPK NQK+CK F DF +
Sbjct  27   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDFSI  86

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +P F++VDRG+C+F 
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFA  109



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            ++ L + L+     G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP 
Sbjct  5    VLALSFILILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPM  64

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +N K CKSF +F VSFKS PG +P F+++DRG+CYF 
Sbjct  65   SNHKGCKSFSEFGVSFKSSPGSLPTFLLIDRGDCYFA  101



>ref|XP_012093114.1| PREDICTED: vacuolar-sorting receptor 3 [Jatropha curcas]
 gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = +3

Query  396  GLIVCL---LWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGT  566
            G  VCL   L +L+    + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G 
Sbjct  7    GFTVCLGFLLMYLMVTGSVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGA  66

Query  567  VVYPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            V YPK N+K CK F+DF +SFKS+PG +P FV++DRG+C+F 
Sbjct  67   VTYPKDNRKGCKDFNDFGLSFKSQPGALPTFVLLDRGDCFFA  108



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            S+KS+PG +P F++VDRG+C+F 
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFA  104



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            ++ L + L+     G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP 
Sbjct  5    VLTLSFVLILELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPM  64

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +N K CKSF +F VSFKS PG +P F+++DRG+CYF 
Sbjct  65   SNHKGCKSFSEFGVSFKSSPGSLPTFLLIDRGDCYFA  101



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP +++ +YECAIGNFG+PQYGG+M G VVYPKAN KACK F DF +
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SF  K GG+P+F++VDRG+CYFT
Sbjct  96   SFNPKAGGLPVFLLVDRGDCYFT  118



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            S+KS+PG +P F++VDRG+C+F 
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFA  104



>dbj|BAK05589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=802

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP S++ +YECAIGNFG+PQYGG+M G VVYPKAN +AC  F D  +
Sbjct  198  GRFVVEKNSLRVTSPASLRGVYECAIGNFGMPQYGGTMHGVVVYPKANARACNPFADSGL  257

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SF  K GG+P+F++VDRG+CYFT
Sbjct  258  SFNPKAGGLPVFLLVDRGDCYFT  280



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPE+IK  ++ AIGNFGIPQYGGSM GTVVYP+ N K+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +PIF++VDRG+C+F 
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFA  104



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSPE+IK  ++ AIGNFGIPQYGGSM GTVVYP+ N K+CK F DF +
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS+PG +PIF++VDRG+C+F 
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFA  104



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  396  GLIVCLLWFL-LCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            GL+  LL  + L    + +FVVEKNSL+V SPE+IK  Y+ AIGNFGIPQYGG+MVGT V
Sbjct  14   GLVAVLLVIIYLKTMAMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAV  73

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQ  CK+FD F++SFKSKPGG+P  V+V+RG+CYF 
Sbjct  74   YPKENQNGCKTFDTFEISFKSKPGGLPNVVLVNRGDCYFA  113



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  423  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  602
            L+  S + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+K CK
Sbjct  19   LIVPSSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCK  78

Query  603  SFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             F++F +SF+SKPG +P FV+VDRG+C+F 
Sbjct  79   EFEEFRISFQSKPGALPTFVLVDRGDCFFA  108



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
             G F+VEKN+LKVTSP+SIK +YECAIGNFGIP+YGG++VGTVVYP +N K CKSF +F 
Sbjct  18   FGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFSEFG  77

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            VSFKS PG +P F+++DRG+CYF 
Sbjct  78   VSFKSSPGSLPTFLLIDRGDCYFA  101



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
             LW  L  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N+
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSIPGTVVYPKENR  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C++F+D   SFKSK G MP FV+VDRG+C+F 
Sbjct  75   KGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFA  108



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            LL  L+    + RFVVEKNSL++TSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   LLISLIAPRSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNK  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK FD F +SF+SKPG +P FV+VDRG+C+F 
Sbjct  75   KGCKEFDGFGISFQSKPGALPTFVLVDRGDCFFA  108



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
             LW  L  S +GRFVVEKNSL+V SP+ IK  Y+ AIGNFGIPQYGGS+ GTVVYPK N+
Sbjct  15   FLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSIPGTVVYPKENR  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C++F+D   SFKSK G MP FV+VDRG+C+F 
Sbjct  75   KGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFA  108



>ref|NP_001292791.1| vacuolar sorting receptor homolog1 precursor [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP+ +K  YECAIGNFG+PQYGG++ G V YPK+N+KAC+SFD FD+
Sbjct  24   GRFVVEKNSLEVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  624  SFKSK-PGGMPIFVVVDRGECYFT  692
            SFK K  GG PIFV+VDRGEC+FT
Sbjct  84   SFKPKQAGGRPIFVLVDRGECFFT  107



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  423  LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACK  602
            L+  S + RFVVEKNSL++TSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+K CK
Sbjct  19   LIVPSSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCK  78

Query  603  SFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             FD F +SF+SKPG +P FV+VDRG+C+F 
Sbjct  79   EFDGFGISFQSKPGALPTFVLVDRGDCFFA  108



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = +3

Query  399  LIVCLLWFLLC--GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            +I+ L +FLL    S   RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTV+
Sbjct  14   VILLLGFFLLTWVSSIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVI  73

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK N+K CK F DF +SFK KPG +P FV++DRG+C+F 
Sbjct  74   YPKDNKKGCKDFSDFSISFKKKPGQLPTFVLLDRGDCFFA  113



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = +3

Query  414  LWF----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            LWF    L+  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YPK
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPK  69

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             N+K CK FDDF +SFKS PG +P  V++DRG C+F 
Sbjct  70   DNKKGCKEFDDFGISFKSSPGALPTIVLLDRGSCFFA  106



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 4/97 (4%)
 Frame = +3

Query  414  LWF----LLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            LWF    L+  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YPK
Sbjct  10   LWFVGLVLVPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPK  69

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             N+K CK FDDF +SFKS PG +P  V++DRG C+F 
Sbjct  70   DNKKGCKEFDDFGISFKSSPGALPTIVLLDRGSCFFA  106



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L+    + RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK N+
Sbjct  15   LVISLIAPRSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNK  74

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K CK FD F +SF+SKPG +P FV+VDRG+C+F 
Sbjct  75   KGCKEFDGFGISFQSKPGALPTFVLVDRGDCFFA  108



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEFGI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            +FKS PG +P FV+VDRG+C+F 
Sbjct  84   TFKSSPGALPTFVLVDRGDCFFA  106



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+   L      RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTVVYPK N 
Sbjct  19   LVEVSLMSPATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENM  78

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KACK F++F  SFK+KPG +P FV+VDRG+C+F 
Sbjct  79   KACKDFNEFGTSFKAKPGALPTFVLVDRGDCFFA  112



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
              +SFKSKPG +P  V++DRG C+F 
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFA  108



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  420  FLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKAC  599
             +L     GRFVVEKNSL+V SPESIK  ++ AIGNFGIPQYGGSM GTV+YPK N+K C
Sbjct  18   LILAELAAGRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYGGSMSGTVLYPKDNKKGC  77

Query  600  KSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K+FDDF +SFK+K G +P FV+VDRG+C+F 
Sbjct  78   KNFDDFGISFKAKAGALPNFVLVDRGDCFFA  108



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G V+YPK N+K CK FDD
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
              +SFKSKPG +P FV++DRG C+F 
Sbjct  82   SGISFKSKPGALPTFVLLDRGNCFFA  107



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYP  83

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K N+K CK FD+F +SFKS PG +P  V++DRG C+F 
Sbjct  84   KDNKKGCKEFDEFGISFKSTPGALPTIVLLDRGSCFFA  121



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            ++  +L  LL  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G V+YP
Sbjct  24   VVSLMLVGLLPVSTMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYP  83

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K N+K CK FD+F +SFKS PG +P  V++DRG C+F 
Sbjct  84   KDNKKGCKEFDEFGISFKSTPGALPTIVLLDRGSCFFA  121



>ref|XP_010233902.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=646

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 3/99 (3%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            LIV L+  ++  S   RFVVEKNSL+VTSP +++ +YECAIGNFG+PQYGG+M G VVYP
Sbjct  27   LIVALV--MMAESAAARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYP  84

Query  579  KANQKACKSF-DDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            KAN KAC  F D   ++F  KPGG+P+F++VDRGECYFT
Sbjct  85   KANAKACADFRDSAGLNFSPKPGGLPVFLLVDRGECYFT  123



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  L  L   S   RFVVEKNSL+VTSP+ I+  ++ AIGNFGIPQYGGSM G VV
Sbjct  14   LGFLVLSLAPL---SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVV  70

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YPK NQK CK F D+ +SF+SKPG +P FV+VDRG+C+F 
Sbjct  71   YPKDNQKGCKEFSDYGISFQSKPGALPTFVLVDRGDCFFA  110



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +3

Query  444  GRFVV--EKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDF  617
             RFVV  EKNSL VTSPESIK  ++ AIGNFGIPQYGGSM GTVVYPK NQK+CK F DF
Sbjct  24   ARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  83

Query  618  DVSFKSKPGGMPIFVVVDRGECYFT  692
             +SFKS+PG +P F++VDRG+C+F 
Sbjct  84   SISFKSQPGALPTFLLVDRGDCFFA  108



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSP+SIK  ++ AIGNFGIPQYGGSM GTV+YPK N K CK FDDF +
Sbjct  31   ARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDFGI  90

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFK+K G +P FV+VDRG+C+F 
Sbjct  91   SFKTKSGALPTFVLVDRGDCFFA  113



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  435  SCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDD  614
            S + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  615  FDVSFKSKPGGMPIFVVVDRGECYFT  692
              +SFKSKPG +P  V++DRG C+F 
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFA  108



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YPK+N+KAC+SFD FD+
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  624  SFKSK-PGGMPIFVVVDRGECYFT  692
            SFK K  GG P FV+VDRGEC+FT
Sbjct  84   SFKPKQAGGRPTFVLVDRGECFFT  107



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
             F+S+PG +P FV+VDRG+C+F 
Sbjct  84   KFESRPGALPTFVLVDRGDCFFA  106



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
             F+S+PG +P FV+VDRG+C+F 
Sbjct  84   KFESRPGALPTFVLVDRGDCFFA  106



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  24   GRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEFGI  83

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
             F+S+PG +P FV+VDRG+C+F 
Sbjct  84   KFESRPGALPTFVLVDRGDCFFA  106



>emb|CBI32834.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 7/100 (7%)
 Frame = +3

Query  411  LLW--FLLCGSCLGR--FVVEKNSLKVTSPESIKDLYECAIGNFGIPQ--YGGSMVGTVV  572
            L+W  F  C + LG   FVV KNSL+VT PES+KD YECA GNFGIPQ  +GG++VGTVV
Sbjct  25   LIWVGFFTCVTYLGSCGFVV-KNSLRVTYPESLKDAYECATGNFGIPQNEHGGTVVGTVV  83

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            YP+ANQK+C     FDVSFKS+P  +PIF++ DRG CYF 
Sbjct  84   YPQANQKSCSRSHHFDVSFKSQPADLPIFLLADRGNCYFA  123



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L+   +  +L  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYP  66

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K N+K CK F+D  +SFKS PG +P FV++DRG C+F 
Sbjct  67   KDNKKGCKEFEDSGISFKSTPGALPTFVLLDRGSCFFA  104



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%), Gaps = 4/100 (4%)
 Frame = +3

Query  393  LGLIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVV  572
            LG +V  L  L+    +GRFVVEKNSL+VTSP+SIK  ++ AIGNFGIPQYGGSM GTVV
Sbjct  13   LGFLVLNLTQLV----MGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYGGSMSGTVV  68

Query  573  YPKANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +PK NQK CK+F DF  SFK K G MP F++VDRG+C F 
Sbjct  69   FPKENQKGCKTFSDFGSSFKPKSGAMPNFLLVDRGDCLFA  108



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEFGI  84

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS PG +P FV+VDRG+C+F 
Sbjct  85   SFKSTPGALPTFVLVDRGDCFFA  107



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +3

Query  447  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  626
            RFVVEKNSLKVTSP+S+K  YECAIGNFG+P+YGG++VG+V+YPK NQK C +F   DV+
Sbjct  22   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFS--DVN  79

Query  627  FKSKPGGMPIFVVVDRGECYFT  692
            F+SKPGG+P F++VDRG+CYFT
Sbjct  80   FQSKPGGLPTFLLVDRGDCYFT  101



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +3

Query  447  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  626
            RFVVEKNSLKVTSP+S+K  YECAIGNFG+P+YGG++VG+V+YPK NQK C +F   DV+
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFS--DVN  80

Query  627  FKSKPGGMPIFVVVDRGECYFT  692
            F+SKPGG+P F++VDRG+CYFT
Sbjct  81   FQSKPGGLPTFLLVDRGDCYFT  102



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
            + +FVVEKNSL+VTSP+SIK  Y+ AIGNFGIPQYGGSM G VVYPK NQK CK FD+  
Sbjct  1    MAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESG  60

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            +SFKSKPG +P  V++DRG C+F 
Sbjct  61   ISFKSKPGALPTIVLLDRGSCFFA  84



>ref|XP_006849341.2| PREDICTED: vacuolar-sorting receptor 3 isoform X1 [Amborella 
trichopoda]
Length=629

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  408  CLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
            C L   +     GRFVVEKNSL VTSP+SI+ +++ AIGNFG+PQYGGSM G VVYPK N
Sbjct  13   CCLVLAMAALVKGRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDN  72

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +K CK FD+F +SFKSK G +P FV++DRG C+FT
Sbjct  73   KKGCKGFDEFGLSFKSKLGALPTFVMLDRGGCFFT  107



>ref|XP_011625221.1| PREDICTED: vacuolar-sorting receptor 3 isoform X2 [Amborella 
trichopoda]
Length=627

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  408  CLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKAN  587
            C L   +     GRFVVEKNSL VTSP+SI+ +++ AIGNFG+PQYGGSM G VVYPK N
Sbjct  13   CCLVLAMAALVKGRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDN  72

Query  588  QKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            +K CK FD+F +SFKSK G +P FV++DRG C+FT
Sbjct  73   KKGCKGFDEFGLSFKSKLGALPTFVMLDRGGCFFT  107



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFGIPQYGGSM G V+YPK NQK CK F +F +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEFGI  84

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKS PG +P FV+VDRG+C+F 
Sbjct  85   SFKSTPGALPKFVLVDRGDCFFA  107



>ref|XP_003534638.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
 gb|KHN29499.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=619

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = +3

Query  447  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  626
            RFVVEKNSLKVTSP+S+K  YECAIGNFG+P+YGG++VG+V+YPK NQK C +F   DV+
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFS--DVN  80

Query  627  FKSKPGGMPIFVVVDRGECYFT  692
            F+SKPGG P F++VDRG+CYFT
Sbjct  81   FQSKPGGFPTFLLVDRGDCYFT  102



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
            + RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTVV+PK NQK C+ F D  
Sbjct  26   VARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAG  85

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            +SF+SKPG +P FV+VDRG+C+F 
Sbjct  86   ISFQSKPGALPTFVLVDRGDCFFA  109



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
            + RFVVEKNSL+VTSP+ +K  Y+ AIGNFGIPQYGGSM GTVV+PK NQK C+ F D  
Sbjct  27   VARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAG  86

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            +SF+SKPG +P FV+VDRG+C+F 
Sbjct  87   ISFQSKPGALPTFVLVDRGDCFFA  110



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  399  LIVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYP  578
            L+   +  +L  S +GRFVVEKNSL+VTSPE I+  ++ AIGNFGIPQYGGSM G VVYP
Sbjct  7    LVSLFVGLVLPVSIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYP  66

Query  579  KANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K ++K CK F+D  +SFKS PG +P FV++DRG C+F 
Sbjct  67   KDDKKGCKEFEDSGISFKSTPGALPTFVLLDRGSCFFA  104



>dbj|BAB64531.1| vacuolar sorting receptor [Vigna mungo]
Length=619

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 2/87 (2%)
 Frame = +3

Query  432  GSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFD  611
            G  +GRFVVEKNSL+VT+P S+K  YECAIGNFG+P YGG++VG+V+YPK NQK C +F 
Sbjct  17   GCTVGRFVVEKNSLRVTAPSSLKGTYECAIGNFGVPMYGGTLVGSVLYPKVNQKGCLNF-  75

Query  612  DFDVSFKSKPGGMPIFVVVDRGECYFT  692
              DV+F+SKPGG P F++VDRG+CYFT
Sbjct  76   -TDVNFQSKPGGFPTFLLVDRGDCYFT  101



>gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNSL VTSP+SI+ +++ AIGNFG+PQYGGSM G VVYPK N+K CK FD+F +
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSK G +P FV++DRG C+FT
Sbjct  67   SFKSKLGALPTFVMLDRGGCFFT  89



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YP+ N+K CK F +FD+
Sbjct  38   ARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEFDI  97

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSKPG +P FV+VDRG+C+F 
Sbjct  98   SFKSKPGMLPKFVLVDRGDCFFA  120



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +
Sbjct  27   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  86

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSK G +P FVVVDRG+C+F 
Sbjct  87   SFKSKIGALPTFVVVDRGDCFFA  109



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL VTSP+ IK  Y+ AIGNFGIPQYGGSM G V YP+ N+K CK F +FD+
Sbjct  38   ARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEFDI  97

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSKPG +P FV+VDRG+C+F 
Sbjct  98   SFKSKPGMLPKFVLVDRGDCFFA  120



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             RFVVEKNSL+VTSP+ IK  Y+ AIGNFG+PQYGGSM G V+YPK NQK CK F DF +
Sbjct  25   ARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDFGL  84

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            S+KS PG +P F++VDRG+C+F 
Sbjct  85   SYKSTPGALPTFLLVDRGDCFFA  107



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +
Sbjct  27   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  86

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSK G +P FVVVDRG+C+F 
Sbjct  87   SFKSKIGALPTFVVVDRGDCFFA  109



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
             +FVVEKNSL V SPESIK  ++ AIGNFGIPQYGGSM GTVVYPK N K CK FD++ +
Sbjct  32   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  91

Query  624  SFKSKPGGMPIFVVVDRGECYFT  692
            SFKSK G +P FVVVDRG+C+F 
Sbjct  92   SFKSKIGALPTFVVVDRGDCFFA  114



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
            + +FVVEKNSL VTSP++IK  ++ AIGNFGIPQYGGSM G VVYPK NQK CK FDD  
Sbjct  24   MAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDSG  83

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            +SFKSKPG +P  V++DRG C+F 
Sbjct  84   ISFKSKPGALPTVVLLDRGNCFFA  107



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  411  LLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQ  590
            L+  L   + + RFVVEKNSL VTSPE IK  ++ AIGNFGIPQYGGSM G V YPK N+
Sbjct  16   LILSLNVHTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENR  75

Query  591  KACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
            K C+ F DF +SFK+KPG +P FV+VDRG+C+F 
Sbjct  76   KGCREFGDFGISFKAKPGALPNFVLVDRGDCFFA  109



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  402  IVCLLWFLLCGSCLGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPK  581
            ++  +W +LCGSC+GRFVVEK+SLKV++P+S+K  YE ++GNFG+P YGGSM+GTVVYP 
Sbjct  10   LLIWVWCVLCGSCVGRFVVEKSSLKVSAPKSLKGSYESSMGNFGVPLYGGSMLGTVVYPD  69

Query  582  ANQKACKSFDDFDVSFKSKPGGMPIFVVVDRGECYFT  692
             N+ ACKSF+ F+ S  + P G P  ++ DRG C+FT
Sbjct  70   DNRDACKSFEGFNASLATAPRGSPTILLADRGGCFFT  106



>ref|NP_001169232.1| hypothetical protein precursor [Zea mays]
 gb|ACN32039.1| unknown [Zea mays]
 gb|ACN34630.1| unknown [Zea mays]
 tpg|DAA64135.1| TPA: hypothetical protein ZEAMMB73_440222 [Zea mays]
Length=633

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  447  RFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDVS  626
            RFVVEKNSL+VTSP  ++ +YECAIGNFG+PQYGG+M G VVYPKA+ KAC+ F D  +S
Sbjct  27   RFVVEKNSLRVTSPAVLRGVYECAIGNFGMPQYGGTMHGVVVYPKADAKACRPFADSGLS  86

Query  627  FKSKPGGMPIFVVVDRGECYFT  692
            FK + GG+P+F++VDRG+CYFT
Sbjct  87   FKPRSGGLPVFLLVDRGDCYFT  108



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  441  LGRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFD  620
            +GRFVVEKNSL+V SP+SIK  ++ AIGNFGIPQYGG M GTVVYP+ N+K CKSFDD  
Sbjct  25   VGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYGGRMGGTVVYPRDNRKGCKSFDDSG  84

Query  621  VSFKSKPGGMPIFVVVDRGECYFT  692
            +SFK+K G +P FV+VDRG+C+F 
Sbjct  85   ISFKAKAGALPNFVLVDRGDCFFA  108



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  624  SFK-SKPGGMPIFVVVDRGECYFT  692
            SFK  K GG P FV++DRGEC+FT
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFT  106



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  624  SFK-SKPGGMPIFVVVDRGECYFT  692
            SFK  K GG P FV++DRGEC+FT
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFT  106



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  624  SFK-SKPGGMPIFVVVDRGECYFT  692
            SFK  K GG P FV++DRGEC+FT
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFT  106



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +3

Query  444  GRFVVEKNSLKVTSPESIKDLYECAIGNFGIPQYGGSMVGTVVYPKANQKACKSFDDFDV  623
            GRFVVEKNS++VTSP+ +K  YECAIGNFG+PQYGG++ G V YP++N+K C+SFD FD+
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  624  SFK-SKPGGMPIFVVVDRGECYFT  692
            SFK  K GG P FV++DRGEC+FT
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFT  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410