BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6164

Length=1298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP12102.1|  unnamed protein product                                477   8e-159   Coffea canephora [robusta coffee]
ref|XP_011080886.1|  PREDICTED: uncharacterized protein LOC105164037    466   1e-154   Sesamum indicum [beniseed]
ref|XP_009796704.1|  PREDICTED: uncharacterized protein LOC104243241    461   1e-152   Nicotiana sylvestris
ref|XP_009630287.1|  PREDICTED: uncharacterized protein LOC104120257    454   4e-150   Nicotiana tomentosiformis
ref|XP_004245556.1|  PREDICTED: uncharacterized protein LOC101268782    452   5e-149   Solanum lycopersicum
ref|XP_006343911.1|  PREDICTED: cell wall protein AWA1-like isofo...    451   5e-149   Solanum tuberosum [potatoes]
ref|XP_002276602.1|  PREDICTED: uncharacterized protein LOC100255255    445   2e-146   Vitis vinifera
ref|XP_009620186.1|  PREDICTED: uncharacterized protein LOC104112...    442   1e-145   Nicotiana tomentosiformis
ref|XP_002509888.1|  transcription factor, putative                     429   3e-140   Ricinus communis
ref|XP_011022585.1|  PREDICTED: uncharacterized protein LOC105124317    425   1e-138   Populus euphratica
ref|XP_012086797.1|  PREDICTED: uncharacterized protein LOC105645728    423   4e-138   Jatropha curcas
ref|XP_009334483.1|  PREDICTED: uncharacterized protein LOC103927300    422   6e-138   Pyrus x bretschneideri [bai li]
gb|ABK96565.1|  unknown                                                 423   7e-138   Populus trichocarpa x Populus deltoides
ref|XP_008336898.1|  PREDICTED: uncharacterized protein LOC103456102    420   4e-137   Malus domestica [apple tree]
ref|XP_008239003.1|  PREDICTED: uncharacterized protein LOC103337613    419   2e-136   Prunus mume [ume]
ref|XP_006385780.1|  hypothetical protein POPTR_0003s13400g             419   3e-136   Populus trichocarpa [western balsam poplar]
ref|XP_009786033.1|  PREDICTED: uncharacterized protein LOC104234198    416   1e-135   Nicotiana sylvestris
ref|XP_011026955.1|  PREDICTED: uncharacterized protein LOC105127385    417   2e-135   Populus euphratica
gb|EYU23400.1|  hypothetical protein MIMGU_mgv1a004206mg                412   2e-135   Erythranthe guttata [common monkey flower]
ref|XP_010261439.1|  PREDICTED: uncharacterized protein LOC104600276    414   3e-134   Nelumbo nucifera [Indian lotus]
ref|XP_006476466.1|  PREDICTED: uncharacterized protein LOC102631...    414   3e-134   Citrus sinensis [apfelsine]
gb|KHN16771.1|  Putative WRKY transcription factor 19                   414   3e-134   Glycine soja [wild soybean]
ref|XP_006439437.1|  hypothetical protein CICLE_v10019140mg             413   4e-134   Citrus clementina [clementine]
ref|XP_003525359.1|  PREDICTED: uncharacterized protein LOC100776...    412   1e-133   Glycine max [soybeans]
ref|XP_009620188.1|  PREDICTED: loricrin-like isoform X2                409   3e-133   Nicotiana tomentosiformis
ref|XP_003533040.1|  PREDICTED: uncharacterized protein LOC100784...    409   2e-132   Glycine max [soybeans]
ref|XP_004143880.1|  PREDICTED: uncharacterized protein LOC101212238    405   3e-131   Cucumis sativus [cucumbers]
ref|XP_008437353.1|  PREDICTED: uncharacterized protein LOC103482798    405   4e-131   Cucumis melo [Oriental melon]
gb|KJB19070.1|  hypothetical protein B456_003G083700                    403   4e-131   Gossypium raimondii
ref|XP_007211292.1|  hypothetical protein PRUPE_ppa002459mg             405   5e-131   Prunus persica
gb|KHG18325.1|  putative WRKY transcription factor 19 -like protein     404   8e-131   Gossypium arboreum [tree cotton]
gb|KJB19068.1|  hypothetical protein B456_003G083700                    404   1e-130   Gossypium raimondii
gb|KJB37515.1|  hypothetical protein B456_006G208300                    403   3e-130   Gossypium raimondii
ref|XP_002297999.2|  hypothetical protein POPTR_0001s10090g             398   2e-128   
ref|XP_010106584.1|  hypothetical protein L484_003082                   395   2e-127   Morus notabilis
ref|XP_004244623.1|  PREDICTED: uncharacterized protein LOC101256504    395   3e-127   Solanum lycopersicum
ref|XP_004298851.1|  PREDICTED: hornerin                                394   1e-126   Fragaria vesca subsp. vesca
ref|XP_007160125.1|  hypothetical protein PHAVU_002G294600g             393   2e-126   Phaseolus vulgaris [French bean]
ref|XP_011073481.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    391   4e-126   
ref|XP_010917189.1|  PREDICTED: uncharacterized protein LOC105041837    397   2e-125   Elaeis guineensis
ref|XP_010053188.1|  PREDICTED: uncharacterized protein LOC104441699    389   5e-125   Eucalyptus grandis [rose gum]
ref|XP_010676385.1|  PREDICTED: uncharacterized protein LOC104892219    387   1e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010533616.1|  PREDICTED: uncharacterized protein LOC104809354    387   2e-124   Tarenaya hassleriana [spider flower]
ref|XP_008778495.1|  PREDICTED: uncharacterized protein LOC103698281    387   4e-124   Phoenix dactylifera
ref|XP_003634111.1|  PREDICTED: uncharacterized protein LOC100241527    385   7e-123   Vitis vinifera
ref|XP_010055802.1|  PREDICTED: uncharacterized protein LOC104443941    384   7e-123   
ref|XP_010915741.1|  PREDICTED: uncharacterized protein LOC105040762    383   1e-122   
ref|XP_010924791.1|  PREDICTED: uncharacterized protein LOC105047534    382   4e-122   Elaeis guineensis
ref|XP_006352259.1|  PREDICTED: uncharacterized protein LOC102589...    379   2e-121   Solanum tuberosum [potatoes]
ref|XP_010925805.1|  PREDICTED: uncharacterized protein LOC105048248    376   6e-120   Elaeis guineensis
ref|XP_006391666.1|  hypothetical protein EUTSA_v10023333mg             375   7e-120   Eutrema salsugineum [saltwater cress]
ref|XP_008794859.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    374   6e-119   
ref|XP_004503653.1|  PREDICTED: uncharacterized protein LOC101508...    373   8e-119   Cicer arietinum [garbanzo]
gb|KEH21167.1|  transcription factor, putative                          374   9e-119   Medicago truncatula
ref|XP_006300404.1|  hypothetical protein CARUB_v10019935mg             368   3e-118   
ref|XP_006300405.1|  hypothetical protein CARUB_v10019935mg             370   7e-118   Capsella rubella
gb|EMS53361.1|  hypothetical protein TRIUR3_16406                       369   1e-117   Triticum urartu
gb|EMT10026.1|  hypothetical protein F775_05300                         369   1e-117   
ref|XP_010473665.1|  PREDICTED: uncharacterized protein LOC104753083    369   3e-117   Camelina sativa [gold-of-pleasure]
ref|XP_002441593.1|  hypothetical protein SORBIDRAFT_09g029960          369   3e-117   Sorghum bicolor [broomcorn]
emb|CDM83369.1|  unnamed protein product                                368   3e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009404457.1|  PREDICTED: uncharacterized protein LOC103987782    369   4e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_176596.2|  uncharacterized protein                               368   5e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43515.1|  hypothetical protein                                   367   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430532.1|  PREDICTED: uncharacterized protein LOC104714775    366   4e-116   
dbj|BAJ85365.1|  predicted protein                                      365   5e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY38191.1|  BnaA09g11980D                                          365   5e-116   Brassica napus [oilseed rape]
ref|XP_009112807.1|  PREDICTED: uncharacterized protein LOC103838138    365   6e-116   Brassica rapa
ref|XP_008795010.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    365   8e-116   
ref|XP_002886362.1|  hypothetical protein ARALYDRAFT_474940             363   3e-115   
ref|XP_009421229.1|  PREDICTED: uncharacterized protein LOC104000817    364   3e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961068.1|  PREDICTED: uncharacterized protein LOC101783...    362   2e-114   
ref|XP_009415164.1|  PREDICTED: uncharacterized protein LOC103996074    359   8e-114   
gb|EAY75008.1|  hypothetical protein OsI_02907                          359   2e-113   Oryza sativa Indica Group [Indian rice]
ref|XP_008672306.1|  PREDICTED: uncharacterized protein LOC100217...    358   3e-113   Zea mays [maize]
ref|XP_009112900.1|  PREDICTED: uncharacterized protein LOC103838232    357   6e-113   Brassica rapa
ref|NP_001043607.1|  Os01g0621900                                       357   1e-112   
ref|XP_002455972.1|  hypothetical protein SORBIDRAFT_03g028290          354   1e-111   Sorghum bicolor [broomcorn]
ref|XP_001771537.1|  predicted protein                                  345   1e-111   
ref|XP_009406798.1|  PREDICTED: uncharacterized protein LOC103989624    353   2e-111   
ref|XP_010671562.1|  PREDICTED: uncharacterized protein LOC104888325    352   6e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008791483.1|  PREDICTED: uncharacterized protein LOC103708365    352   7e-110   
ref|XP_011076067.1|  PREDICTED: uncharacterized protein LOC105160403    347   1e-108   Sesamum indicum [beniseed]
ref|XP_006644380.1|  PREDICTED: uncharacterized protein LOC102713682    345   3e-108   Oryza brachyantha
ref|XP_009405756.1|  PREDICTED: uncharacterized protein LOC103988833    344   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05114.1|  unnamed protein product                                344   8e-108   Coffea canephora [robusta coffee]
ref|XP_004965502.1|  PREDICTED: hornerin-like isoform X1                338   7e-106   Setaria italica
ref|XP_006842938.1|  PREDICTED: uncharacterized protein LOC18432776     338   1e-105   Amborella trichopoda
emb|CBI34417.3|  unnamed protein product                                331   1e-104   Vitis vinifera
gb|KHN25665.1|  Putative WRKY transcription factor 19                   337   2e-104   Glycine soja [wild soybean]
ref|XP_003517492.1|  PREDICTED: uncharacterized protein LOC100809...    335   3e-104   
ref|XP_001760338.1|  predicted protein                                  323   9e-104   
ref|XP_002968151.1|  hypothetical protein SELMODRAFT_33558              321   3e-103   
ref|XP_006584992.1|  PREDICTED: uncharacterized protein LOC102666151    328   1e-101   Glycine max [soybeans]
ref|XP_006580009.1|  PREDICTED: uncharacterized protein LOC100806...    327   2e-101   Glycine max [soybeans]
ref|XP_010939550.1|  PREDICTED: uncharacterized protein LOC105058355    327   3e-101   Elaeis guineensis
gb|KHN24351.1|  Putative WRKY transcription factor 19                   327   3e-101   Glycine soja [wild soybean]
ref|XP_004504771.1|  PREDICTED: uncharacterized protein LOC101489...    327   3e-101   
gb|KHN39202.1|  Putative WRKY transcription factor 19                   327   3e-101   Glycine soja [wild soybean]
ref|XP_007222059.1|  hypothetical protein PRUPE_ppa003189mg             324   9e-101   
ref|XP_007159079.1|  hypothetical protein PHAVU_002G206700g             325   9e-101   Phaseolus vulgaris [French bean]
ref|XP_002437055.1|  hypothetical protein SORBIDRAFT_10g020110          325   1e-100   Sorghum bicolor [broomcorn]
ref|XP_010243331.1|  PREDICTED: uncharacterized protein LOC104587418    325   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_009354077.1|  PREDICTED: uncharacterized protein LOC103945257    325   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_009409436.1|  PREDICTED: uncharacterized protein LOC103991649    324   3e-100   
gb|KEH31245.1|  loricrin-like protein                                   324   3e-100   Medicago truncatula
ref|XP_010261088.1|  PREDICTED: uncharacterized protein LOC104599999    324   4e-100   Nelumbo nucifera [Indian lotus]
ref|XP_009347826.1|  PREDICTED: uncharacterized protein LOC103939456    323   7e-100   Pyrus x bretschneideri [bai li]
gb|AFW81273.1|  hypothetical protein ZEAMMB73_277508                    313   1e-99    
ref|XP_008457144.1|  PREDICTED: uncharacterized protein LOC103496890    323   1e-99    Cucumis melo [Oriental melon]
ref|XP_008339251.1|  PREDICTED: uncharacterized protein LOC103402288    325   1e-99    
ref|XP_010418466.1|  PREDICTED: uncharacterized protein LOC104704045    319   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011013775.1|  PREDICTED: uncharacterized protein LOC105117722    322   3e-99    Populus euphratica
ref|XP_010103840.1|  hypothetical protein L484_024142                   321   4e-99    Morus notabilis
gb|EYU19611.1|  hypothetical protein MIMGU_mgv1a002990mg                321   4e-99    Erythranthe guttata [common monkey flower]
ref|XP_010937059.1|  PREDICTED: uncharacterized protein LOC105056536    321   9e-99    Elaeis guineensis
ref|XP_007158547.1|  hypothetical protein PHAVU_002G161400g             321   1e-98    Phaseolus vulgaris [French bean]
ref|XP_004138941.1|  PREDICTED: delta-like protein C                    320   1e-98    Cucumis sativus [cucumbers]
ref|XP_008352811.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    320   2e-98    
ref|XP_009410374.1|  PREDICTED: loricrin-like                           320   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002299680.1|  hypothetical protein POPTR_0001s21410g             318   7e-98    Populus trichocarpa [western balsam poplar]
ref|XP_002271060.2|  PREDICTED: uncharacterized protein LOC100249189    318   8e-98    Vitis vinifera
ref|XP_008804473.1|  PREDICTED: uncharacterized protein LOC103717758    318   1e-97    Phoenix dactylifera
emb|CAN82910.1|  hypothetical protein VITISV_015279                     318   2e-97    Vitis vinifera
ref|XP_012079959.1|  PREDICTED: uncharacterized protein LOC105640258    317   2e-97    Jatropha curcas
ref|XP_004300691.1|  PREDICTED: uncharacterized protein LOC101302269    317   3e-97    Fragaria vesca subsp. vesca
ref|XP_008391437.1|  PREDICTED: uncharacterized protein LOC103453654    317   3e-97    Malus domestica [apple tree]
ref|XP_006493281.1|  PREDICTED: uncharacterized protein LOC102617...    315   5e-97    
ref|XP_009379709.1|  PREDICTED: hornerin-like                           315   6e-97    Pyrus x bretschneideri [bai li]
ref|XP_008218884.1|  PREDICTED: uncharacterized protein LOC103319151    315   9e-97    Prunus mume [ume]
ref|XP_008656082.1|  PREDICTED: loricrin-like                           315   1e-96    
ref|XP_003563651.1|  PREDICTED: uncharacterized protein LOC100836935    314   1e-96    Brachypodium distachyon [annual false brome]
ref|XP_006656131.1|  PREDICTED: uncharacterized protein LOC102710413    315   1e-96    Oryza brachyantha
ref|XP_011092406.1|  PREDICTED: uncharacterized protein LOC105172...    313   2e-96    Sesamum indicum [beniseed]
ref|XP_011092401.1|  PREDICTED: uncharacterized protein LOC105172...    314   2e-96    Sesamum indicum [beniseed]
gb|KJB79709.1|  hypothetical protein B456_013G063300                    314   2e-96    Gossypium raimondii
ref|XP_003579890.1|  PREDICTED: uncharacterized protein LOC100843615    314   3e-96    
ref|XP_010030066.1|  PREDICTED: uncharacterized protein LOC104419929    313   4e-96    Eucalyptus grandis [rose gum]
gb|EMS68953.1|  hypothetical protein TRIUR3_05473                       313   6e-96    Triticum urartu
ref|XP_009404065.1|  PREDICTED: uncharacterized protein LOC103987474    313   7e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007043029.1|  Emb:CAB89363.1                                     313   8e-96    
gb|EMT09274.1|  hypothetical protein F775_28888                         312   1e-95    
ref|XP_002453636.1|  hypothetical protein SORBIDRAFT_04g009650          312   1e-95    Sorghum bicolor [broomcorn]
gb|EMS48571.1|  hypothetical protein TRIUR3_18004                       312   1e-95    Triticum urartu
ref|XP_002304079.2|  hypothetical protein POPTR_0003s01750g             312   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008811578.1|  PREDICTED: uncharacterized protein LOC103722706    311   3e-95    
gb|EMT10282.1|  hypothetical protein F775_27687                         311   3e-95    
ref|XP_007040390.1|  Uncharacterized protein isoform 1                  311   5e-95    
ref|XP_004951275.1|  PREDICTED: uncharacterized protein LOC101764211    310   5e-95    Setaria italica
gb|ERM94366.1|  hypothetical protein AMTR_s00010p00248420               310   5e-95    Amborella trichopoda
ref|XP_010916986.1|  PREDICTED: uncharacterized protein LOC105041692    311   5e-95    Elaeis guineensis
tpg|DAA35760.1|  TPA: hypothetical protein ZEAMMB73_993422              311   5e-95    
ref|XP_009586702.1|  PREDICTED: uncharacterized protein LOC104084...    310   6e-95    
ref|XP_006827129.2|  PREDICTED: uncharacterized protein LOC18422393     310   7e-95    Amborella trichopoda
ref|XP_006351810.1|  PREDICTED: uncharacterized protein LOC102590322    310   7e-95    Solanum tuberosum [potatoes]
ref|XP_009586701.1|  PREDICTED: uncharacterized protein LOC104084...    310   7e-95    Nicotiana tomentosiformis
dbj|BAJ94860.1|  predicted protein                                      310   8e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG22844.1|  putative WRKY transcription factor 19 -like protein     310   1e-94    Gossypium arboreum [tree cotton]
ref|XP_011004973.1|  PREDICTED: uncharacterized protein LOC105111348    310   1e-94    Populus euphratica
ref|XP_010687470.1|  PREDICTED: uncharacterized protein LOC104901577    309   1e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006652895.1|  PREDICTED: filaggrin-2-like                        309   2e-94    Oryza brachyantha
ref|XP_009798583.1|  PREDICTED: uncharacterized protein LOC104244...    309   2e-94    Nicotiana sylvestris
ref|XP_009798584.1|  PREDICTED: uncharacterized protein LOC104244...    309   2e-94    Nicotiana sylvestris
gb|KJB31994.1|  hypothetical protein B456_005G217900                    308   4e-94    Gossypium raimondii
emb|CAH68133.1|  B0414F07.3                                             308   4e-94    Oryza sativa [red rice]
ref|XP_004230554.1|  PREDICTED: uncharacterized protein LOC101246968    308   5e-94    Solanum lycopersicum
ref|NP_001057751.2|  Os06g0523100                                       303   6e-94    
ref|NP_001054040.2|  Os04g0640900                                       308   6e-94    
ref|XP_009150537.1|  PREDICTED: filaggrin-2                             306   8e-94    Brassica rapa
gb|EAY95752.1|  hypothetical protein OsI_17619                          307   8e-94    Oryza sativa Indica Group [Indian rice]
gb|EAZ32159.1|  hypothetical protein OsJ_16356                          307   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EPS69501.1|  hypothetical protein M569_05264                         303   1e-93    Genlisea aurea
ref|XP_002513710.1|  conserved hypothetical protein                     306   2e-93    Ricinus communis
emb|CDO97480.1|  unnamed protein product                                306   2e-93    Coffea canephora [robusta coffee]
gb|AFW71977.1|  hypothetical protein ZEAMMB73_865146                    305   6e-93    
ref|XP_010520484.1|  PREDICTED: uncharacterized protein LOC104799...    304   9e-93    
ref|XP_010461962.1|  PREDICTED: uncharacterized protein LOC104742642    304   1e-92    Camelina sativa [gold-of-pleasure]
emb|CAH67071.1|  OSIGBa0097P08.1                                        304   1e-92    Oryza sativa [red rice]
gb|EAZ01162.1|  hypothetical protein OsI_23190                          304   2e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_010484239.1|  PREDICTED: uncharacterized protein LOC104762612    304   2e-92    Camelina sativa [gold-of-pleasure]
ref|NP_001052976.2|  Os04g0458200                                       303   2e-92    
ref|XP_010444391.1|  PREDICTED: uncharacterized protein LOC104727084    304   2e-92    Camelina sativa [gold-of-pleasure]
ref|NP_201260.1|  loricrin-related protein                              303   3e-92    Arabidopsis thaliana [mouse-ear cress]
gb|EEE61116.1|  hypothetical protein OsJ_15040                          305   5e-92    Oryza sativa Japonica Group [Japonica rice]
gb|EPS58190.1|  hypothetical protein M569_16626                         295   5e-92    Genlisea aurea
emb|CAE03375.1|  OSJNBa0036B21.17                                       305   6e-92    Oryza sativa Japonica Group [Japonica rice]
emb|CBW45773.1|  ORW1943Ba0077G13.1                                     305   7e-92    Oryza rufipogon [common wild rice]
ref|XP_009130459.1|  PREDICTED: uncharacterized protein LOC103855246    300   1e-91    Brassica rapa
emb|CDY46810.1|  BnaC02g43180D                                          299   1e-91    Brassica napus [oilseed rape]
ref|XP_006280171.1|  hypothetical protein CARUB_v10026073mg             300   1e-91    
ref|XP_008668458.1|  PREDICTED: uncharacterized protein LOC100383...    301   2e-91    
ref|XP_006280172.1|  hypothetical protein CARUB_v10026073mg             301   2e-91    
gb|KDO56524.1|  hypothetical protein CISIN_1g006721mg                   300   4e-91    Citrus sinensis [apfelsine]
ref|XP_006394140.1|  hypothetical protein EUTSA_v10003819mg             300   4e-91    Eutrema salsugineum [saltwater cress]
ref|XP_008784519.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    300   5e-91    
ref|XP_006652378.1|  PREDICTED: uncharacterized protein LOC102712799    300   6e-91    
ref|NP_001169521.1|  hypothetical protein                               300   6e-91    Zea mays [maize]
ref|XP_002866619.1|  hypothetical protein ARALYDRAFT_358659             308   7e-91    
gb|KHG10350.1|  putative WRKY transcription factor 19 -like protein     300   8e-91    Gossypium arboreum [tree cotton]
emb|CDY31315.1|  BnaA02g34260D                                          297   1e-90    Brassica napus [oilseed rape]
ref|XP_006432464.1|  hypothetical protein CICLE_v10000572mg             298   2e-90    
ref|XP_006647130.1|  PREDICTED: uncharacterized protein LOC102713982    298   3e-90    Oryza brachyantha
ref|XP_006399449.1|  hypothetical protein EUTSA_v10013049mg             292   4e-90    
ref|XP_002446603.1|  hypothetical protein SORBIDRAFT_06g018770          297   4e-90    Sorghum bicolor [broomcorn]
ref|XP_002452331.1|  hypothetical protein SORBIDRAFT_04g023820          297   7e-90    Sorghum bicolor [broomcorn]
emb|CDY18707.1|  BnaA09g06880D                                          294   1e-89    Brassica napus [oilseed rape]
ref|XP_006399450.1|  hypothetical protein EUTSA_v10013049mg             294   4e-89    Eutrema salsugineum [saltwater cress]
ref|XP_004975837.1|  PREDICTED: loricrin-like                           294   6e-89    Setaria italica
ref|XP_003572181.1|  PREDICTED: uncharacterized protein LOC100845094    293   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_008678723.1|  PREDICTED: uncharacterized protein LOC103653668    293   2e-88    Zea mays [maize]
ref|XP_010240508.1|  PREDICTED: loricrin-like isoform X2                293   3e-88    Brachypodium distachyon [annual false brome]
gb|EAY85267.1|  hypothetical protein OsI_06638                          293   3e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_003580653.1|  PREDICTED: loricrin-like isoform X1                293   3e-88    Brachypodium distachyon [annual false brome]
ref|XP_002873415.1|  hypothetical protein ARALYDRAFT_908918             290   6e-88    
ref|XP_009112138.1|  PREDICTED: uncharacterized protein LOC103837532    290   8e-88    Brassica rapa
ref|NP_196529.1|  loricrin-related protein                              288   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001159223.1|  hypothetical protein                               290   3e-87    Zea mays [maize]
dbj|BAD20066.1|  loricrin-like                                          290   3e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010452964.1|  PREDICTED: uncharacterized protein LOC104734965    288   3e-87    
ref|NP_001047213.1|  Os02g0575700                                       289   1e-86    
gb|EEC73463.1|  hypothetical protein OsI_07775                          289   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_003575219.1|  PREDICTED: hornerin-like                           288   3e-86    
dbj|BAK03259.1|  predicted protein                                      288   4e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009380175.1|  PREDICTED: loricrin-like                           287   5e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010431733.1|  PREDICTED: probable WRKY transcription facto...    275   5e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010422955.1|  PREDICTED: probable WRKY transcription facto...    284   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010491606.1|  PREDICTED: uncharacterized protein LOC104769157    283   3e-85    Camelina sativa [gold-of-pleasure]
dbj|BAK04205.1|  predicted protein                                      273   9e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS58002.1|  hypothetical protein TRIUR3_23027                       291   1e-84    Triticum urartu
ref|XP_008676922.1|  PREDICTED: uncharacterized protein LOC100275...    282   2e-84    Zea mays [maize]
ref|NP_001143197.1|  uncharacterized protein LOC100275699               282   2e-84    
ref|XP_009125354.1|  PREDICTED: probable WRKY transcription facto...    278   7e-84    Brassica rapa
emb|CDY64841.1|  BnaCnng45290D                                          274   4e-83    Brassica napus [oilseed rape]
emb|CDX85802.1|  BnaA02g00110D                                          273   5e-82    
gb|EMT32954.1|  hypothetical protein F775_16695                         276   1e-81    
gb|EYU18510.1|  hypothetical protein MIMGU_mgv1a003824mg                271   1e-80    Erythranthe guttata [common monkey flower]
ref|XP_006648777.1|  PREDICTED: uncharacterized protein LOC102711408    266   2e-78    Oryza brachyantha
emb|CDX81227.1|  BnaC09g06380D                                          254   9e-75    
ref|XP_006385779.1|  hypothetical protein POPTR_0003s13400g             248   1e-72    
ref|XP_010239444.1|  PREDICTED: LOW QUALITY PROTEIN: probable WRK...    226   1e-64    
emb|CDY51293.1|  BnaA06g23530D                                          226   1e-63    Brassica napus [oilseed rape]
gb|KDO76383.1|  hypothetical protein CISIN_1g011430mg                   223   5e-63    Citrus sinensis [apfelsine]
emb|CDY08361.1|  BnaC09g12350D                                          216   6e-60    Brassica napus [oilseed rape]
emb|CBI32953.3|  unnamed protein product                                204   2e-56    Vitis vinifera
emb|CDY25558.1|  BnaC09g11830D                                          199   5e-55    Brassica napus [oilseed rape]
ref|XP_007040391.1|  F22C12.10, putative isoform 2                      192   2e-51    
ref|NP_001154222.1|  mitogen-activated protein kinase kinase kina...    188   8e-48    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118968.1|  mitogen-activated protein kinase kinase kina...    188   8e-48    Arabidopsis thaliana [mouse-ear cress]
ref|NP_192939.2|  mitogen-activated protein kinase kinase kinase 11     188   9e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002775503.1|  hypothetical protein Pmar_PMAR020482               173   8e-46    Perkinsus marinus ATCC 50983
gb|EWM25546.1|  hypothetical protein Naga_100130g8                      173   4e-43    Nannochloropsis gaditana
ref|XP_002288629.1|  predicted protein                                  162   7e-43    Thalassiosira pseudonana CCMP1335
ref|NP_001169383.1|  uncharacterized protein LOC100383251               164   8e-42    
emb|CBI22577.3|  unnamed protein product                                162   2e-40    Vitis vinifera
ref|XP_010234178.1|  PREDICTED: probable WRKY transcription facto...    154   1e-38    
ref|XP_010234179.1|  PREDICTED: uncharacterized protein LOC100841...    155   2e-38    Brachypodium distachyon [annual false brome]
ref|XP_004952390.1|  PREDICTED: probable WRKY transcription facto...    152   5e-38    Setaria italica
ref|XP_006656085.1|  PREDICTED: uncharacterized protein LOC102720245    151   1e-37    Oryza brachyantha
dbj|BAD35335.1|  loricrin-like                                          151   1e-37    Oryza sativa Japonica Group [Japonica rice]
gb|EEE65702.1|  hypothetical protein OsJ_21336                          152   2e-37    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80600.1|  hypothetical protein OsI_22948                          152   2e-37    Oryza sativa Indica Group [Indian rice]
ref|NP_001057624.1|  Os06g0472700                                       151   2e-37    
dbj|BAJ95748.1|  predicted protein                                      150   2e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146471.1|  uncharacterized protein LOC100280059               149   1e-36    Zea mays [maize]
gb|ACN36046.1|  unknown                                                 146   9e-36    Zea mays [maize]
ref|XP_004952392.1|  PREDICTED: probable WRKY transcription facto...    145   9e-36    
gb|EMS46199.1|  hypothetical protein TRIUR3_04464                       146   2e-35    Triticum urartu
ref|XP_008676985.1|  PREDICTED: hypothetical protein isoform X2         145   2e-35    Zea mays [maize]
ref|NP_001144044.1|  hypothetical protein                               145   3e-35    Zea mays [maize]
ref|XP_008676992.1|  PREDICTED: hypothetical protein isoform X4         144   4e-35    
ref|XP_008676991.1|  PREDICTED: hypothetical protein isoform X3         144   4e-35    Zea mays [maize]
ref|XP_002444891.1|  hypothetical protein SORBIDRAFT_07g000960          145   4e-35    Sorghum bicolor [broomcorn]
ref|XP_008676994.1|  PREDICTED: hypothetical protein isoform X6         144   4e-35    Zea mays [maize]
ref|XP_008676993.1|  PREDICTED: hypothetical protein isoform X5         144   4e-35    
gb|EJK46480.1|  hypothetical protein THAOC_34847                        149   8e-35    Thalassiosira oceanica
gb|ACN34128.1|  unknown                                                 140   1e-33    Zea mays [maize]
ref|XP_008616481.1|  hypothetical protein SDRG_12196                    139   2e-33    Saprolegnia diclina VS20
dbj|BAJ93609.1|  predicted protein                                      140   3e-33    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008868444.1|  hypothetical protein H310_05489                    137   2e-32    Aphanomyces invadans
gb|ETK87798.1|  hypothetical protein L915_07794                         136   6e-32    
ref|XP_008904700.1|  hypothetical protein PPTG_10937                    135   7e-32    
dbj|BAD20067.1|  loricrin-like                                          121   8e-32    
gb|ETO76699.1|  hypothetical protein F444_07922                         136   1e-31    
gb|ETP45819.1|  hypothetical protein F442_07812                         135   1e-31    
ref|XP_008904583.1|  hypothetical protein PPTG_10858                    135   1e-31    
gb|ETL41335.1|  hypothetical protein L916_07636                         135   1e-31    
gb|KDO35561.1|  hypothetical protein SPRG_00406                         133   2e-31    
gb|ETM47760.1|  hypothetical protein L914_07600                         136   2e-31    
ref|XP_009835650.1|  hypothetical protein H257_10712                    134   2e-31    
ref|XP_008607341.1|  hypothetical protein SDRG_03483                    133   2e-31    
gb|ETI48015.1|  hypothetical protein F443_07857                         136   2e-31    
ref|XP_008871415.1|  hypothetical protein H310_07445                    133   3e-31    
ref|XP_009529443.1|  hypothetical protein PHYSODRAFT_286359             134   3e-31    
gb|ETK87916.1|  hypothetical protein L915_07707                         135   3e-31    
gb|ETL94511.1|  hypothetical protein L917_07519                         135   3e-31    
ref|XP_009839949.1|  hypothetical protein H257_13945                    130   2e-30    
gb|ETL78978.1|  hypothetical protein L917_20299                         132   2e-30    
gb|ETL25773.1|  hypothetical protein L916_20422                         132   3e-30    
gb|EEE51867.1|  hypothetical protein OsJ_33402                          129   3e-30    
gb|ETK72318.1|  hypothetical protein L915_20560                         132   3e-30    
gb|ETP29950.1|  hypothetical protein F442_20963                         132   3e-30    
gb|ETO60679.1|  hypothetical protein F444_21156                         131   4e-30    
ref|XP_002908858.1|  conserved hypothetical protein                     129   9e-30    
gb|ETM32254.1|  hypothetical protein L914_20303                         130   1e-29    
gb|ETI34705.1|  hypothetical protein F443_18876                         130   1e-29    
ref|XP_008914791.1|  hypothetical protein PPTG_18419                    129   2e-29    
ref|XP_008868087.1|  hypothetical protein H310_05208                    128   8e-29    
ref|XP_009540071.1|  hypothetical protein PHYSODRAFT_455520             120   1e-28    
ref|NP_001046478.1|  Os02g0259100                                       125   2e-28    
ref|XP_009538878.1|  hypothetical protein PHYSODRAFT_247554             126   3e-28    
ref|XP_002905526.1|  conserved hypothetical protein                     125   5e-28    
ref|XP_008605315.1|  hypothetical protein SDRG_01560                    125   5e-28    
ref|XP_008895280.1|  hypothetical protein PPTG_04747                    125   8e-28    
gb|ETI38570.1|  hypothetical protein F443_15724                         125   8e-28    
gb|ETL32237.1|  hypothetical protein L916_15157                         125   8e-28    
ref|XP_009833154.1|  hypothetical protein H257_08804                    122   8e-28    
gb|ETP36519.1|  hypothetical protein F442_15558                         125   9e-28    
emb|CCI39861.1|  unnamed protein product                                124   9e-28    
emb|CCA19191.1|  conserved hypothetical protein                         123   1e-27    
gb|AGE12613.1|  hypothetical protein                                    115   2e-27    
gb|KDO23784.1|  hypothetical protein SPRG_11215                         119   3e-27    
ref|XP_009833225.1|  hypothetical protein H257_08855                    119   3e-27    
ref|XP_002500420.1|  predicted protein                                  123   4e-27    
ref|XP_009833234.1|  hypothetical protein H257_08864                    118   7e-27    
emb|CCA26802.1|  conserved hypothetical protein                         120   7e-27    
ref|XP_009529954.1|  hypothetical protein PHYSODRAFT_506045             118   1e-26    
emb|CCA21053.1|  conserved hypothetical protein                         119   2e-26    
ref|XP_008910342.1|  hypothetical protein PPTG_15081                    118   2e-26    
ref|XP_008872426.1|  hypothetical protein H310_08470                    117   3e-26    
ref|XP_008618289.1|  hypothetical protein SDRG_13966                    116   3e-26    
ref|XP_002908757.1|  conserved hypothetical protein                     116   4e-26    
ref|XP_009837958.1|  hypothetical protein H257_12450                    120   5e-26    
ref|XP_009529928.1|  hypothetical protein PHYSODRAFT_506674             116   5e-26    
ref|XP_009518404.1|  hypothetical protein PHYSODRAFT_540638             118   7e-26    
ref|XP_008877135.1|  hypothetical protein H310_12011                    118   8e-26    
emb|CCI45514.1|  unnamed protein product                                116   1e-25    
gb|EMT24040.1|  hypothetical protein F775_20671                         118   2e-25    
ref|XP_002771282.1|  hypothetical protein Pmar_PMAR023210               114   2e-25    
ref|XP_002908777.1|  conserved hypothetical protein                     114   3e-25    
gb|EMT32787.1|  hypothetical protein F775_00346                         114   4e-25    
ref|XP_008615028.1|  hypothetical protein SDRG_10795                    112   6e-25    
ref|XP_008874902.1|  hypothetical protein H310_10330                    113   8e-25    
ref|XP_009842727.1|  hypothetical protein H257_16097                    113   1e-24    
ref|XP_008875426.1|  hypothetical protein H310_10752                    111   2e-24    
ref|XP_008604229.1|  hypothetical protein SDRG_00527                    111   6e-24    
ref|NP_001067530.2|  Os11g0223400                                       112   7e-24    
gb|KDO27903.1|  hypothetical protein SPRG_07176                         110   8e-24    
ref|XP_009830589.1|  hypothetical protein H257_06906                    109   8e-24    
ref|XP_009843205.1|  hypothetical protein H257_16471                    110   8e-24    
emb|CCA17111.1|  conserved hypothetical protein                         112   1e-23    
gb|AFW59623.1|  putative DNA-directed RNA polymerase subunit fami...    114   1e-23    
gb|KDO26858.1|  hypothetical protein SPRG_08147                         107   1e-23    
emb|CCA16180.1|  conserved hypothetical protein                         113   2e-23    
gb|AAX95851.1|  NB-ARC domain, putative                                 114   2e-23    
ref|XP_008621356.1|  hypothetical protein SDRG_16910                    107   2e-23    
ref|XP_008874020.1|  hypothetical protein H310_09659                    108   2e-23    
gb|KDO35560.1|  hypothetical protein SPRG_00405                         109   3e-23    
ref|XP_002775010.1|  hypothetical protein Pmar_PMAR002195               107   4e-23    
emb|CCI40947.1|  unnamed protein product                                112   4e-23    
ref|XP_009821977.1|  hypothetical protein H257_00801                    109   5e-23    
emb|CCI42445.1|  unnamed protein product                                110   6e-23    
ref|XP_008896777.1|  hypothetical protein PPTG_05060                    111   7e-23    
gb|ETM34815.1|  hypothetical protein L914_18174                         111   7e-23    
gb|ETK74930.1|  hypothetical protein L915_18365                         111   7e-23    
gb|ETP32613.1|  hypothetical protein F442_18714                         110   9e-23    
gb|ETO63393.1|  hypothetical protein F444_18892                         110   9e-23    
gb|KDO30482.1|  hypothetical protein SPRG_04385                         111   1e-22    
gb|ETO72906.1|  hypothetical protein F444_11111                         108   2e-22    
gb|ETK84266.1|  hypothetical protein L915_10766                         107   2e-22    
gb|ETP42139.1|  hypothetical protein F442_10942                         108   2e-22    
ref|XP_002447197.1|  hypothetical protein SORBIDRAFT_06g030290          106   2e-22    
ref|XP_002907264.1|  conserved hypothetical protein                     109   3e-22    
ref|XP_008908939.1|  hypothetical protein PPTG_13237                    108   3e-22    
gb|ETI42243.1|  hypothetical protein F443_12598                         108   3e-22    
gb|ETK82258.1|  hypothetical protein L915_12329                         107   3e-22    
gb|ETM42138.1|  hypothetical protein L914_12163                         107   3e-22    
ref|XP_002898349.1|  conserved hypothetical protein                     107   4e-22    
ref|XP_008910373.1|  hypothetical protein PPTG_15109                    106   4e-22    
ref|XP_008862259.1|  hypothetical protein H310_01034                    105   5e-22    
gb|ETM03723.1|  hypothetical protein L917_00096                         105   5e-22    
gb|ETO68491.1|  hypothetical protein F444_14681                         106   5e-22    
gb|ETK97328.1|  hypothetical protein L915_00111                         105   9e-22    
gb|ETM57010.1|  hypothetical protein L914_00104                         104   9e-22    
ref|XP_008889706.1|  hypothetical protein PPTG_00094                    104   9e-22    
gb|ETO86335.1|  hypothetical protein F444_00110                         104   1e-21    
gb|ETI57593.1|  hypothetical protein F443_00114                         104   1e-21    
ref|XP_008879130.1|  hypothetical protein H310_13413                    105   1e-21    
ref|XP_002998529.1|  conserved hypothetical protein                     105   2e-21    
ref|XP_009836307.1|  hypothetical protein H257_11159                    104   2e-21    
emb|CCI40238.1|  unnamed protein product                                107   2e-21    
emb|CCI40239.1|  unnamed protein product                                106   2e-21    
ref|XP_008613099.1|  hypothetical protein SDRG_08970                    103   3e-21    
gb|KDO19998.1|  hypothetical protein SPRG_14578                         103   3e-21    
ref|XP_008613802.1|  hypothetical protein SDRG_09634                    105   4e-21    
emb|CCI42342.1|  unnamed protein product                                105   4e-21    
ref|XP_002901898.1|  conserved hypothetical protein                     104   4e-21    
ref|XP_009833150.1|  hypothetical protein H257_08800                    102   4e-21    
ref|XP_009534761.1|  hypothetical protein PHYSODRAFT_549251             100   5e-21    
ref|XP_008609833.1|  hypothetical protein SDRG_05869                    103   5e-21    
gb|ETK75526.1|  hypothetical protein L915_17869                         104   6e-21    
ref|XP_008913038.1|  hypothetical protein PPTG_17138                    104   6e-21    
gb|ETL82193.1|  hypothetical protein L917_17596                         104   6e-21    
gb|ETI35261.1|  hypothetical protein F443_18362                         104   7e-21    
ref|XP_009824861.1|  hypothetical protein H257_02764                    104   7e-21    
ref|XP_008878447.1|  hypothetical protein, variant 2                    103   1e-20    
gb|KDO31648.1|  hypothetical protein SPRG_03568                         100   2e-20    
ref|XP_010232040.1|  PREDICTED: uncharacterized protein LOC100835538  99.0    2e-20    
ref|XP_002896022.1|  conserved hypothetical protein                     101   2e-20    
emb|CCA16791.1|  conserved hypothetical protein                         103   2e-20    
ref|XP_008609335.1|  hypothetical protein SDRG_05399                  99.8    2e-20    
ref|XP_009514632.1|  hypothetical protein PHYSODRAFT_321166             103   2e-20    
ref|XP_002907212.1|  conserved hypothetical protein                   99.4    3e-20    
gb|ETI50322.1|  hypothetical protein F443_06105                         102   3e-20    
ref|XP_009834650.1|  hypothetical protein H257_09956                    102   3e-20    
gb|ETL96760.1|  hypothetical protein L917_05807                         102   3e-20    
gb|EMS67348.1|  hypothetical protein TRIUR3_08427                       103   4e-20    
ref|XP_008916811.1|  hypothetical protein PPTG_19940                    101   4e-20    
emb|CCI39931.1|  unnamed protein product                                102   4e-20    
emb|CCA14729.1|  conserved hypothetical protein                         102   5e-20    
ref|XP_008620018.1|  hypothetical protein SDRG_15618                  98.6    6e-20    
gb|ETL96761.1|  hypothetical protein, variant                           100   8e-20    
emb|CCA14223.1|  conserved hypothetical protein                         102   8e-20    
gb|ETI50323.1|  hypothetical protein, variant                           100   8e-20    
ref|XP_008614026.1|  hypothetical protein SDRG_09851                  99.0    8e-20    
ref|XP_002774794.1|  hypothetical protein Pmar_PMAR002606             95.5    8e-20    
emb|CCI40237.1|  unnamed protein product                                101   1e-19    
ref|XP_008609277.1|  hypothetical protein SDRG_05342                  97.4    2e-19    
gb|KDO32735.1|  hypothetical protein SPRG_02433                       98.2    2e-19    
gb|KDO31022.1|  hypothetical protein SPRG_04208                       97.4    2e-19    
ref|XP_008916812.1|  hypothetical protein, variant                    99.0    2e-19    
ref|XP_002788873.1|  hypothetical protein Pmar_PMAR029673             94.0    2e-19    
emb|CCI40240.1|  unnamed protein product                                100   2e-19    
ref|XP_009832781.1|  hypothetical protein H257_08561                  98.6    2e-19    
ref|XP_008895482.1|  hypothetical protein, variant                      100   2e-19    
gb|ETP36312.1|  hypothetical protein, variant                           100   2e-19    
ref|XP_009538595.1|  hypothetical protein PHYSODRAFT_319927             100   3e-19    
gb|ETK78571.1|  hypothetical protein, variant                           100   3e-19    
gb|ETI38379.1|  hypothetical protein, variant                           100   3e-19    
gb|ETP36311.1|  hypothetical protein F442_15719                         100   3e-19    
gb|ETK78570.1|  hypothetical protein L915_15434                         100   3e-19    
ref|XP_008895481.1|  hypothetical protein PPTG_04890                    100   3e-19    
gb|ETI38378.1|  hypothetical protein F443_15878                         100   3e-19    
gb|ETL85242.1|  hypothetical protein L917_15153                         100   3e-19    
gb|ETM48476.1|  hypothetical protein L914_06988                       98.6    3e-19    
ref|XP_009834649.1|  hypothetical protein, variant                    99.0    3e-19    
emb|CBN79244.1|  putative copper transporter                            100   4e-19    
gb|ETL95263.1|  hypothetical protein L917_06908                       98.6    4e-19    
gb|ETL42106.1|  hypothetical protein L916_07023                       98.6    4e-19    
ref|XP_008865837.1|  hypothetical protein H310_03656                  95.9    4e-19    
ref|XP_002787762.1|  hypothetical protein Pmar_PMAR012539             99.4    5e-19    
ref|XP_002906977.1|  conserved hypothetical protein                   99.8    5e-19    
ref|XP_008867681.1|  hypothetical protein H310_04912                  98.6    6e-19    
ref|XP_008615318.1|  hypothetical protein SDRG_11073                  95.9    6e-19    
gb|KDO34449.1|  hypothetical protein SPRG_01583                       95.9    7e-19    
gb|KDO20657.1|  hypothetical protein SPRG_13410                       95.1    7e-19    
ref|XP_009824973.1|  hypothetical protein H257_02851                  95.1    7e-19    
ref|XP_009837814.1|  hypothetical protein, variant                    97.8    8e-19    
ref|XP_008871955.1|  hypothetical protein H310_08103                  97.1    1e-18    
ref|XP_009517547.1|  hypothetical protein PHYSODRAFT_445608           94.4    1e-18    
ref|XP_009837813.1|  hypothetical protein H257_12347                  97.8    2e-18    
ref|XP_009835536.1|  hypothetical protein H257_10634                  94.7    2e-18    
emb|CCI39429.1|  unnamed protein product                              95.5    3e-18    
gb|KDO33258.1|  hypothetical protein SPRG_02067                       94.7    3e-18    
ref|XP_008870828.1|  hypothetical protein H310_07252                  93.6    4e-18    
ref|NP_001137058.1|  uncharacterized protein LOC100217230             92.4    4e-18    
ref|XP_003059142.1|  predicted protein                                96.7    5e-18    
ref|XP_008875621.1|  hypothetical protein H310_10909                  94.0    5e-18    
ref|XP_002970383.1|  hypothetical protein SELMODRAFT_441219           95.5    5e-18    
ref|XP_008908026.1|  hypothetical protein PPTG_12643                  93.6    6e-18    
ref|XP_008620013.1|  hypothetical protein SDRG_15613                  92.8    6e-18    
gb|KDO34453.1|  hypothetical protein SPRG_01587                       92.0    8e-18    
gb|KDO20659.1|  hypothetical protein SPRG_13412                       92.0    9e-18    
ref|XP_008620017.1|  hypothetical protein SDRG_15617                  92.0    1e-17    
ref|XP_009826260.1|  hypothetical protein H257_03739                  92.4    1e-17    
ref|XP_009825210.1|  hypothetical protein H257_03016                  94.4    1e-17    
ref|XP_008865836.1|  hypothetical protein H310_03655                  91.3    2e-17    
ref|XP_008609887.1|  hypothetical protein SDRG_05920                  91.3    2e-17    
ref|XP_008904576.1|  hypothetical protein PPTG_10850                  94.7    2e-17    
ref|XP_008621116.1|  hypothetical protein SDRG_16676                  91.7    2e-17    
ref|XP_009529728.1|  hypothetical protein PHYSODRAFT_263101           94.4    2e-17    
ref|XP_008607095.1|  hypothetical protein SDRG_03243                  91.7    2e-17    
gb|KDO28049.1|  hypothetical protein SPRG_20211                       90.9    2e-17    
ref|XP_008861382.1|  hypothetical protein H310_00387                  92.8    2e-17    
gb|KDO34454.1|  hypothetical protein SPRG_01588                       90.9    3e-17    
ref|XP_008609876.1|  hypothetical protein SDRG_05910                  90.1    3e-17    
ref|XP_008615423.1|  hypothetical protein SDRG_11171                  92.4    3e-17    
ref|XP_009822295.1|  hypothetical protein H257_01015                  92.4    3e-17    
gb|KDO31171.1|  hypothetical protein SPRG_04310                       92.4    3e-17    
ref|XP_002908935.1|  conserved hypothetical protein                   93.6    4e-17    
gb|KDO35670.1|  hypothetical protein SPRG_18830                       92.8    4e-17    
ref|XP_008621133.1|  hypothetical protein SDRG_16693                  92.8    4e-17    
ref|XP_008609886.1|  hypothetical protein SDRG_05919                  90.9    4e-17    
ref|XP_008612540.1|  hypothetical protein SDRG_08430                  91.3    5e-17    
ref|XP_002898099.1|  conserved hypothetical protein                   90.9    5e-17    
ref|XP_008620015.1|  hypothetical protein SDRG_15615                  89.7    7e-17    
ref|XP_009525416.1|  hypothetical protein PHYSODRAFT_558230           90.5    7e-17    
ref|XP_009824974.1|  hypothetical protein H257_02852                  90.1    8e-17    
emb|CCA16449.1|  conserved hypothetical protein                       89.7    9e-17    
ref|XP_008865838.1|  hypothetical protein H310_03657                  90.5    9e-17    
ref|XP_008613211.1|  hypothetical protein SDRG_09077                  89.7    1e-16    



>emb|CDP12102.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   477 bits (1227),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 243/321 (76%), Positives = 270/321 (84%), Gaps = 1/321 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQYP+CTKGAQGSTMFCKAHGGG+R
Sbjct  359   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRR  418

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C  EGCTKGAEGSTPFCKGHGGGKRC FQGGG+CPKSVHGGTL+CVAHGGGKRCAV +CT
Sbjct  419   CTSEGCTKGAEGSTPFCKGHGGGKRCSFQGGGICPKSVHGGTLFCVAHGGGKRCAVPECT  478

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQP SEFG  E PC
Sbjct  479   KSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGQPGSEFGNSESPC  538

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSF RGKTGLCASHGALVQDKRVHG  TLG +VQ+  P + + MK++   EDM+AD M +
Sbjct  539   NSFVRGKTGLCASHGALVQDKRVHGAVTLGAMVQDPEPSKPDKMKQVIIAEDMNADIMKM  598

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             E SV+T  +GS  K +   QA +P+  S  S  V IPEGRVHGGSL++M+ SNS  S  S
Sbjct  599   ESSVITPFSGSGGKCVCPLQAGLPVGRSASSNAVAIPEGRVHGGSLMAMMVSNSALSFGS  658

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S G  +PSE RK++I  QSW+
Sbjct  659   SNGMVSPSEQRKSWI-RQSWV  678


 Score =   184 bits (467),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+CQ   C K A G SGLCI+HGGGRRCQ   C KGA+G T FCKAHGGG+RC + GCTK
Sbjct  267   KQCQFNGCVKGARGASGLCIAHGGGRRCQRLGCHKGAEGRTAFCKAHGGGRRCEFLGCTK  326

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  327   SAEGRTDLCIAHGGGRRCSHEG---CSRAARGKSGLCIRHGGGKRCQRENCTKSAEGLSG  383

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGG+RC   +  ++  +G  P   F +G  
Sbjct  384   LCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRRCT-SEGCTKGAEGSTP---FCKGHG  439

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   C+  G  +  K VHGG    V 
Sbjct  440   GGKRCSFQGGGICPKSVHGGTLFCVA  465



>ref|XP_011080886.1| PREDICTED: uncharacterized protein LOC105164037 [Sesamum indicum]
 ref|XP_011080887.1| PREDICTED: uncharacterized protein LOC105164037 [Sesamum indicum]
Length=667

 Score =   466 bits (1198),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/321 (73%), Positives = 265/321 (83%), Gaps = 4/321 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQYP+C KGAQGSTMFCKAHGGGKR
Sbjct  351   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQYPECKKGAQGSTMFCKAHGGGKR  410

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GC KGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGTL+CVAHGGGKRCAV +CT
Sbjct  411   CTYPGCNKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVAHGGGKRCAVPECT  470

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SEFG+G++PC
Sbjct  471   KSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCLWGHPGSEFGQGDVPC  530

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             N+FARGKTGLCASHGALVQDKRVHGGAT+G+VVQE    +   M  I T EDM+ D+  +
Sbjct  531   NTFARGKTGLCASHGALVQDKRVHGGATIGIVVQESKVNQPVKMNPIFTVEDMNVDNAKM  590

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             E SVVT      W Y   + A +P+ GS  S+   +PEGRVHGG+L++M A +   +++ 
Sbjct  591   ENSVVTCTG--SWDYFGDQPAHLPV-GSNASLG-KVPEGRVHGGNLIAMFAGSPVINVAC  646

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S     P EP KA+ TH++WM
Sbjct  647   SGDMVGPPEPEKAFTTHKTWM  667


 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 130/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC + GCTK
Sbjct  259   KQCQFQGCFKGARGASGLCIAHGGGRRCQRPGCHKGAEGRTAFCKAHGGGRRCEFLGCTK  318

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  319   SAEGRTDFCIAHGGGRRCSNEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSAEGLSG  375

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +  P          CN  A G T
Sbjct  376   LCISHGGGRRCQYPECKKGAQGSTMFCKAHGGGKRCTY--PG---------CNKGAEGST  424

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
               C  H         G  V  K VHGG    V 
Sbjct  425   PFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVA  457



>ref|XP_009796704.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
 ref|XP_009796705.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
 ref|XP_009796706.1| PREDICTED: uncharacterized protein LOC104243241 [Nicotiana sylvestris]
Length=679

 Score =   461 bits (1186),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/321 (74%), Positives = 266/321 (83%), Gaps = 3/321 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  362   LCIRHGGGKRCQNEGCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  421

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGTL+CVAHGGGKRCAV +CT
Sbjct  422   CTFEGCNKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVAHGGGKRCAVPECT  481

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGG+RC+ E CGKSAQGSTDFCKAHGGGKRC WGQP SEFG+G+ PC
Sbjct  482   KSARGRTDFCVRHGGGRRCKVEDCGKSAQGSTDFCKAHGGGKRCSWGQPDSEFGQGDGPC  541

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFARGKTGLCASHGALVQDKRVHGGATLG +V +  P + E MK I   ED+  D+M +
Sbjct  542   NSFARGKTGLCASHGALVQDKRVHGGATLGAMVLDSAPNQPEKMKGIVNLEDICFDAMKM  601

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             + + +TSANGSD +Y  FKQ T            ++ EGRVHGGSL+++LAS S  + +S
Sbjct  602   QSNGMTSANGSDVEYFGFKQNTNM---QVGGSSSSVSEGRVHGGSLMALLASGSGRTSNS  658

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S+GT   SEP  +++  ++WM
Sbjct  659   SKGTVTASEPGNSFLVSKNWM  679


 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 133/211 (63%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  265   RSSSTKQCQFKGCVKGARGASGLCIAHGGGRRCQKPGCHKGAEGRTAFCKAHGGGRRCEF  324

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  325   LGCTKSAEGRTDFCIAHGGGRRCSQDG---CTRAARGKSGLCIRHGGGKRCQNEGCTKSA  381

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC + +  ++  +G  P   F
Sbjct  382   EGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-EGCNKGAEGSTP---F  437

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C+  G  V  K VHGG    V 
Sbjct  438   CKGHGGGKRCSFQGGGVCPKSVHGGTLFCVA  468



>ref|XP_009630287.1| PREDICTED: uncharacterized protein LOC104120257 [Nicotiana tomentosiformis]
Length=679

 Score =   454 bits (1168),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 232/321 (72%), Positives = 263/321 (82%), Gaps = 3/321 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  362   LCIRHGGGKRCQNEGCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  421

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGTL+CVAHGGGKRCAV++CT
Sbjct  422   CTFEGCNKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVAHGGGKRCAVSECT  481

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGG+RC+ E CGKSAQGSTDFCKAHGGGKRC WGQP SEFG+G+ PC
Sbjct  482   KSARGRTDFCVRHGGGRRCKVEDCGKSAQGSTDFCKAHGGGKRCSWGQPDSEFGQGDGPC  541

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFARGKTGLCASHGALVQDKRVHGGATLG +V +  P ++E MK I   ED+  D M +
Sbjct  542   NSFARGKTGLCASHGALVQDKRVHGGATLGAMVLDSAPNQSEKMKGIVNLEDICFDVMKM  601

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             +   +TSA GSD ++   KQ T            ++ EGRVHGGSL+++LAS S  + +S
Sbjct  602   QSGAMTSAYGSDMEHFGLKQKTSM---QVGGSSSSVSEGRVHGGSLMALLASGSGRTSNS  658

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S+G    SEP  +++  ++WM
Sbjct  659   SKGAVTASEPGNSFLVSKNWM  679


 Score =   188 bits (477),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 128/218 (59%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K+CQ E C K A G SGLCI+HGGGRRCQ   C KGA+G T FCKAHGGG+RC +
Sbjct  265   RNSSTKQCQFEGCVKGARGASGLCIAHGGGRRCQKLGCHKGAEGRTAFCKAHGGGRRCEF  324

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  325   LGCTKSAEGRTDFCIAHGGGRRCSQDG---CTRAARGKSGLCIRHGGGKRCQNEGCTKSA  381

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  382   EGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------EGCNKG  430

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG    V 
Sbjct  431   AEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVA  468


 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 87/155 (56%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        + +   K+C +EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  252   CTSGLTQQQQQQQRNSSTKQCQFEGCVKGARGASGLCIAHGGGRRCQKLG---CHKGAEG  308

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T +C AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  +GC ++A+G +  C  HGG
Sbjct  309   RTAFCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSQDGCTRAARGKSGLCIRHGG  368

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC               C   A G +GLC SHG
Sbjct  369   GKRCQ-----------NEGCTKSAEGLSGLCISHG  392



>ref|XP_004245556.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_004245557.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_010325376.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
 ref|XP_010325377.1| PREDICTED: uncharacterized protein LOC101268782 [Solanum lycopersicum]
Length=681

 Score =   452 bits (1162),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 262/321 (82%), Gaps = 4/321 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  363   LCIRHGGGKRCQHEGCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  422

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGST FCKGHGGGKRC FQG G+CPKSVHGGTL+CVAHGGGKRCAV +CT
Sbjct  423   CTFEGCNKGAEGSTAFCKGHGGGKRCSFQGNGLCPKSVHGGTLFCVAHGGGKRCAVAECT  482

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+ +GCGKSAQGSTDFCKAHGGGKRC WGQP SEFG+G+ PC
Sbjct  483   RSARGRTDFCVRHGGGKRCKVDGCGKSAQGSTDFCKAHGGGKRCSWGQPDSEFGQGDGPC  542

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFARGKTGLCASHGAL+QDKRVHGGATLG +V ++ P ++E +KEI   ED+  D   +
Sbjct  543   NSFARGKTGLCASHGALIQDKRVHGGATLGTIVLDLAPNQSEKIKEIVNVEDICFDVTKM  602

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             +   +TS+N S  KY+ F Q  +P+ GS  S    + EGRVHGG L+++LA  S  + +S
Sbjct  603   QSIGMTSSNDSHMKYLGFNQPNVPVAGSSSS----VSEGRVHGGGLMALLAGGSGRTSNS  658

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S+     SEP  ++I  ++ M
Sbjct  659   SKEPVTASEPGSSFIVSKNRM  679


 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 122/192 (64%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  266   RSSSTKQCQFKGCVKGARGASGLCIAHGGGRRCQKPGCHKGAEGRTAFCKAHGGGRRCEF  325

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  326   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CSRAARGKSGLCIRHGGGKRCQHEGCTKSA  382

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  383   EGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTFEG-----------CNKG  431

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  432   AEGSTAFCKGHG  443



>ref|XP_006343911.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Solanum tuberosum]
 ref|XP_006343912.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Solanum tuberosum]
Length=679

 Score =   451 bits (1161),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 261/321 (81%), Gaps = 4/321 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  363   LCIRHGGGKRCQHEGCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  422

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGST FCKGHGGGKRC FQG G+CPKSVHGGTL+CVAHGGGKRCAV++CT
Sbjct  423   CTFEGCNKGAEGSTAFCKGHGGGKRCSFQGNGLCPKSVHGGTLFCVAHGGGKRCAVSECT  482

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP SEFG+G+  C
Sbjct  483   RSARGRTDFCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGQPDSEFGQGDGLC  542

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFARGKTGLCASHGALVQDKRVHGGATLG +V ++ P ++E MKEI   ED+  D   +
Sbjct  543   NSFARGKTGLCASHGALVQDKRVHGGATLGTMVLDLEPNQSEKMKEIVNAEDICFDVTKM  602

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
             +   +TS +    KY+ F Q  +P+ GS  S    + EGRVHGG L+++LA  S  + ++
Sbjct  603   QSIGMTSGDDPHMKYLGFNQPNIPVAGSSSS----VSEGRVHGGGLMALLAGGSGRTSNN  658

Query  396   SRGTENPSEPRKAYITHQSWM  334
             S+     SEP  ++I  ++WM
Sbjct  659   SKEPVPASEPGSSFIVSKNWM  679


 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 120/192 (63%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ + C K A G SGLCI+HGGGRRCQ   C KGA+G T FCKAHGGG+RC +
Sbjct  266   RSSSTKLCQFKGCVKGARGASGLCIAHGGGRRCQKSGCHKGAEGRTAFCKAHGGGRRCEF  325

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  326   LGCTKSAEGRTDFCIAHGGGRRCSQEG---CSRAARGKSGLCIRHGGGKRCQHEGCTKSA  382

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  383   EGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------EGCNKG  431

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  432   AEGSTAFCKGHG  443



>ref|XP_002276602.1| PREDICTED: uncharacterized protein LOC100255255 [Vitis vinifera]
 ref|XP_010658581.1| PREDICTED: uncharacterized protein LOC100255255 [Vitis vinifera]
Length=684

 Score =   445 bits (1144),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 261/329 (79%), Gaps = 10/329 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+P CTKGAQGSTM+CKAHGGGKR
Sbjct  358   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFPACTKGAQGSTMYCKAHGGGKR  417

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGG+CPKSVHGGT +CVAHGGGKRCAV +CT
Sbjct  418   CTVPGCTKGAEGSTPFCKGHGGGKRCSFQGGGICPKSVHGGTNFCVAHGGGKRCAVPECT  477

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQ  S+FG  + PC
Sbjct  478   KSARGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGQVGSQFGSQDGPC  537

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             +SFARGKTGLCASH ALVQDKRVHGGATL   VQ  +P + E MK++  TEDM+ D M +
Sbjct  538   SSFARGKTGLCASHNALVQDKRVHGGATLAHTVQIPSPSKPEKMKDVVATEDMNVDIMKM  597

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSP-----PS-IPVTIPEGRVHGGSLLsmlasns  415
               S +   N + W  +  KQ  +P    P     PS +PV  PEGRVHGGSL++MLA + 
Sbjct  598   MGSSIV--NPAGWTGLELKQVGLPQPHLPAREVRPSPVPVLAPEGRVHGGSLMAMLAGSP  655

Query  414   dpslssSRGTEN--PSEPRKAYITHQSWM  334
               S S S+   +  PSEPRK Y+  QSWM
Sbjct  656   GLSPSDSKTLISGGPSEPRKPYMMPQSWM  684


 Score =   185 bits (469),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 129/219 (59%), Gaps = 25/219 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ + C K A G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  261   RSTSSKTCQFKGCGKGARGASGLCIAHGGGRRCQKTGCHKGAEGRTVYCKAHGGGRRCEF  320

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  321   LGCTKSAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  377

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQF  C K AQGST +CKAHGGGKRC             +P C  
Sbjct  378   EGLSGLCISHGGGRRCQFPACTKGAQGSTMYCKAHGGGKRC------------TVPGCTK  425

Query  750   FARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
              A G T  C  H         G  +  K VHGG    V 
Sbjct  426   GAEGSTPFCKGHGGGKRCSFQGGGICPKSVHGGTNFCVA  464



>ref|XP_009620186.1| PREDICTED: uncharacterized protein LOC104112063 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009620187.1| PREDICTED: uncharacterized protein LOC104112063 isoform X1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   442 bits (1137),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 257/314 (82%), Gaps = 7/314 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ ENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGST+FCKAHGGGKR
Sbjct  344   LCIRHGGGKRCQMENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKR  403

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGSTPFCKGHGGGKRC +QGGGVCPKSVHGGTL+CVAHGGGKRCA+ +C+
Sbjct  404   CTFEGCNKGAEGSTPFCKGHGGGKRCTYQGGGVCPKSVHGGTLFCVAHGGGKRCAMPECS  463

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC WGQP SEFG+ E P 
Sbjct  464   RSARGRTDFCVRHGGGKRCKFDSCGKSAQGSTDFCKAHGGGKRCSWGQPGSEFGQNESPF  523

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFAR K+GLC SHGALVQDKRVHGGATLG VV + TPK    MKEI   EDM  D M +
Sbjct  524   NSFARAKSGLCESHGALVQDKRVHGGATLGAVVLDSTPKNPGKMKEIVNVEDMYIDIMKM  583

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
               +++TS   + WKY  FK+   P+         ++ EGRVHGGSL++MLA  S  +L+S
Sbjct  584   GSNILTS---TGWKYFEFKEGNTPVG----GSSSSVSEGRVHGGSLMAMLAGGSSHTLNS  636

Query  396   SRGTENPSEPRKAY  355
             SRGT   SEP K +
Sbjct  637   SRGTVTTSEPGKPF  650


 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 133/218 (61%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+ G K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  247   RNSGIKQCQFKGCIKGARGASGLCIAHGGGRRCQKPGCHKGAEGRTAFCKAHGGGRRCEF  306

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC + +CTKSA
Sbjct  307   LGCTKSAEGRTDFCITHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQMENCTKSA  363

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  364   EGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKRCTFEG-----------CNKG  412

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG    V 
Sbjct  413   AEGSTPFCKGHGGGKRCTYQGGGVCPKSVHGGTLFCVA  450



>ref|XP_002509888.1| transcription factor, putative [Ricinus communis]
 gb|EEF51275.1| transcription factor, putative [Ricinus communis]
Length=677

 Score =   429 bits (1103),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 255/324 (79%), Gaps = 4/324 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  355   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQSLGCTKGAQGSTMFCKAHGGGKR  414

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  415   CTAPGCTKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  474

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G +   P
Sbjct  475   KSARGRTDFCVRHGGGKRCKNEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGVQPTAP  534

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGK GLCA H  LVQDKRVHGGATLG ++QE    +TE MKE+   EDM+ D++ 
Sbjct  535   CNSFARGKKGLCALHSGLVQDKRVHGGATLGPIIQEPKSIQTEKMKEVMIAEDMNVDNLG  594

Query  579   VERSVVTSANGSDWKYISFKQATMPI-LGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsl  403
                   +S + +D K+     A +P       S+PV +PEGRVHGGSL++MLA +S    
Sbjct  595   SSMGASSSKS-TDLKHFGVPNAHIPAGEAGMSSMPVFVPEGRVHGGSLMAMLAGDSSVGS  653

Query  402   ssSRGTE-NPSEPRKAYITHQSWM  334
             SS+     NPS+PRK Y+  QSWM
Sbjct  654   SSNLVVAGNPSDPRKTYMVPQSWM  677


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 132/211 (63%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K C+ E C K A G SG CISHGGGRRCQ P C KGA+G T++CK+HGGG+RC +
Sbjct  258   RSSNSKLCEVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKSHGGGRRCEF  317

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  318   LGCTKSAEGRTDFCIAHGGGRRCSSEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  374

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P   F
Sbjct  375   EGLSGLCISHGGGRRCQSLGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTP---F  430

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  431   CKGHGGGKRCAFQGGGVCTKSVHGGTNFCVA  461



>ref|XP_011022585.1| PREDICTED: uncharacterized protein LOC105124317 [Populus euphratica]
 ref|XP_011022586.1| PREDICTED: uncharacterized protein LOC105124317 [Populus euphratica]
Length=681

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 224/326 (69%), Positives = 251/326 (77%), Gaps = 5/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GC+KGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  416   CTAPGCSKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRT FCVRHGGGKRC+FEGCGKSAQGSTD+CKAHGGGKRC WG P SE+G     P
Sbjct  476   KSARGRTLFCVRHGGGKRCKFEGCGKSAQGSTDYCKAHGGGKRCSWGHPGSEYGNQPTGP  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    ++E MKE+ T EDM  D + 
Sbjct  536   CNSFARGKTGLCALHSGLVQDKRVHGGVTLGTMVQDPKISQSEKMKEVVTAEDMTIDIVK  595

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +      S   +      F  ++ PI        SIPV + EGRV GGSL++M+A     
Sbjct  596   MGTVAAASTGRTTTDLKHFGDSSTPISVREAGLSSIPVFVSEGRVRGGSLMAMIAGGFGV  655

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
               SS++    +PSEPRK+Y+ HQ+WM
Sbjct  656   GSSSNQVVAGDPSEPRKSYVIHQNWM  681


 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 131/206 (64%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRC+   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  264   KLCQVEGCGKGARGASGRCISHGGGRRCRKAGCLKGAEGRTVYCKAHGGGRRCEFLGCTK  323

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  324   SAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  380

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC      S+  +G  P   F +G  
Sbjct  381   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCT-APGCSKGAEGSTP---FCKGHG  436

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  437   GGKRCAFQGGGVCTKSVHGGTNFCVA  462



>ref|XP_012086797.1| PREDICTED: uncharacterized protein LOC105645728 [Jatropha curcas]
 gb|KDP25357.1| hypothetical protein JCGZ_20513 [Jatropha curcas]
Length=679

 Score =   423 bits (1088),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 256/325 (79%), Gaps = 7/325 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGST+FCKAHGGGKR
Sbjct  358   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQTPGCTKGAQGSTLFCKAHGGGKR  417

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  418   CTAPGCTKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  477

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTDFCVRHGGGKRC++EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  478   KSARGRTDFCVRHGGGKRCKYEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGVQPTGP  537

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H +LVQDKRVHGG TLG ++ E    + + +KE+   EDM+ D + 
Sbjct  538   CNSFARGKTGLCALHSSLVQDKRVHGGITLGPIIHEPKISQPQKLKEV-AAEDMNVDIVK  596

Query  579   VERSVVTSAN--GSDWKYISFKQATMPI-LGSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  ++  SA+   SD K  +   A +P+      S+PV +PEGRVHGGSL++MLA  S  
Sbjct  597   MGSNLGASASKPTSDLKDFAVPNAHIPVGEAGLSSVPVFVPEGRVHGGSLMAMLAGGSGT  656

Query  408   slssSRGTENPSEPRKAYITHQSWM  334
                S     +PSEP+K++I  +SWM
Sbjct  657   GSRSL--GSDPSEPQKSFIVPKSWM  679


 Score =   184 bits (467),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 130/206 (63%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  266   KLCQVEGCGKGARGASGRCISHGGGRRCQKAGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  325

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  326   SAEGRTDYCIAHGGGRRCSREG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  382

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P   F +G  
Sbjct  383   LCISHGGGRRCQTPGCTKGAQGSTLFCKAHGGGKRCT-APGCTKGAEGSTP---FCKGHG  438

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  439   GGKRCAFQGGGVCTKSVHGGTNFCVA  464



>ref|XP_009334483.1| PREDICTED: uncharacterized protein LOC103927300 [Pyrus x bretschneideri]
Length=668

 Score =   422 bits (1086),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 252/322 (78%), Gaps = 11/322 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTM+CKAHGGGKR
Sbjct  357   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAVGCTKGAQGSTMYCKAHGGGKR  416

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC F+GGG C KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  417   CTAPGCTKGAEGSTPYCKGHGGGKRCAFEGGGHCTKSVHGGTNFCVAHGGGKRCAIPECT  476

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P S +G +   P
Sbjct  477   KSARGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSVYGVQASAP  536

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    ++E MKE+   +DM+ D M 
Sbjct  537   CNSFARGKTGLCALHSGLVQDKRVHGGITLGPMVQDPKLGKSEKMKEVVIADDMNVDVMN  596

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             +   + TSA G+   Y   K       G   S+P  +PEGRVHGGSL+++L   S  + +
Sbjct  597   IVSGIRTSATGT---YSDLKH------GGQSSVPTLVPEGRVHGGSLMALLVGGSSDANT  647

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             +S G+ N S P+K+Y+ HQ+WM
Sbjct  648   NSMGS-NSSGPKKSYMMHQNWM  668


 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 112/161 (70%), Gaps = 3/161 (2%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  260   RSSNSKTCQVEGCGKGARGASGRCISHGGGRRCQRSGCHKGAEGRTVYCKAHGGGRRCEF  319

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  320   LGCTKSAEGRTDFCIAHGGGRRCSEEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  376

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
              G +  C+ HGGG+RCQ  GC K AQGST +CKAHGGGKRC
Sbjct  377   EGLSGLCISHGGGRRCQAVGCTKGAQGSTMYCKAHGGGKRC  417


 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 81/137 (59%), Gaps = 14/137 (10%)
 Frame = -3

Query  1122  KRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD  943
             K C  EGC KGA G++  C  HGGG+RC   G   C K   G T+YC AHGGG+RC    
Sbjct  265   KTCQVEGCGKGARGASGRCISHGGGRRCQRSG---CHKGAEGRTVYCKAHGGGRRCEFLG  321

Query  942   CTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI  763
             CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGGGKRC              
Sbjct  322   CTKSAEGRTDFCIAHGGGRRCSEEGCTRAARGKSGLCIRHGGGKRCQ-----------RE  370

Query  762   PCNSFARGKTGLCASHG  712
              C   A G +GLC SHG
Sbjct  371   NCTKSAEGLSGLCISHG  387



>gb|ABK96565.1| unknown [Populus trichocarpa x Populus deltoides]
Length=681

 Score =   423 bits (1087),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 224/326 (69%), Positives = 250/326 (77%), Gaps = 5/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GC+KGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  416   CTAPGCSKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRT FCVRHGGGKRC+FEGCGKSAQGSTD+CKAHGGGKRC WG P SE+G     P
Sbjct  476   KSARGRTHFCVRHGGGKRCKFEGCGKSAQGSTDYCKAHGGGKRCSWGHPGSEYGNQPTGP  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG TLG +VQ+    ++E MKE+ T EDM  D   
Sbjct  536   CNSFARGKTGLCALHSGLVLDKRVHGGVTLGPMVQDPKISQSEKMKEVVTAEDMTIDIAK  595

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  S   S   +      F  ++ PI        SIPV + EGRV GGSL++M+A     
Sbjct  596   MGTSAAASTGRTTTDLKHFGDSSTPISVREAGLSSIPVFVSEGRVRGGSLMAMIAGGFGV  655

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
               SS++    +PSEPRK+Y+ HQ+WM
Sbjct  656   GSSSNQVVAGDPSEPRKSYVIHQNWM  681


 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 131/206 (64%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRC+   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  264   KLCQVEGCGKGARGASGRCISHGGGRRCRKAGCLKGAEGRTVYCKAHGGGRRCEFLGCTK  323

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  324   SAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  380

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC      S+  +G  P   F +G  
Sbjct  381   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCT-APGCSKGAEGSTP---FCKGHG  436

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  437   GGKRCAFQGGGVCTKSVHGGTNFCVA  462



>ref|XP_008336898.1| PREDICTED: uncharacterized protein LOC103456102 [Malus domestica]
 ref|XP_008337506.1| PREDICTED: uncharacterized protein LOC103456102 [Malus domestica]
Length=667

 Score =   420 bits (1080),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 219/322 (68%), Positives = 252/322 (78%), Gaps = 11/322 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTM+CKAHGGGKR
Sbjct  356   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAVGCTKGAQGSTMYCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC F+GGG C KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  416   CTAPGCTKGAEGSTPYCKGHGGGKRCAFEGGGHCTKSVHGGTNFCVAHGGGKRCAMPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P S FG +   P
Sbjct  476   KSARGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSVFGVQASAP  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG TLG +VQ+    ++E MKE+   +DM+ D M 
Sbjct  536   CNSFARGKTGLCALHSGLVLDKRVHGGITLGPMVQDPKLGKSEKMKEVVIADDMNVDVMN  595

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             +   + TSA G+   Y   K       G   S+P  +PEGRVHGGSL+++LA  S  + +
Sbjct  596   IVSGIRTSATGT---YSDLKH------GGQSSVPTLVPEGRVHGGSLMALLAGGSSDANT  646

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             +S G+ N S P+K+Y+ HQ+WM
Sbjct  647   NSMGS-NSSGPKKSYMMHQNWM  667


 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 112/161 (70%), Gaps = 3/161 (2%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  259   RSSNSKTCQVEGCGKGARGASGRCISHGGGRRCQRSGCHKGAEGRTVYCKAHGGGRRCEF  318

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  319   LGCTKSAEGRTDFCIAHGGGRRCSEEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  375

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
              G +  C+ HGGG+RCQ  GC K AQGST +CKAHGGGKRC
Sbjct  376   EGLSGLCISHGGGRRCQAVGCTKGAQGSTMYCKAHGGGKRC  416



>ref|XP_008239003.1| PREDICTED: uncharacterized protein LOC103337613 [Prunus mume]
Length=670

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 222/322 (69%), Positives = 252/322 (78%), Gaps = 12/322 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC FQGGG C KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  420   CTAPGCTKGAEGSTPYCKGHGGGKRCAFQGGGHCTKSVHGGTNFCVAHGGGKRCAMPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P S FG   I P
Sbjct  480   KSARGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSVFGGQAIGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    +++  KE+ T +DM+ D M 
Sbjct  540   CNSFARGKTGLCALHSGLVQDKRVHGGITLGPMVQDPKLGKSDKKKEVATADDMNVDVMN  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             +  S+ TSA G+        Q++ P+L         IPEGRVHGGSL+++LA  SD + +
Sbjct  600   IGSSIRTSATGTCSDMKQAGQSSAPVL---------IPEGRVHGGSLMALLAGGSDSNAN  650

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             S R   N S P+K+Y+  Q+WM
Sbjct  651   SRR--SNSSGPKKSYMMPQNWM  670


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 129/210 (61%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSSNSKTCQVEGCGKGARGASGRCISHGGGRRCQRSGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  380   EGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  438

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   CA  G     K VHGG    V 
Sbjct  439   HGGGKR--CAFQGGGHCTKSVHGGTNFCVA  466



>ref|XP_006385780.1| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
 ref|XP_002304530.2| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
 gb|ERP63577.1| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
 gb|EEE79509.2| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
Length=681

 Score =   419 bits (1076),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 221/326 (68%), Positives = 249/326 (76%), Gaps = 5/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GC+KGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCA  +CT
Sbjct  416   CTAPGCSKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAAPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRT FCVRHGGGKRC+FEGCGKSAQGSTD+CKAHGGGKRC WG   SE+G     P
Sbjct  476   KSARGRTQFCVRHGGGKRCKFEGCGKSAQGSTDYCKAHGGGKRCSWGHSGSEYGNQPTGP  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG TLG +VQ+    ++E MKE+ T EDM  D + 
Sbjct  536   CNSFARGKTGLCALHSGLVLDKRVHGGVTLGPMVQDPKISQSEKMKEVVTAEDMTIDIVK  595

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  S   S   +      F  ++ PI        SIPV + EGRV GGSL++M+A     
Sbjct  596   MGTSAAASTGRTTTDLKHFGDSSTPISVREAGLSSIPVFVSEGRVRGGSLMAMIAGGFGV  655

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
               SS++    +PSEP+K+Y+ HQ+WM
Sbjct  656   GSSSNQVVAGDPSEPKKSYVIHQNWM  681


 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 131/206 (64%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRC+   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  264   KLCQVEGCGKGARGASGRCISHGGGRRCRKAGCLKGAEGRTVYCKAHGGGRRCEFLGCTK  323

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  324   SAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  380

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC      S+  +G  P   F +G  
Sbjct  381   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCT-APGCSKGAEGSTP---FCKGHG  436

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  437   GGKRCAFQGGGVCTKSVHGGTNFCVA  462



>ref|XP_009786033.1| PREDICTED: uncharacterized protein LOC104234198 [Nicotiana sylvestris]
 ref|XP_009786034.1| PREDICTED: uncharacterized protein LOC104234198 [Nicotiana sylvestris]
Length=638

 Score =   416 bits (1069),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 246/314 (78%), Gaps = 14/314 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ ENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGST+FCKAHGGGKR
Sbjct  336   LCIRHGGGKRCQMENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKR  395

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGC KGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGTL+CVAHGGGKRCA  +C+
Sbjct  396   CIFEGCNKGAEGSTPFCKGHGGGKRCTFQGGGVCPKSVHGGTLFCVAHGGGKRCAFPECS  455

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+F+GCGKSAQGSTDFCKAHGGGKRC WGQP SEFG  + PC
Sbjct  456   RSARGRTDFCVRHGGGKRCKFDGCGKSAQGSTDFCKAHGGGKRCSWGQPGSEFGH-DNPC  514

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFARG T +  SHGAL+QDKRVHGGATLG VV + TP+    MKEI   +DM  D M +
Sbjct  515   NSFARGTTRV--SHGALMQDKRVHGGATLGAVVLDPTPQNLGKMKEIANVQDMYIDIMKM  572

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
               +++TS   + WK    K+   P+         ++ EGRVHGGSL+    +      + 
Sbjct  573   GNNILTS---TGWKSFELKEGNTPVG----GSSSSVSEGRVHGGSLM----AMLAGGSNC  621

Query  396   SRGTENPSEPRKAY  355
             +RGT   S P K +
Sbjct  622   TRGTMTTSAPGKPF  635


 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 133/218 (61%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+ G K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  239   RNSGIKQCQFKGCVKGARGASGLCIAHGGGRRCQKPGCHKGAEGRTAFCKAHGGGRRCEF  298

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC + +CTKSA
Sbjct  299   LGCTKSAEGRTDFCITHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQMENCTKSA  355

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  356   EGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKRCIFEG-----------CNKG  404

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG    V 
Sbjct  405   AEGSTPFCKGHGGGKRCTFQGGGVCPKSVHGGTLFCVA  442



>ref|XP_011026955.1| PREDICTED: uncharacterized protein LOC105127385 [Populus euphratica]
 ref|XP_011026956.1| PREDICTED: uncharacterized protein LOC105127385 [Populus euphratica]
 ref|XP_011026957.1| PREDICTED: uncharacterized protein LOC105127385 [Populus euphratica]
 ref|XP_011026958.1| PREDICTED: uncharacterized protein LOC105127385 [Populus euphratica]
Length=685

 Score =   417 bits (1071),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 250/326 (77%), Gaps = 5/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTM CKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMLCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTPFCKGHGGGKRCAFQGGGVCSKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDFCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGHLPSGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C SFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    ++E  KE+ T EDM  D + 
Sbjct  540   CTSFARGKTGLCALHSGLVQDKRVHGGVTLGPMVQDPKISQSEKTKEVITVEDMTVDIVK  599

Query  579   VERSVVTSA--NGSDWKYISFKQATMPILGS-PPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  S   S     SD K+     A +    +   S+PV + EGRVHGGSL++MLA  S  
Sbjct  600   MGTSARDSLGRTTSDLKHFGVSNAHLSASEAGLSSMPVFVSEGRVHGGSLMAMLAGGSGV  659

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
                S++    +P EPRK+Y+T Q+WM
Sbjct  660   GSCSNQIVAGDPPEPRKSYVTTQNWM  685


 Score =   188 bits (477),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSASSKLCQVEGCGKGARGASGRCISHGGGRRCQKAGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCSREG---CARAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF GC K AQGST  CKAHGGGKRC      ++  +G  P   F
Sbjct  380   EGLSGLCISHGGGRRCQFLGCTKGAQGSTMLCKAHGGGKRCT-APGCTKGAEGSTP---F  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  436   CKGHGGGKRCAFQGGGVCSKSVHGGTNFCVA  466


 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITQQQQPYQRSASSKLCQVEGCGKGARGASGRCISHGGGRRCQKAG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSREGCARAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390



>gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Erythranthe guttata]
Length=539

 Score =   412 bits (1058),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 250/321 (78%), Gaps = 18/321 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ +NC+KSAEGLSGLCISHGGGRRCQYP+C KGAQGSTMFCKAHGGGKR
Sbjct  237   LCIRHGGGKRCQVQNCSKSAEGLSGLCISHGGGRRCQYPECHKGAQGSTMFCKAHGGGKR  296

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST  CKGHGGGKRC FQGGG+CPKSVHGGTL+CVAHGGGKRCA+++CT
Sbjct  297   CTHPGCKKGAEGSTSLCKGHGGGKRCSFQGGGLCPKSVHGGTLFCVAHGGGKRCAISECT  356

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC++EGCGKSAQGSTDFCKAHG GKRC WG P SEFG G+ PC
Sbjct  357   RSARGRTDFCVRHGGGKRCKYEGCGKSAQGSTDFCKAHGDGKRCSWGSPGSEFGLGDNPC  416

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             N+FARGKTGLC SHGALVQD RVHGG T+G+VVQ+   K     K + T ED        
Sbjct  417   NTFARGKTGLCVSHGALVQDNRVHGGGTVGIVVQDFKAK-----KPVFTVEDGSV-----  466

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
                V+ SA+ S+  Y  ++   MP   +  S  V  PEGRVHGG+L+++LA     +  S
Sbjct  467   ---VMNSADCSN--YFGYQPTHMPSGSNRSSGKV--PEGRVHGGNLMALLAGGPGFNFPS  519

Query  396   SRGTENPSEPRKAYITHQSWM  334
                   PSEP K+++THQ+WM
Sbjct  520   GD-MAGPSEPEKSFVTHQTWM  539


 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 105/174 (60%), Gaps = 11/174 (6%)
 Frame = -3

Query  1233  GLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHG  1054
             G +  C +HGGGRRC++  CTK A+G T FC AHGGG+RC YE CT+ A G +  C  HG
Sbjct  183   GRTAFCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSYETCTRAARGKSGLCIRHG  242

Query  1053  GGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQF  874
             GGKRC  Q    C KS  G +  C++HGGG+RC   +C K A+G T FC  HGGGKRC  
Sbjct  243   GGKRCQVQN---CSKSAEGLSGLCISHGGGRRCQYPECHKGAQGSTMFCKAHGGGKRCTH  299

Query  873   EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              GC K A+GST  CK HGGGKRC +        +G   C     G T  C +HG
Sbjct  300   PGCKKGAEGSTSLCKGHGGGKRCSF--------QGGGLCPKSVHGGTLFCVAHG  345



>ref|XP_010261439.1| PREDICTED: uncharacterized protein LOC104600276 [Nelumbo nucifera]
 ref|XP_010261440.1| PREDICTED: uncharacterized protein LOC104600276 [Nelumbo nucifera]
Length=694

 Score =   414 bits (1064),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 213/301 (71%), Positives = 238/301 (79%), Gaps = 17/301 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+P CTKGAQGST+FCKAHGGGKR
Sbjct  362   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFPACTKGAQGSTVFCKAHGGGKR  421

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCAV +CT
Sbjct  422   CTVIGCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTRFCVAHGGGKRCAVPECT  481

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD+CVRHGGG+RC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  SEFG    PC
Sbjct  482   KSARGRTDYCVRHGGGRRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGQLGSEFGGQAAPC  541

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FARGKTGLCA+H ALVQD+RVHGG TL   V++    + E MK++ T++DM+ D   +
Sbjct  542   DRFARGKTGLCAAHNALVQDRRVHGGGTLAPKVEDPKLCKPEKMKQVVTSDDMNVDLRKL  601

Query  576   ERSVVTSANGSDWKYISFK-------------QATMPILG-SPPSIPVTIPEGRVHGGSL  439
             + S     N + W  I  K             Q + PIL  S P  PV++PEGRVHGGSL
Sbjct  602   DSS---EGNLTGWNAIYSKGYGHPAISLQLPSQVSHPILKVSAPPGPVSLPEGRVHGGSL  658

Query  438   L  436
             +
Sbjct  659   M  659


 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 122/192 (64%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ + C+K A G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  265   RSTSAKTCQFKGCSKGARGASGLCIAHGGGRRCQKVGCNKGAEGRTVYCKAHGGGRRCQF  324

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  325   LGCTKSAEGRTDYCIAHGGGRRCSHEG---CIRAARGKSGLCIRHGGGKRCQKENCTKSA  381

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC             I C   
Sbjct  382   EGLSGLCISHGGGRRCQFPACTKGAQGSTVFCKAHGGGKRCTV-----------IGCTKG  430

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  431   AEGSTPFCKGHG  442



>ref|XP_006476466.1| PREDICTED: uncharacterized protein LOC102631154 isoform X1 [Citrus 
sinensis]
 ref|XP_006476467.1| PREDICTED: uncharacterized protein LOC102631154 isoform X2 [Citrus 
sinensis]
Length=684

 Score =   414 bits (1063),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 253/325 (78%), Gaps = 4/325 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGST FCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTSFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGPQSTGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG VV +    + E MKE+ T +DM+ D M 
Sbjct  540   CNSFARGKTGLCALHSGLVQDKRVHGGFTLGPVVLDPNLHKPEKMKEVVTADDMNVDIMK  599

Query  579   VERSVVTSA-NGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsl  403
             +   + +SA   SD K+ +   +     G  PS+PV +PEGRVHGGSL++MLA +S  S 
Sbjct  600   MGSGLGSSAGKSSDSKHGASNVSDSVGGGGFPSVPVFVPEGRVHGGSLMAMLAGSSGVSS  659

Query  402   ssSRGTE--NPSEPRKAYITHQSWM  334
             +SS+     +P    K+ I  QSWM
Sbjct  660   NSSKVVVACDPLVTGKSSIMPQSWM  684


 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 130/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC Y
Sbjct  263   RSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLGCHKGAEGRTVYCKAHGGGRRCEY  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC     +    KG     SF
Sbjct  380   EGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKRCT----APGCTKGAEGSTSF  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  436   CKGHGGGKRCAFQGGGVCTKSVHGGTNFCVA  466


 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITQQHQRLQRSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTD+C+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEYLGCTKSAEGRTDYCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390



>gb|KHN16771.1| Putative WRKY transcription factor 19 [Glycine soja]
Length=682

 Score =   414 bits (1063),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 256/326 (79%), Gaps = 8/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAPGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC +QGGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  420   CTAPGCTKGAEGSTPYCKGHGGGKRCTYQGGGVCTKSVHGGTNFCVAHGGGKRCAVPGCT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G + + P
Sbjct  480   KSARGRTDHCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGIQQDGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG +LG VVQ+    + + +K++   ++MD D M 
Sbjct  540   CNSFARGKTGLCALHSGLVHDKRVHGGISLGSVVQDPHSSKADELKQVLVDKNMDIDMMK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  S+ T A  SD++   F+ AT  +    GS   +PV +PEGRVHGGSL++ML  +S  
Sbjct  600   IGSSLGT-ATCSDFE--QFEAATAHVSAKEGSHLPVPVAVPEGRVHGGSLMAMLTGSSSR  656

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
               SS RG   +PSEP K Y   QSW+
Sbjct  657   GSSSGRGLVGDPSEPIKGYAMPQSWI  682


 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  263   RPSNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCNHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  380   EGLSGLCISHGGGRRCQAPGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  438

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   C   G  V  K VHGG    V 
Sbjct  439   HGGGKR--CTYQGGGVCTKSVHGGTNFCVA  466



>ref|XP_006439437.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 ref|XP_006439438.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 gb|ESR52677.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
 gb|ESR52678.1| hypothetical protein CICLE_v10019140mg [Citrus clementina]
Length=684

 Score =   413 bits (1062),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 228/325 (70%), Positives = 252/325 (78%), Gaps = 4/325 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGST FCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTSFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGPQSTGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG VV +    + E MKE+ T +DM+ D M 
Sbjct  540   CNSFARGKTGLCALHSGLVQDKRVHGGFTLGPVVLDPNLHKPEKMKEVVTADDMNVDIMK  599

Query  579   VERSVVTSA-NGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsl  403
             +   + +SA   SD K+     +     G  PS+PV +PEGRVHGGSL++MLA +S  S 
Sbjct  600   MGSGLGSSAGKSSDSKHGVSNVSDSVGGGGFPSVPVFVPEGRVHGGSLMAMLAGSSGVSS  659

Query  402   ssSRGTE--NPSEPRKAYITHQSWM  334
             +SS+     +P    K+ I  QSWM
Sbjct  660   NSSKVVVACDPLVTGKSSIIPQSWM  684


 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 130/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC Y
Sbjct  263   RSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLGCHKGAEGRTVYCKAHGGGRRCEY  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC     +    KG     SF
Sbjct  380   EGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKRCT----APGCTKGAEGSTSF  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  436   CKGHGGGKRCAFQGGGVCTKSVHGGTNFCVA  466


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITQQHQRLQRSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTD+C+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEYLGCTKSAEGRTDYCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390



>ref|XP_003525359.1| PREDICTED: uncharacterized protein LOC100776565 isoform X1 [Glycine 
max]
 ref|XP_006580546.1| PREDICTED: uncharacterized protein LOC100776565 isoform X2 [Glycine 
max]
 gb|KHM99932.1| Putative WRKY transcription factor 19 [Glycine soja]
Length=683

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 220/324 (68%), Positives = 253/324 (78%), Gaps = 3/324 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQVPGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC +QGGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  420   CTAPGCTKGAEGSTPYCKGHGGGKRCTYQGGGVCTKSVHGGTNFCVAHGGGKRCAVPGCT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G + + P
Sbjct  480   KSARGRTDHCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGIQQDGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG +LG VVQ+    + + +K++   ++MD + M 
Sbjct  540   CNSFARGKTGLCALHSGLVHDKRVHGGISLGSVVQDPHSSKADELKQVLIDKNMDVNMMK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPIL-GSPPSIPVTIPEGRVHGGSLLsmlasnsdpsl  403
             +  S+  +A  SD++ +    A + +  G    + V +PEGRVHGGSL++ML  +S    
Sbjct  600   IGSSLGAAATCSDFEQLEAATAHVSVKEGGHLPMSVVVPEGRVHGGSLMAMLTGSSSRGS  659

Query  402   ssSRG-TENPSEPRKAYITHQSWM  334
             SS RG   +PSEP K Y   QSW+
Sbjct  660   SSGRGLVSDPSEPIKGYPMPQSWI  683


 Score =   190 bits (483),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 131/210 (62%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  263   RPGNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  380   EGLSGLCISHGGGRRCQVPGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  438

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   C   G  V  K VHGG    V 
Sbjct  439   HGGGKR--CTYQGGGVCTKSVHGGTNFCVA  466


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 85/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G           G  K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGLTQQQQPLHRPGNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC               C   A G +GLC SHG
Sbjct  367   GKRCQREN-----------CTKSAEGLSGLCISHG  390



>ref|XP_009620188.1| PREDICTED: loricrin-like isoform X2 [Nicotiana tomentosiformis]
Length=626

 Score =   409 bits (1051),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 241/314 (77%), Gaps = 34/314 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ ENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGST+FCKAHGGGKR
Sbjct  344   LCIRHGGGKRCQMENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKR  403

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGSTPFCKGHGGGKRC +QGGGVCPKSVHGGTL+CVAHGGGKRCA+ +C+
Sbjct  404   CTFEGCNKGAEGSTPFCKGHGGGKRCTYQGGGVCPKSVHGGTLFCVAHGGGKRCAMPECS  463

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC WGQP SEFG+ E P 
Sbjct  464   RSARGRTDFCVRHGGGKRCKFDSCGKSAQGSTDFCKAHGGGKRCSWGQPGSEFGQNESPF  523

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             NSFAR K+GLC SHGALVQDKRVHGGATLG VV + TPK                     
Sbjct  524   NSFARAKSGLCESHGALVQDKRVHGGATLGAVVLDSTPKNP-------------------  564

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslss  397
                         WKY  FK+   P+         ++ EGRVHGGSL++MLA  S  +L+S
Sbjct  565   -----------GWKYFEFKEGNTPVG----GSSSSVSEGRVHGGSLMAMLAGGSSHTLNS  609

Query  396   SRGTENPSEPRKAY  355
             SRGT   SEP K +
Sbjct  610   SRGTVTTSEPGKPF  623


 Score =   192 bits (489),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 133/218 (61%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+ G K+CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  247   RNSGIKQCQFKGCIKGARGASGLCIAHGGGRRCQKPGCHKGAEGRTAFCKAHGGGRRCEF  306

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC + +CTKSA
Sbjct  307   LGCTKSAEGRTDFCITHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQMENCTKSA  363

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             CN  
Sbjct  364   EGLSGLCISHGGGRRCQYPQCTKGAQGSTLFCKAHGGGKRCTFEG-----------CNKG  412

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG    V 
Sbjct  413   AEGSTPFCKGHGGGKRCTYQGGGVCPKSVHGGTLFCVA  450



>ref|XP_003533040.1| PREDICTED: uncharacterized protein LOC100784837 isoform 1 [Glycine 
max]
Length=682

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 255/326 (78%), Gaps = 8/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAPGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC +QGGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  420   CTAPGCTKGAEGSTPYCKGHGGGKRCTYQGGGVCTKSVHGGTNFCVAHGGGKRCAVPGCT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G + + P
Sbjct  480   KSARGRTDHCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGIQQDGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LV DKRVHGG +LG VVQ+    +T+ +K++   ++M  D M 
Sbjct  540   CNSFARGKTGLCALHSGLVHDKRVHGGISLGSVVQDPHSSKTDELKQVLVDKNMGIDMMK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLLsmlasnsdp  409
             +  S+ T A  SD++   F+ AT  +    GS   + V +PEGRVHGGSL++ML  +S  
Sbjct  600   IGSSLGT-ATCSDFE--QFEAATAHVSAKEGSHLPVSVAVPEGRVHGGSLMAMLTGSSSR  656

Query  408   slssSRGTE-NPSEPRKAYITHQSWM  334
               SS RG   +PSEP K Y   QSW+
Sbjct  657   GSSSGRGLVGDPSEPIKGYAMPQSWI  682


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  263   RPSNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCNHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  380   EGLSGLCISHGGGRRCQAPGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  438

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   C   G  V  K VHGG    V 
Sbjct  439   HGGGKR--CTYQGGGVCTKSVHGGTNFCVA  466



>ref|XP_004143880.1| PREDICTED: uncharacterized protein LOC101212238 [Cucumis sativus]
 ref|XP_004143881.1| PREDICTED: uncharacterized protein LOC101212238 [Cucumis sativus]
 ref|XP_011654712.1| PREDICTED: uncharacterized protein LOC101212238 [Cucumis sativus]
 gb|KGN50043.1| hypothetical protein Csa_5G151590 [Cucumis sativus]
Length=670

 Score =   405 bits (1042),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 245/322 (76%), Gaps = 12/322 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTM+CKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQTPGCTKGAQGSTMYCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGG+C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTPFCKGHGGGKRCGFQGGGICTKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE-IP  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGTQPCCP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGK GLCA H  LVQDKRVHGG ++G ++Q+    +TE MK I   + M+ D + 
Sbjct  540   CNSFARGKMGLCALHSGLVQDKRVHGGVSIGPIIQDPNLSKTEKMKGIVGEDYMNEDLIK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             V   V     G + ++ +  +A        PS  V  PEGRVHGGSLL+MLA +S    +
Sbjct  600   VGGKV-----GPNLEHFAGSEA------DKPSTSVLAPEGRVHGGSLLAMLACSSGLGST  648

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             S      P +P + +I  +SW+
Sbjct  649   SRNAVSGPDQPMEHHIMSRSWV  670


 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 130/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSSNSKICQVEGCGKGARGASGRCISHGGGRRCQKLGCHKGAEGRTVYCKAHGGGRRCQH  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDYCIAHGGGRRCNREG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST +CKAHGGGKRC      ++  +G  P   F
Sbjct  380   EGLSGLCISHGGGRRCQTPGCTKGAQGSTMYCKAHGGGKRCT-APGCTKGAEGSTP---F  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C   G  +  K VHGG    V 
Sbjct  436   CKGHGGGKRCGFQGGGICTKSVHGGTNFCVA  466



>ref|XP_008437353.1| PREDICTED: uncharacterized protein LOC103482798 [Cucumis melo]
 ref|XP_008437354.1| PREDICTED: uncharacterized protein LOC103482798 [Cucumis melo]
 ref|XP_008437355.1| PREDICTED: uncharacterized protein LOC103482798 [Cucumis melo]
Length=670

 Score =   405 bits (1041),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 245/322 (76%), Gaps = 12/322 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTM+CKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQTPGCTKGAQGSTMYCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGG+C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTPFCKGHGGGKRCGFQGGGICTKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE-IP  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGTQPCCP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGK GLCA H  LVQDKRVHGG ++G ++Q+    +TE MK I   + M+ D + 
Sbjct  540   CNSFARGKMGLCALHSGLVQDKRVHGGVSIGPIIQDPNLSKTEKMKGIVGEDYMNEDLIK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             V   V     G + +  +  +A        PS  V +PEGRVHGGSLL+MLA +S    +
Sbjct  600   VGGKV-----GPNLEQFAGSEA------DKPSTSVLVPEGRVHGGSLLAMLACSSGLGST  648

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             S      P +P + +I  +SW+
Sbjct  649   SRNAVSGPDQPMEHHIMPRSWV  670


 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSSNSKICQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCQH  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDYCIAHGGGRRCNREG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST +CKAHGGGKRC      ++  +G  P   F
Sbjct  380   EGLSGLCISHGGGRRCQTPGCTKGAQGSTMYCKAHGGGKRCT-APGCTKGAEGSTP---F  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C   G  +  K VHGG    V 
Sbjct  436   CKGHGGGKRCGFQGGGICTKSVHGGTNFCVA  466



>gb|KJB19070.1| hypothetical protein B456_003G083700 [Gossypium raimondii]
Length=611

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 247/329 (75%), Gaps = 20/329 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCT+SAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  295   LCIRHGGGKRCQKENCTRSAEGLSGLCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKR  354

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F+GGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  355   CTFLGCTKGAEGSTPFCKGHGGGKRCAFEGGGVCTKSVHGGTNFCVAHGGGKRCAVHQCT  414

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  415   KSARGRTDYCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQHSGP  474

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSF+RGKTGLCA H  LVQDKRVHGG T+G +V +    ++E MKEI T E M+ D M 
Sbjct  475   CNSFSRGKTGLCALHSGLVQDKRVHGGDTIGPIVHDPKLSKSEKMKEIVTPEVMNVDIM-  533

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVT------IPEGRVHGGSLLsmlasn  418
                      +G++       Q  +P   +P +  V       +PEGRVHGGSL++MLA  
Sbjct  534   --------GSGTEATCSGLNQHRVP---NPCNSSVEGGFSPFVPEGRVHGGSLMAMLAGG  582

Query  417   sdpslssSRGTE-NPSEPRKAYITHQSWM  334
             S     +  G   NPSEP K+++  Q WM
Sbjct  583   SGLGSGNCEGLAGNPSEPNKSHMAPQKWM  611


 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  203   KVCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  262

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  263   SAEGRTDFCIAHGGGRRCNHEG---CTRAARGKSGLCIRHGGGKRCQKENCTRSAEGLSG  319

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +    ++  +G  P   F +G  
Sbjct  320   LCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKRCTF-LGCTKGAEGSTP---FCKGHG  375

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  376   GGKRCAFEGGGVCTKSVHGGTNFCVA  401



>ref|XP_007211292.1| hypothetical protein PRUPE_ppa002459mg [Prunus persica]
 gb|EMJ12491.1| hypothetical protein PRUPE_ppa002459mg [Prunus persica]
Length=670

 Score =   405 bits (1040),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 230/288 (80%), Gaps = 10/288 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC FQGGG C KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  420   CTAPGCTKGAEGSTPYCKGHGGGKRCAFQGGGHCTKSVHGGTNFCVAHGGGKRCAMPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P S FG   I P
Sbjct  480   KSARGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSVFGGQAIGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    +++  KE+ T +DM+ D M 
Sbjct  540   CNSFARGKTGLCALHSGLVQDKRVHGGITLGPMVQDPKLGKSDKKKEVATADDMNVDVMN  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +  S+ TSA G+        Q++ P+L         IPEGRVHGGSL+
Sbjct  600   IGSSIRTSATGTCSDMKQAGQSSAPVL---------IPEGRVHGGSLM  638


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 129/210 (61%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSSNSKTCQVEGCGKGARGASGRCISHGGGRRCQKSGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  380   EGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  438

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   CA  G     K VHGG    V 
Sbjct  439   HGGGKR--CAFQGGGHCTKSVHGGTNFCVA  466



>gb|KHG18325.1| putative WRKY transcription factor 19 -like protein [Gossypium 
arboreum]
Length=676

 Score =   404 bits (1039),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 246/329 (75%), Gaps = 20/329 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCT+SAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTRSAEGLSGLCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F+GGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  420   CTFLGCTKGAEGSTPFCKGHGGGKRCAFEGGGVCTKSVHGGTNFCVAHGGGKRCAVPQCT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQHSGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSF+RGKTGLCA H  LVQDKRVHGG T+G +V +    + E MKEI T EDM+ D M 
Sbjct  540   CNSFSRGKTGLCALHSGLVQDKRVHGGDTIGPIVHDPKLSKPEKMKEIVTPEDMNVDIM-  598

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVT------IPEGRVHGGSLLsmlasn  418
                      +G++       Q  +P   +P +  V       +PEGRVHGGSL++MLA  
Sbjct  599   --------GSGTETTCSGLNQHRVP---NPCNSSVEGGFSPFVPEGRVHGGSLMAMLAGG  647

Query  417   sdpslssSRGTE-NPSEPRKAYITHQSWM  334
             S     +      NPSEP K+++  Q WM
Sbjct  648   SGLDSGNCEVLAGNPSEPNKSHMAPQKWM  676


 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  268   KVCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  327

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  328   SAEGRTDFCIAHGGGRRCNHEG---CTRAARGKSGLCIRHGGGKRCQKENCTRSAEGLSG  384

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +    ++  +G  P   F +G  
Sbjct  385   LCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKRCTF-LGCTKGAEGSTP---FCKGHG  440

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  441   GGKRCAFEGGGVCTKSVHGGTNFCVA  466



>gb|KJB19068.1| hypothetical protein B456_003G083700 [Gossypium raimondii]
 gb|KJB19069.1| hypothetical protein B456_003G083700 [Gossypium raimondii]
Length=676

 Score =   404 bits (1038),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 247/329 (75%), Gaps = 20/329 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCT+SAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTRSAEGLSGLCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F+GGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  420   CTFLGCTKGAEGSTPFCKGHGGGKRCAFEGGGVCTKSVHGGTNFCVAHGGGKRCAVHQCT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQHSGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSF+RGKTGLCA H  LVQDKRVHGG T+G +V +    ++E MKEI T E M+ D M 
Sbjct  540   CNSFSRGKTGLCALHSGLVQDKRVHGGDTIGPIVHDPKLSKSEKMKEIVTPEVMNVDIM-  598

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVT------IPEGRVHGGSLLsmlasn  418
                      +G++       Q  +P   +P +  V       +PEGRVHGGSL++MLA  
Sbjct  599   --------GSGTEATCSGLNQHRVP---NPCNSSVEGGFSPFVPEGRVHGGSLMAMLAGG  647

Query  417   sdpslssSRGTE-NPSEPRKAYITHQSWM  334
             S     +  G   NPSEP K+++  Q WM
Sbjct  648   SGLGSGNCEGLAGNPSEPNKSHMAPQKWM  676


 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  268   KVCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  327

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  328   SAEGRTDFCIAHGGGRRCNHEG---CTRAARGKSGLCIRHGGGKRCQKENCTRSAEGLSG  384

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +    ++  +G  P   F +G  
Sbjct  385   LCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKRCTF-LGCTKGAEGSTP---FCKGHG  440

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  441   GGKRCAFEGGGVCTKSVHGGTNFCVA  466


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITRQQQPQQRSSSSKVCQVEGCGKGARGASGRCISHGGGRRCQKPG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCNHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTRSAEGLSGLCISHG  390



>gb|KJB37515.1| hypothetical protein B456_006G208300 [Gossypium raimondii]
Length=682

 Score =   403 bits (1036),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 220/326 (67%), Positives = 247/326 (76%), Gaps = 8/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ ENCT+SAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQMENCTRSAEGLSGLCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y  CTKGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRC + +CT
Sbjct  420   CTYPRCTKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCVMPECT  479

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  480   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQPSGP  539

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CN FARGKTGLC  H +LVQDKRVHGGATLG +V++    ++  MKEI    D + D+  
Sbjct  540   CNYFARGKTGLCVLHSSLVQDKRVHGGATLGPIVEDQKLSKSGEMKEIVNAMDANVDTRN  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPS---IPVTIPEGRVHGGSLLsmlasnsdp  409
             +   V  SA+ S     S  Q  +P   +  S     V+ PEGRVHGGSLL+MLA  S  
Sbjct  600   IWSDVEASASTS---CSSLNQYGVPNACNSVSKGGFSVSAPEGRVHGGSLLAMLAGGSCV  656

Query  408   slssSRG-TENPSEPRKAYITHQSWM  334
               ++S G T NP+ P K+    Q+WM
Sbjct  657   GSANSAGFTGNPAGPNKSIKPPQNWM  682


 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 135/211 (64%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C + A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  263   RSSSSKTCQIEGCVRGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEF  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC + +CT+SA
Sbjct  323   LGCTKSAEGRTDFCIAHGGGRRCGHDG---CTRAARGKSGLCIRHGGGKRCQMENCTRSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC + +  ++  +G  P   F
Sbjct  380   EGLSGLCISHGGGRRCQFIGCTKGAQGSTMFCKAHGGGKRCTYPR-CTKGAEGSTP---F  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  436   CKGHGGGKRCAFQGGGVCTKSVHGGTNFCVA  466



>ref|XP_002297999.2| hypothetical protein POPTR_0001s10090g [Populus trichocarpa]
 gb|EEE82804.2| hypothetical protein POPTR_0001s10090g [Populus trichocarpa]
Length=655

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 217/323 (67%), Positives = 237/323 (73%), Gaps = 35/323 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTM CKAHGGGKR
Sbjct  366   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFSGCTKGAQGSTMLCKAHGGGKR  425

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQ GGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  426   CTAPGCTKGAEGSTPFCKGHGGGKRCAFQRGGVCSKSVHGGTNFCVAHGGGKRCAVPECT  485

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  486   KSARGRTDFCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNLPSGP  545

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C SFARGKTGLCA H  LVQDKRVHGG TLG +VQ+    ++E  KE+ T EDM  D + 
Sbjct  546   CTSFARGKTGLCALHSGLVQDKRVHGGVTLGPMVQDPKISQSEKTKEVVTVEDMTVDIVK  605

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             +                                 V + EGRVHGGSL++MLA  S     
Sbjct  606   M---------------------------------VFVSEGRVHGGSLMAMLAGGSGVGSC  632

Query  399   sSRGTE-NPSEPRKAYITHQSWM  334
             S++    +P EPRK+YIT Q+WM
Sbjct  633   SNQIVAGDPPEPRKSYITTQNWM  655


 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 126/218 (58%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  269   RSASSKLCQVEGCGKGARGASGRCISHGGGRRCQKAGCHKGAEGRTVYCKAHGGGRRCEF  328

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  329   LGCTKSAEGRTDFCIAHGGGRRCSREG---CARAARGKSGLCIRHGGGKRCQKENCTKSA  385

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF GC K AQGST  CKAHGGGKRC               C   
Sbjct  386   EGLSGLCISHGGGRRCQFSGCTKGAQGSTMLCKAHGGGKRCT-----------APGCTKG  434

Query  747   ARGKTGLCASHG---------ALVQDKRVHGGATLGVV  661
             A G T  C  HG           V  K VHGG    V 
Sbjct  435   AEGSTPFCKGHGGGKRCAFQRGGVCSKSVHGGTNFCVA  472


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  256   CTSGITQQQQPYQRSASSKLCQVEGCGKGARGASGRCISHGGGRRCQKAG---CHKGAEG  312

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  313   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSREGCARAARGKSGLCIRHGG  372

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  373   GKRCQ-----------KENCTKSAEGLSGLCISHG  396



>ref|XP_010106584.1| hypothetical protein L484_003082 [Morus notabilis]
 gb|EXC10838.1| hypothetical protein L484_003082 [Morus notabilis]
Length=664

 Score =   395 bits (1016),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 238/322 (74%), Gaps = 19/322 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  361   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQALGCTKGAQGSTMFCKAHGGGKR  420

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  421   CTAPGCTKGAEGSTPFCKGHGGGKRCAFQGGGVCSKSVHGGTNFCVAHGGGKRCAMPECT  480

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     P
Sbjct  481   KSARGRTDYCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQPTGP  540

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQ+   ++ E  KE+   EDM+ D   
Sbjct  541   CNSFARGKTGLCALHSGLVQDKRVHGGVTLGPLVQDPKHEKPEKTKEV-IAEDMNLDVTK  599

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             V  S           +   KQ       S  +   ++ EGRVHGGS    ++S    S S
Sbjct  600   VASS----------SFFDLKQ-------SGGASNFSVGEGRVHGGSHFVKVSSVLGASSS  642

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             +     + S+P K Y+  ++WM
Sbjct  643   AGVVISDSSKPMKPYMLPRNWM  664


 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K C+ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  264   RSTSSKTCEVEGCGKGARGASGRCISHGGGRRCQKQGCHKGAEGRTVYCKAHGGGRRCEF  323

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  324   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  380

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P   F
Sbjct  381   EGLSGLCISHGGGRRCQALGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTP---F  436

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  437   CKGHGGGKRCAFQGGGVCSKSVHGGTNFCVA  467



>ref|XP_004244623.1| PREDICTED: uncharacterized protein LOC101256504 [Solanum lycopersicum]
Length=663

 Score =   395 bits (1014),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 246/322 (76%), Gaps = 16/322 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCT+SAEGLSG CISHGGGRRCQYPQC+KGAQGSTMFCK HGGGKR
Sbjct  357   LCIRHGGGKRCQEENCTRSAEGLSGFCISHGGGRRCQYPQCSKGAQGSTMFCKGHGGGKR  416

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC KGAEGSTPFCKGHGGGKRC F+GGG+CPKSVHGGTL+CV HGGGKRCAV +C+
Sbjct  417   CTFEGCNKGAEGSTPFCKGHGGGKRCSFEGGGICPKSVHGGTLFCVKHGGGKRCAVPECS  476

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+F  C KSAQGSTDFCKAHG GKRC WGQP S F + +  C
Sbjct  477   KSARGRTNYCVRHGGGKRCKFIDCTKSAQGSTDFCKAHGSGKRCSWGQPDSGFSQNDSTC  536

Query  756   NSFARGKTGLCASHGALVQDKRVHGGA-TLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             +SFA+GK+GL  SHGAL QDKRVHGG  TLG    + TP     MKEID         M 
Sbjct  537   DSFAKGKSGLVESHGALEQDKRVHGGGDTLGASTLDSTPLNPGKMKEIDI--------MN  588

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
                +V+TS   + W Y  F QA+M    +      ++ EGRVHGGSL++MLA  S  +L+
Sbjct  589   TGSNVLTS---TGWNYFGFNQASM----AVGGSSSSVSEGRVHGGSLMAMLAGGSCHTLN  641

Query  399   sSRGTENPSEPRKAYITHQSWM  334
             SS GT   S+P K ++T ++W+
Sbjct  642   SSPGTATTSKPGKPFVTPKNWI  663


 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+CQ ++C K A G SG CI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +  CTK
Sbjct  265   KQCQFKDCVKGARGASGFCIAHGGGRRCQKPDCHKGAEGRTAFCKAHGGGRRCKFLDCTK  324

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  325   SAEGRTGFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQEENCTRSAEGLSG  381

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQ+  C K AQGST FCK HGGGKRC +             CN  A G T
Sbjct  382   FCISHGGGRRCQYPQCSKGAQGSTMFCKGHGGGKRCTFEG-----------CNKGAEGST  430

Query  732   GLCASHG  712
               C  HG
Sbjct  431   PFCKGHG  437



>ref|XP_004298851.1| PREDICTED: hornerin [Fragaria vesca subsp. vesca]
Length=674

 Score =   394 bits (1011),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 244/322 (76%), Gaps = 19/322 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  371   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKR  430

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC FQGGG C KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  431   CTAPGCTKGAEGSTPYCKGHGGGKRCAFQGGGHCTKSVHGGTNFCVAHGGGKRCAMPECT  490

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             KSARGRTD+CVRHGGGKRC++ GCGKSAQGSTDFCKAHGGGKRC WG P S +G+    P
Sbjct  491   KSARGRTDYCVRHGGGKRCKYSGCGKSAQGSTDFCKAHGGGKRCSWGHPGSVYGREAAGP  550

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQDKRVHGG TLG +VQE  PK  + ++E+D   +M+ D   
Sbjct  551   CNSFARGKTGLCALHSGLVQDKRVHGGVTLGTIVQE--PKFGKLVREVD---EMNVDDAM  605

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
                S+ T+A+GS     S  +     +G P    V +PEGRVHGGSL+++L+  S     
Sbjct  606   TNGSIATTASGS----CSGLKNGGSSVGQP---SVIVPEGRVHGGSLMALLSGGSGTVG-  657

Query  399   sSRGTENPSEPRKAYITHQSWM  334
                   + S P K Y+  ++WM
Sbjct  658   -----SDSSLPMKPYMMPKNWM  674


 Score =   184 bits (468),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 128/210 (61%), Gaps = 7/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC Y
Sbjct  274   RSSNSKTCQVEGCGKGARGASGRCISHGGGRRCQRAGCHKGAEGRTVYCKAHGGGRRCEY  333

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  334   LGCTKSAEGRTDFCIAHGGGRRCSHDG---CTRAARGKSGLCIRHGGGKRCQRENCTKSA  390

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C  
Sbjct  391   EGLSGLCISHGGGRRCQAIGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCKG  449

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   CA  G     K VHGG    V 
Sbjct  450   HGGGKR--CAFQGGGHCTKSVHGGTNFCVA  477



>ref|XP_007160125.1| hypothetical protein PHAVU_002G294600g [Phaseolus vulgaris]
 gb|ESW32119.1| hypothetical protein PHAVU_002G294600g [Phaseolus vulgaris]
Length=662

 Score =   393 bits (1010),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 203/289 (70%), Positives = 229/289 (79%), Gaps = 2/289 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  359   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQATGCTKGAQGSTMFCKAHGGGKR  418

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTP+CKGHGGGKRC +QGGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  419   CTAPGCTKGAEGSTPYCKGHGGGKRCTYQGGGVCTKSVHGGTNFCVAHGGGKRCAVPGCT  478

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+F  CGKSAQGSTDFCKAHGGGKRC WG P SE+G + + P
Sbjct  479   KSARGRTDHCVRHGGGKRCKFIECGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGIQQDGP  538

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTG+CA H  LV DKRVHGG +LG VVQ     +T+ +K++   ++MD D M 
Sbjct  539   CNSFARGKTGMCALHSGLVHDKRVHGGISLGSVVQNPHSSKTDELKQLLVDKNMDIDMMK  598

Query  579   VERSVVTSANGSDWKYISFKQATMPIL-GSPPSIPVTIPEGRVHGGSLL  436
             +  S+  +A  SD+K+     A +    G    + V +PEGRVHGGSL+
Sbjct  599   IGSSLGPAATCSDFKHYEAVTAHVSAKEGGHLPMSVAVPEGRVHGGSLM  647


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 131/211 (62%), Gaps = 7/211 (3%)
 Frame = -3

Query  1290  IRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCI  1111
             +R    K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC 
Sbjct  261   LRPSNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPGCLKGAEGRTVYCKAHGGGRRCE  320

Query  1110  YEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKS  931
             + GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKS
Sbjct  321   FLGCTKSAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKS  377

Query  930   ARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CN  754
             A G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P C 
Sbjct  378   AEGLSGLCISHGGGRRCQATGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTPYCK  436

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVV  661
                 GK   C   G  V  K VHGG    V 
Sbjct  437   GHGGGKR--CTYQGGGVCTKSVHGGTNFCVA  465



>ref|XP_011073481.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105158420 
[Sesamum indicum]
Length=634

 Score =   391 bits (1004),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 219/287 (76%), Gaps = 11/287 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIR GGGK CQKENCTKSAEG SGLCISHGGGRRCQYP+C KGAQGST FCKAHGGGKR
Sbjct  348   LCIRRGGGKWCQKENCTKSAEGASGLCISHGGGRRCQYPECNKGAQGSTAFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GC KGAEGST FCKGHGGGKRC FQGGG+CPKSVHGGTL+C+AHGGG RCAV +CT
Sbjct  408   CTYLGCNKGAEGSTLFCKGHGGGKRCFFQGGGICPKSVHGGTLFCMAHGGGGRCAVQECT  467

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCV HGGGKRC+ EGCGKSAQGS DFCKAHGGGKRC WG P  E G+     
Sbjct  468   KSARGRTDFCVHHGGGKRCKIEGCGKSAQGSNDFCKAHGGGKRCSWGPPGPELGEX----  523

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
                      LCA HG LVQDKRVHGGAT+G VVQ++  K++  +K+I T EDM  D   +
Sbjct  524   ---XXXNCXLCAYHGGLVQDKRVHGGATMGTVVQDLKVKQSAELKQISTIEDMSVDLTMI  580

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             E + ++S   S W Y S + A  P+  +P   P   PEGRVHGG+L+
Sbjct  581   ENNALSST--SSWNYFSLQHANSPVGSNPALSP--FPEGRVHGGNLM  623


 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 112/185 (61%), Gaps = 14/185 (8%)
 Frame = -3

Query  1266  CQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGA  1087
             CQ + C K A G SG CI+HGGG RCQ P C +GA+G    CKAHGGG +C   GCTK A
Sbjct  258   CQFQGCVKGARGASGFCIAHGGGHRCQRPGCQRGAEGQMASCKAHGGGLQCEILGCTKSA  317

Query  1086  EGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFC  907
             EG T FC  HGGG+ C  +G   C ++  G +  C+  GGGK C   +CTKSA G +  C
Sbjct  318   EGRTEFCIAHGGGRWCNHEG---CTRTARGKSGLCIRRGGGKWCQKENCTKSAEGASGLC  374

Query  906   VRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGL  727
             + HGGG+RCQ+  C K AQGST FCKAHGGGKRC +           + CN  A G T  
Sbjct  375   ISHGGGRRCQYPECNKGAQGSTAFCKAHGGGKRCTY-----------LGCNKGAEGSTLF  423

Query  726   CASHG  712
             C  HG
Sbjct  424   CKGHG  428



>ref|XP_010917189.1| PREDICTED: uncharacterized protein LOC105041837 [Elaeis guineensis]
 ref|XP_010917197.1| PREDICTED: uncharacterized protein LOC105041837 [Elaeis guineensis]
 ref|XP_010917204.1| PREDICTED: uncharacterized protein LOC105041837 [Elaeis guineensis]
Length=908

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 224/288 (78%), Gaps = 7/288 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEG SGLCISHGGGRRCQ+P C+KGAQGSTMFCKAHGGGKR
Sbjct  592   LCIRHGGGKRCQRENCTKSAEGYSGLCISHGGGRRCQFPGCSKGAQGSTMFCKAHGGGKR  651

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  652   CTFLGCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTQFCVAHGGGKRCAVPGCT  711

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  S  G G  PC
Sbjct  712   KSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGQVGSNLGAGAPPC  771

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
             + FARGKTGLCA+H ALVQD+ VHGG +LG+   Q  T  +TE MK+I   ED      T
Sbjct  772   DRFARGKTGLCAAHSALVQDRCVHGGGSLGLSATQYPTLVKTEKMKDIIVEED------T  825

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               +        + W     K   MP L       V++PEGRVHGGSLL
Sbjct  826   FSKIGNDGEKFAGWSDCDTKNNIMPHLLPCQPGSVSLPEGRVHGGSLL  873


 Score =   192 bits (489),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 123/187 (66%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  500   KTCQFQGCGKGARGASGLCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGRRCQHLGCTK  559

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  560   SAEGRTDYCIAHGGGRRCSHEG---CIRAARGKSGLCIRHGGGKRCQRENCTKSAEGYSG  616

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  617   LCISHGGGRRCQFPGCSKGAQGSTMFCKAHGGGKRCTF-----------LGCTKGAEGST  665

Query  732   GLCASHG  712
               C  HG
Sbjct  666   PFCKGHG  672


 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G+SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG RC + G TK
Sbjct  257   KTCQFQGCGKGARGVSGLCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGWRCQHLGSTK  316

Query  1092  GA-EGSTPFCKGHGGGKRCLF  1033
              A EG T +C  HG    C  
Sbjct  317   SADEGCTDYCIAHGSTTACTM  337


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ+  C KGA+G +  C AHGGG+RC   GC KGAEG T FCK HGGG RC  Q  G 
Sbjct  257   KTCQFQGCGKGARGVSGLCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGWRC--QHLGS  314

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
                +  G T YC+AHG     + T CT S+   TD
Sbjct  315   TKSADEGCTDYCIAHG-----STTACTMSSVKETD  344


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 93/207 (45%), Gaps = 27/207 (13%)
 Frame = -3

Query  1047  KRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEG  868
             K C FQG   C K   G +  C+AHGGG+RC    C K A GRT FC  HGGG RCQ  G
Sbjct  257   KTCQFQG---CGKGARGVSGLCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGWRCQHLG  313

Query  867   CGKSA-QGSTDFCKAHGGGKRCYWG-------QPSSEFG------KGEIPCNSFARGKTG  730
               KSA +G TD+C AHG    C          + S++ G       G+    S  +    
Sbjct  314   STKSADEGCTDYCIAHGSTTACTMSSVKETDEESSADLGLNFQLHLGDENMPSPKKSSVA  373

Query  729   LCASHGALVQDKRVHGGATLG---VVVQEITPKRTENMKEIDTTEDMDADSMTVERSVVT  559
               AS   L+ D ++  G + G    V+  I+P   +    +DT+  +      V+  + +
Sbjct  374   AQASGSELIYDLQL--GLSTGPSESVITGISPVSDQLQNSLDTSAVI-GQVPKVDEGLAS  430

Query  558   SANGSDWKYISFKQATMPILGSPPSIP  478
                 S W + S+   ++ I  +  S P
Sbjct  431   ----SRWIFGSYVAPSLYISETTSSFP  453


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = -3

Query  1122  KRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD  943
             K C ++GC KGA G +  C  HGGG+RC   G   C K   G T++C AHGGG RC    
Sbjct  257   KTCQFQGCGKGARGVSGLCIAHGGGRRCQRPG---CHKGAEGRTIFCKAHGGGWRCQHLG  313

Query  942   CTKSA-RGRTDFCVRHGGGKRCQFEGCGKSAQGST  841
              TKSA  G TD+C+ HG    C      ++ + S+
Sbjct  314   STKSADEGCTDYCIAHGSTTACTMSSVKETDEESS  348


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGA-QGSTMFCKAHGGGK  1120
             LCI HGGG+RCQ+  C K AEG +  C +HGGG RCQ+   TK A +G T +C AHG   
Sbjct  274   LCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGWRCQHLGSTKSADEGCTDYCIAHGSTT  333

Query  1119  RCIYEGCTKGAEGST  1075
              C      +  E S+
Sbjct  334   ACTMSSVKETDEESS  348



>ref|XP_010053188.1| PREDICTED: uncharacterized protein LOC104441699 [Eucalyptus grandis]
 gb|KCW77454.1| hypothetical protein EUGRSUZ_D01792 [Eucalyptus grandis]
Length=670

 Score =   389 bits (1000),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 233/323 (72%), Gaps = 10/323 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRC Y  CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCHYTGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCA+ +CT
Sbjct  416   CTFVGCNKGAEGSTPFCKGHGGGKRCAFQGGGVCSKSVHGGTNFCVAHGGGKRCAMPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-P  760
             +SARGRT+FCVRHGGGKRC+  GC KSAQGSTD+CKAHGGGKRC WGQP SEFG      
Sbjct  476   RSARGRTNFCVRHGGGKRCKSHGCSKSAQGSTDYCKAHGGGKRCSWGQPGSEFGDQNTGS  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             CNSFARGKTGLCA H  LVQD+RVHGG ++G ++Q     + E M+E+  TEDM+ D   
Sbjct  536   CNSFARGKTGLCALHSGLVQDRRVHGGLSVGPILQGQKVTQPEEMEEVVNTEDMNID---  592

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
                  V +    D        + +PI  SP        EGRVHGGSL++ML         
Sbjct  593   -----VGNICNLDLNQFEPGSSKLPIAQSPSDSSTVASEGRVHGGSLMAMLNGGIALGSD  647

Query  399   sSRGTE-NPSEPRKAYITHQSWM  334
               +  E +  E  K+ +  + W+
Sbjct  648   KDKSLESDEPETGKSLVVPRRWI  670


 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 128/218 (59%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  259   RSSASKLCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEF  318

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  319   LGCTKSAEGRTDLCIAHGGGRRCTRDG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  375

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RC + GC K AQGST FCKAHGGGKRC +           + CN  
Sbjct  376   EGLSGLCISHGGGRRCHYTGCTKGAQGSTMFCKAHGGGKRCTF-----------VGCNKG  424

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG    V 
Sbjct  425   AEGSTPFCKGHGGGKRCAFQGGGVCSKSVHGGTNFCVA  462



>ref|XP_010676385.1| PREDICTED: uncharacterized protein LOC104892219 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676386.1| PREDICTED: uncharacterized protein LOC104892219 [Beta vulgaris 
subsp. vulgaris]
Length=641

 Score =   387 bits (995),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 233/291 (80%), Gaps = 18/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCT+SAEGLSGLCISHGGGRRCQ+P+C KGAQGSTMFCKAHGGGKR
Sbjct  359   LCIRHGGGKRCQRENCTRSAEGLSGLCISHGGGRRCQHPECNKGAQGSTMFCKAHGGGKR  418

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C  EGCT+GAEGSTPFCKGHGGGKRC F G   CPKSVHGGT +CVAHGGGKRCAVT CT
Sbjct  419   CTVEGCTRGAEGSTPFCKGHGGGKRCSFPG---CPKSVHGGTSFCVAHGGGKRCAVTGCT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTDFCVRHGGGKRC+F+GCGKSAQGSTDFCKAHGGGKRC WGQ  S +G + + P
Sbjct  476   KSARGRTDFCVRHGGGKRCKFDGCGKSAQGSTDFCKAHGGGKRCAWGQSESPYGNQADGP  535

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEID-TTEDMDADSM  583
             C SFARGKTGLCA HGALVQDKRVHGG TLG ++Q+  P  T   K +D +T  M  D+M
Sbjct  536   CGSFARGKTGLCAMHGALVQDKRVHGGFTLGPLLQD--PDFTNPGKRMDASTGVMSVDAM  593

Query  582   TVERSVVTSAN--GSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              +E + + +     SD  +   ++ ++    SPPS     PEGRVHGGSL+
Sbjct  594   GLELTGINAVGWPASDMMHTQVQRESL----SPPS-----PEGRVHGGSLM  635


 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 123/210 (59%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SGLCI+HGGGRRCQ P C KGA+G T  CKAHGGG+RC + GCTK
Sbjct  267   KLCQFNGCEKGARGASGLCIAHGGGRRCQRPGCNKGAEGRTALCKAHGGGRRCEFLGCTK  326

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  327   SAEGRTDFCIAHGGGRRC---GHDNCSRAARGKSGLCIRHGGGKRCQRENCTRSAEGLSG  383

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST FCKAHGGGKRC               C   A G T
Sbjct  384   LCISHGGGRRCQHPECNKGAQGSTMFCKAHGGGKRCTVEG-----------CTRGAEGST  432

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C  HG   +       K VHGG +  V 
Sbjct  433   PFCKGHGGGKRCSFPGCPKSVHGGTSFCVA  462



>ref|XP_010533616.1| PREDICTED: uncharacterized protein LOC104809354 [Tarenaya hassleriana]
Length=662

 Score =   387 bits (995),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/291 (69%), Positives = 227/291 (78%), Gaps = 5/291 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ+ +CTKGAQGSTMFCKAHGGGKR
Sbjct  353   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQFIECTKGAQGSTMFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGG-GVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             C Y GC+KGAEGSTPFCKGHGGGKRC FQGG GVC KSVHGGT +CVAHGGGKRCAV  C
Sbjct  413   CTYPGCSKGAEGSTPFCKGHGGGKRCAFQGGDGVCSKSVHGGTNFCVAHGGGKRCAVPGC  472

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEI  763
             TKSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P +E+  +   
Sbjct  473   TKSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCAWGHPGTEYANQSSG  532

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSM  583
             PC SFARGKTGLCA H +LV DKRVHGG +L  V+Q+     TE  +E   ++DM+ D +
Sbjct  533   PCCSFARGKTGLCALHSSLVDDKRVHGGISLSSVIQDPKLSETETTEEFSVSQDMNIDVL  592

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSP--PSIPVTIPEGRVHGGSLL  436
              +  +V +         +   +A +P  G     S    +PEGRVHGGSL+
Sbjct  593   KMGTAVRSPGCKPCINILGDYEA-LPDAGKAGSSSTSAAVPEGRVHGGSLM  642


 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 129/214 (60%), Gaps = 24/214 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  261   KLCQVEGCQKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  320

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  321   SAEGRTDFCIAHGGGRRCNHEG---CSRAARGKSGLCIRHGGGKRCQRENCTKSAEGLSG  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +  P          C+  A G T
Sbjct  378   LCISHGGGRRCQFIECTKGAQGSTMFCKAHGGGKRCTY--PG---------CSKGAEGST  426

Query  732   GLCASHGA----------LVQDKRVHGGATLGVV  661
               C  HG            V  K VHGG    V 
Sbjct  427   PFCKGHGGGKRCAFQGGDGVCSKSVHGGTNFCVA  460



>ref|XP_008778495.1| PREDICTED: uncharacterized protein LOC103698281 [Phoenix dactylifera]
 ref|XP_008778496.1| PREDICTED: uncharacterized protein LOC103698281 [Phoenix dactylifera]
 ref|XP_008778497.1| PREDICTED: uncharacterized protein LOC103698281 [Phoenix dactylifera]
 ref|XP_008778498.1| PREDICTED: uncharacterized protein LOC103698281 [Phoenix dactylifera]
Length=668

 Score =   387 bits (994),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 206/288 (72%), Positives = 220/288 (76%), Gaps = 7/288 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ ENCTKSAEG SGLCISHGGGRRCQ+  C+KGAQGSTMFCKAHGGGKR
Sbjct  352   LCIRHGGGKRCQMENCTKSAEGYSGLCISHGGGRRCQFSGCSKGAQGSTMFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  412   CTFLGCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTQFCVAHGGGKRCAVPGCT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  S  G G  PC
Sbjct  472   KSARGRTDFCVRHGGGKRCRFEGCGKSAQGSTDFCKAHGGGKRCSWGQLGSNVGAGAPPC  531

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI-TPKRTENMKEIDTTEDMDADSMT  580
             + FARGKTGLCA+H ALVQD+ VHGG +LG       T  +TE MK+I   E+      T
Sbjct  532   DRFARGKTGLCAAHSALVQDRCVHGGGSLGPSADRCPTLVKTEKMKDITVEEN------T  585

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               +      N   W     K   MP L    S   +IPEGRVHGGSLL
Sbjct  586   FSKIGNDGENFVHWSGCDTKNNIMPHLIPCQSGSDSIPEGRVHGGSLL  633


 Score =   193 bits (491),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 123/187 (66%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  260   KTCQFQGCGKGARGASGLCIAHGGGRRCQRPGCHKGAEGRTIFCKAHGGGRRCQYLGCTK  319

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   C ++  G +  C+ HGGGKRC + +CTKSA G + 
Sbjct  320   SAEGRTDYCIAHGGGRRC---GHESCTRAARGKSGLCIRHGGGKRCQMENCTKSAEGYSG  376

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  377   LCISHGGGRRCQFSGCSKGAQGSTMFCKAHGGGKRCTF-----------LGCTKGAEGST  425

Query  732   GLCASHG  712
               C  HG
Sbjct  426   PFCKGHG  432


 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 85/149 (57%), Gaps = 14/149 (9%)
 Frame = -3

Query  1158  GSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCV  979
             G T+  +     K C ++GC KGA G++  C  HGGG+RC   G   C K   G T++C 
Sbjct  248   GVTLLQQRDTTTKTCQFQGCGKGARGASGLCIAHGGGRRCQRPG---CHKGAEGRTIFCK  304

Query  978   AHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW  799
             AHGGG+RC    CTKSA GRTD+C+ HGGG+RC  E C ++A+G +  C  HGGGKRC  
Sbjct  305   AHGGGRRCQYLGCTKSAEGRTDYCIAHGGGRRCGHESCTRAARGKSGLCIRHGGGKRCQM  364

Query  798   GQPSSEFGKGEIPCNSFARGKTGLCASHG  712
                          C   A G +GLC SHG
Sbjct  365   EN-----------CTKSAEGYSGLCISHG  382



>ref|XP_003634111.1| PREDICTED: uncharacterized protein LOC100241527 [Vitis vinifera]
Length=702

 Score =   385 bits (988),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 242/326 (74%), Gaps = 7/326 (2%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ ENCT+SAEG SGLCISHGGGRRCQYP+CTKGAQGSTMFCKAHGGGKR
Sbjct  354   LCIRHGGGKRCRMENCTRSAEGFSGLCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGKR  413

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGTL+CVAHGGGKRCA+ +CT
Sbjct  414   CTAPGCTKGAEGSTPFCKGHGGGKRCTFQGG--CTKSVHGGTLFCVAHGGGKRCAIPECT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRT FCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGG+RC WG P S FG +   P
Sbjct  472   KSARGRTAFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGRRCSWGVPGSGFGDQTTTP  531

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C+ FARGKTGLCA+HGA VQDKRVHGG+TL   +Q   P+ T  MK I T+E++ A+ MT
Sbjct  532   CDKFARGKTGLCANHGAQVQDKRVHGGSTLDPTLQGPKPRMTGKMKNIVTSENVGAEVMT  591

Query  579   VERSVVTSANGSDWKYISFKQAT-MPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsl  403
                S       + +    F  +  MP   +   + +++PEGRVHGGSL++ML        
Sbjct  592   TVGSGGKLLGVNYFGSPGFGHSMQMPTQDNAGPVQISLPEGRVHGGSLMAMLRGGIGGVG  651

Query  402   ssSRGTEN---PSEPRKAYITHQSWM  334
             ++S   +    PS   K+Y     WM
Sbjct  652   AASSSNQAVCCPSVQGKSYTLPLGWM  677



>ref|XP_010055802.1| PREDICTED: uncharacterized protein LOC104443941 [Eucalyptus grandis]
 gb|KCW72353.1| hypothetical protein EUGRSUZ_E00807 [Eucalyptus grandis]
Length=677

 Score =   384 bits (986),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 222/291 (76%), Gaps = 4/291 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQKE CTKSAEGLSGLCISHGGGRRCQ   C+KGAQGST+FCKAHGGGKR
Sbjct  353   LCIKHGGGKRCQKEGCTKSAEGLSGLCISHGGGRRCQSIGCSKGAQGSTLFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GCTKGAEGSTPFCKGHGGGKRC  QGGGVC KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  413   CTYAGCTKGAEGSTPFCKGHGGGKRCSHQGGGVCTKSVHGGTAFCVAHGGGKRCAVPGCT  472

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEF-GKGEIP  760
             KSARGRTD CVRHGGGKRCQ  GC KSAQGSTDFCKAHGGGKRC WG P S F G+G  P
Sbjct  473   KSARGRTDSCVRHGGGKRCQAAGCSKSAQGSTDFCKAHGGGKRCAWGHPRSGFGGEGSSP  532

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C +FARGKTGLCA H  LVQD+RVHG   +G +VQ  T  + E  KE  TTE M  D   
Sbjct  533   CTAFARGKTGLCALHSGLVQDRRVHGAMVVGTMVQSPTVTQLEKAKETVTTESMSIDVTR  592

Query  579   VERSVVTSANG--SDWKYISFKQATMPIL-GSPPSIPVTIPEGRVHGGSLL  436
             +  S VTS+    S  +      A  P+  G   S+ V++PEGRVHGGSL+
Sbjct  593   ITGSEVTSSGTAYSGLQPYGLGNAHYPVTDGGLSSMSVSVPEGRVHGGSLM  643


 Score =   187 bits (474),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 130/206 (63%), Gaps = 8/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T+FCKAHGGG+RC   GCTK
Sbjct  260   KICQVEGCGKGARGASGRCISHGGGRRCQRPGCPKGAEGRTVFCKAHGGGRRCESLGCTK  319

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   GG  C ++  G +  C+ HGGGKRC    CTKSA G + 
Sbjct  320   SAEGRTDYCIAHGGGRRCSHAGG--CTRAARGKSGLCIKHGGGKRCQKEGCTKSAEGLSG  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC +    ++  +G  P   F +G  
Sbjct  378   LCISHGGGRRCQSIGCSKGAQGSTLFCKAHGGGKRCTYAG-CTKGAEGSTP---FCKGHG  433

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   C+  G  V  K VHGG    V 
Sbjct  434   GGKRCSHQGGGVCTKSVHGGTAFCVA  459



>ref|XP_010915741.1| PREDICTED: uncharacterized protein LOC105040762 [Elaeis guineensis]
 ref|XP_010915742.1| PREDICTED: uncharacterized protein LOC105040762 [Elaeis guineensis]
 ref|XP_010915743.1| PREDICTED: uncharacterized protein LOC105040762 [Elaeis guineensis]
 ref|XP_010915744.1| PREDICTED: uncharacterized protein LOC105040762 [Elaeis guineensis]
 ref|XP_010915745.1| PREDICTED: uncharacterized protein LOC105040762 [Elaeis guineensis]
Length=661

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 201/288 (70%), Positives = 223/288 (77%), Gaps = 10/288 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEG SGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  348   LCIRHGGGKRCQRENCTKSAEGQSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F GG  C KSVHGGTL+CVAHGGGKRCA  +CT
Sbjct  408   CTFPGCTKGAEGSTPFCKGHGGGKRCAFLGG--CSKSVHGGTLFCVAHGGGKRCAAPECT  465

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT+FCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  S FG G  PC
Sbjct  466   KSARGRTNFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGQAGSVFGAGCPPC  525

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE-ITPKRTENMKEIDTTEDMDADSMT  580
             + FARGK GLCA+H A V+D RVHGG  LG V     +P ++E MK +   +DM  +  T
Sbjct  526   DRFARGKIGLCAAHTAQVEDHRVHGGHVLGAVTALCSSPIKSEKMKRVVVDQDMFTNMET  585

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               +S +T      W  +  K A  P+      + V + EGRVHGGSL+
Sbjct  586   STQSQLT------WSGLDQKSAMHPVNPLHSGV-VPLSEGRVHGGSLM  626


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 128/211 (61%), Gaps = 21/211 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             + CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC Y GCTK
Sbjct  256   RNCQFQGCGKGARGASGLCIAHGGGRRCQRPGCHKGAEGKTIYCKAHGGGRRCQYLGCTK  315

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  316   SAEGRTDYCIAHGGGRRCSHGG---CTRAARGKSGLCIRHGGGKRCQRENCTKSAEGQSG  372

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  373   LCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------PGCTKGAEGST  421

Query  732   GLCASHGALVQ-------DKRVHGGATLGVV  661
               C  HG   +        K VHGG    V 
Sbjct  422   PFCKGHGGGKRCAFLGGCSKSVHGGTLFCVA  452



>ref|XP_010924791.1| PREDICTED: uncharacterized protein LOC105047534 [Elaeis guineensis]
 ref|XP_010924792.1| PREDICTED: uncharacterized protein LOC105047534 [Elaeis guineensis]
 ref|XP_010924793.1| PREDICTED: uncharacterized protein LOC105047534 [Elaeis guineensis]
 ref|XP_010924794.1| PREDICTED: uncharacterized protein LOC105047534 [Elaeis guineensis]
Length=669

 Score =   382 bits (981),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 225/294 (77%), Gaps = 20/294 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E+CTKSAEG SGLCISHGGGRRCQ+  C+KGAQGSTM CKAHGGGKR
Sbjct  354   LCIRHGGGKRCQREHCTKSAEGFSGLCISHGGGRRCQFLGCSKGAQGSTMLCKAHGGGKR  413

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  414   CTFLGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTQFCVAHGGGKRCAVPGCT  473

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGK C WG   S FG G +PC
Sbjct  474   KSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKCCSWGHVGSNFGVGALPC  533

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG-VVVQEITPKRTENMKEIDTTEDM------  598
             + FARGK GLC +H ALVQD  VHGG+TLG  V+Q  T  +TE MK+I   ED+      
Sbjct  534   DRFARGKIGLCTAHTALVQDHCVHGGSTLGSSVMQCPTLVKTEKMKDITVEEDVLSRIGE  593

Query  597   DADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             D DS           NGSD K I      M  L    S   ++PEGRV GGSL+
Sbjct  594   DGDSF-------VGWNGSDMKNI------MAHLIPCRSGSASLPEGRVRGGSLM  634


 Score =   190 bits (482),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  262   KTCQYQGCGKGARGASGLCIAHGGGRRCQRPGCYKGAEGRTIFCKAHGGGRRCQYLGCTK  321

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +    C ++  G +  C+ HGGGKRC    CTKSA G + 
Sbjct  322   SAEGRTDYCIAHGGGRRCSHES---CTRAARGKSGLCIRHGGGKRCQREHCTKSAEGFSG  378

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST  CKAHGGGKRC +           + C   A G T
Sbjct  379   LCISHGGGRRCQFLGCSKGAQGSTMLCKAHGGGKRCTF-----------LGCTKGAEGST  427

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
               C  HG     L Q      K VHGG    V 
Sbjct  428   PFCKGHGGGKRCLFQGGGVCPKSVHGGTQFCVA  460



>ref|XP_006352259.1| PREDICTED: uncharacterized protein LOC102589461 isoform X1 [Solanum 
tuberosum]
 ref|XP_006352260.1| PREDICTED: uncharacterized protein LOC102589461 isoform X2 [Solanum 
tuberosum]
Length=626

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 220/288 (76%), Gaps = 26/288 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENC +SAEGLSG CISHGGGRRCQYPQC+KGAQGSTMFCK HGGGKR
Sbjct  357   LCIRHGGGKRCQEENCIRSAEGLSGFCISHGGGRRCQYPQCSKGAQGSTMFCKGHGGGKR  416

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGC +GAEGSTPFCKGHGGGKRC F+GGG+CPKSVHGGTL+CV HGGGKRCA+ +C+
Sbjct  417   CTFEGCNRGAEGSTPFCKGHGGGKRCSFEGGGICPKSVHGGTLFCVRHGGGKRCAIPECS  476

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD+CVRHGGGKRC+F  CGKSAQGSTDFCKAHG GKRC WGQP S FG+ + PC
Sbjct  477   KSARGRTDYCVRHGGGKRCKFVDCGKSAQGSTDFCKAHGSGKRCSWGQPDSGFGQMDSPC  536

Query  756   NSFARGKTGLCASHGALVQDKRVHGGA-TLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             NSFA+GK+GL  SH  + QDKRVHGG  TLG  + + TP     MKEID           
Sbjct  537   NSFAKGKSGLVESH--VEQDKRVHGGGDTLGAAILDSTPLNPGKMKEIDIMN--------  586

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                        + WKY  F QA+MP+         ++ EGRVHGGSL+
Sbjct  587   -----------TGWKYFGFNQASMPVG----GSSSSVSEGRVHGGSLM  619


 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 122/192 (64%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R  G K+CQ ++C K A G SG CI+HGGGRRCQ P C KGA+G T FCKAHGGG+RC +
Sbjct  260   RGSGIKQCQFKDCIKGARGASGFCIAHGGGRRCQKPDCHKGAEGRTAFCKAHGGGRRCGF  319

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
               CTK AEG T FC  HGGG+RC ++    C ++  G +  C+ HGGGKRC   +C +SA
Sbjct  320   LDCTKSAEGRTGFCIAHGGGRRCSYED---CTRAARGKSGLCIRHGGGKRCQEENCIRSA  376

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G + FC+ HGGG+RCQ+  C K AQGST FCK HGGGKRC +             CN  
Sbjct  377   EGLSGFCISHGGGRRCQYPQCSKGAQGSTMFCKGHGGGKRCTFEG-----------CNRG  425

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  426   AEGSTPFCKGHG  437



>ref|XP_010925805.1| PREDICTED: uncharacterized protein LOC105048248 [Elaeis guineensis]
 ref|XP_010925806.1| PREDICTED: uncharacterized protein LOC105048248 [Elaeis guineensis]
Length=661

 Score =   376 bits (965),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 219/288 (76%), Gaps = 10/288 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEG SGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  348   LCIRHGGGKRCQRENCTKSAEGQSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCT+GAEGST FCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCA  +CT
Sbjct  408   CTFPGCTRGAEGSTLFCKGHGGGKRCAFQGG--CSKSVHGGTQFCVAHGGGKRCAAPECT  465

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  S FG G  PC
Sbjct  466   KSARGRTDFCVRHGGGKRCKFEGCVKSAQGSTDFCKAHGGGKRCAWGQAGSVFGAGSPPC  525

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG-VVVQEITPKRTENMKEIDTTEDMDADSMT  580
             + FARGK GLCA+H A ++D ++HGG  LG V  Q   P ++E MKE+   +DM +    
Sbjct  526   DHFARGKIGLCAAHTAQIEDHQIHGGHILGAVTAQYPAPSKSEKMKEVVVDQDMFSKMGA  585

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                S ++      W  +  +    P       + +++PEGRVHGG L+
Sbjct  586   GRESQLS------WSRLDQRTLMHPAYPLHSGV-ISLPEGRVHGGRLM  626


 Score =   182 bits (461),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 128/211 (61%), Gaps = 21/211 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+ + C K A G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC Y GCT+
Sbjct  256   KNCRFQGCGKGARGASGLCIAHGGGRRCQRTGCHKGAEGRTIYCKAHGGGRRCQYLGCTR  315

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  316   SAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTKSAEGQSG  372

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  373   LCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------PGCTRGAEGST  421

Query  732   GLCASHGALVQ-------DKRVHGGATLGVV  661
               C  HG   +        K VHGG    V 
Sbjct  422   LFCKGHGGGKRCAFQGGCSKSVHGGTQFCVA  452



>ref|XP_006391666.1| hypothetical protein EUTSA_v10023333mg [Eutrema salsugineum]
 gb|ESQ28952.1| hypothetical protein EUTSA_v10023333mg [Eutrema salsugineum]
Length=654

 Score =   375 bits (964),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 217/292 (74%), Gaps = 18/292 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQANGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  416   CTHAGCTKGAEGSTPFCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P +E+       
Sbjct  476   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAGQSSSG  535

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTE---NMKEIDTTEDMDA  592
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  P  +E     +E   ++DM+ 
Sbjct  536   PCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRPSSSETENESQEFSGSQDMNI  595

Query  591   DSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             DSM        SA GS    I   +    +           PEGRVHGGSL+
Sbjct  596   DSMKAR-----SAVGSPETDIDLNEYEAGL--------GLAPEGRVHGGSLI  634


 Score =   184 bits (466),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  264   KLCQIEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  323

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  324   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  380

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  381   LCISHGGGRRCQANGCTKGAQGSTMFCKAHGGGKRCTHAGCTKGAEGSTPFCKGHGGGKR  440

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  441   CAFQGGDPCSKSVHGGTNFCVAHG  464


 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 14/143 (10%)
 Frame = -3

Query  1140  KAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGK  961
             K+    K C  EGC KGA G++  C  HGGG+RC   G   C K   G T+YC AHGGG+
Sbjct  258   KSSSSSKLCQIEGCQKGARGASGRCISHGGGRRCQKHG---CHKGAEGRTVYCKAHGGGR  314

Query  960   RCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSE  781
             RC    CTKSA GRTDFC+ HGGG+RC  E C ++A+G +  C  HGGGKRC        
Sbjct  315   RCEFLGCTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQREN----  370

Query  780   FGKGEIPCNSFARGKTGLCASHG  712
                    C   A G +GLC SHG
Sbjct  371   -------CTKSAEGLSGLCISHG  386



>ref|XP_008794859.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103710723 
[Phoenix dactylifera]
Length=662

 Score =   374 bits (959),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 218/289 (75%), Gaps = 12/289 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC++ENCTKSAEG SGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  349   LCIRHGGGKRCRRENCTKSAEGQSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRC+  +CT
Sbjct  409   CTFPGCTKGAEGSTPFCKGHGGGKRCAFQGG--CSKSVHGGTQFCVAHGGGKRCSAPECT  466

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  S FG    PC
Sbjct  467   KSARGRTDFCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCAWGQAGSVFGAVAPPC  526

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI-TPKRTENMKEIDTTEDMDADSMT  580
             +  ARGK GLCA+H A V+D +VH G  LG        P ++E MKE+   +DM      
Sbjct  527   DRLARGKIGLCAAHTAQVEDHQVHSGRILGAAAARFPAPSKSEKMKEVIVDQDM------  580

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSP-PSIPVTIPEGRVHGGSLL  436
                S + +   S   +    Q T+    +P  S  +++PEGRVHGG L+
Sbjct  581   --FSKMGAGRESQLSWSRLDQETLMHPANPLNSGLISLPEGRVHGGRLM  627


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 128/216 (59%), Gaps = 21/216 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K C+ + C K A G SGLCI+HGGGRRCQ P C KGA+G T++CKAHGGG RC +
Sbjct  252   RSSNTKNCRFQGCGKGARGASGLCIAHGGGRRCQRPGCHKGAEGRTIYCKAHGGGHRCQH  311

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  312   LGCTKSAEGRTDYCIAHGGGRRCSHDG---CTRAARGKSGLCIRHGGGKRCRRENCTKSA  368

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G++  C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   
Sbjct  369   EGQSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------PGCTKG  417

Query  747   ARGKTGLCASHGALVQ-------DKRVHGGATLGVV  661
             A G T  C  HG   +        K VHGG    V 
Sbjct  418   AEGSTPFCKGHGGGKRCAFQGGCSKSVHGGTQFCVA  453



>ref|XP_004503653.1| PREDICTED: uncharacterized protein LOC101508470 isoform X1 [Cicer 
arietinum]
 ref|XP_004503654.1| PREDICTED: uncharacterized protein LOC101508470 isoform X2 [Cicer 
arietinum]
 ref|XP_004503655.1| PREDICTED: uncharacterized protein LOC101508470 isoform X3 [Cicer 
arietinum]
Length=665

 Score =   373 bits (958),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 215/325 (66%), Positives = 235/325 (72%), Gaps = 15/325 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  352   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQVSGCTKGAQGSTMFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC +QGGGVC KSVHGGT +CVAHGGGKRCAVT CT
Sbjct  412   CTAPGCTKGAEGSTPFCKGHGGGKRCTYQGGGVCTKSVHGGTNFCVAHGGGKRCAVTGCT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE G + + P
Sbjct  472   KSARGRTDHCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPESEHGIQPDGP  531

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTE-NMKEIDTTEDMDADSM  583
             C SFARGKTGLCA H  LV D+RVHGG +LG V      K  E  M +I ++    A   
Sbjct  532   CTSFARGKTGLCALHSGLVHDRRVHGGVSLGSVQDPRCSKPVEVTMMKIGSSIGNTAAPR  591

Query  582   TVERSVVTSANGSDWKYISFKQATMPI-LGSPPSIPVTIPEGRVHGGSLLsmlasnsdps  406
             T           SD K      A   +  G    + V +PEGRVHGGSL+++L S    S
Sbjct  592   TC----------SDLKQHEVASACASVEEGGRFPMSVAVPEGRVHGGSLMALLTSGGTSS  641

Query  405   lssSRGTENPSEPRKAY-ITHQSWM  334
             +    G +  S+P K Y I  QSW+
Sbjct  642   VKGLTGGD-LSKPIKGYNILPQSWI  665


 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 132/211 (63%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             RHG  K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC Y
Sbjct  255   RHGNSKICQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEY  314

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  315   LGCTKSAEGRTDFCIAHGGGRRCSHDG---CSRAARGKSGLCIRHGGGKRCQKENCTKSA  371

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P   F
Sbjct  372   EGLSGLCISHGGGRRCQVSGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTP---F  427

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C   G  V  K VHGG    V 
Sbjct  428   CKGHGGGKRCTYQGGGVCTKSVHGGTNFCVA  458



>gb|KEH21167.1| transcription factor, putative [Medicago truncatula]
Length=677

 Score =   374 bits (959),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 241/327 (74%), Gaps = 10/327 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  355   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQVAGCTKGAQGSTMFCKAHGGGKR  414

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC +QGGG+C KSVHGGT +CVAHGGGKRCAV  CT
Sbjct  415   CTAPGCTKGAEGSTPFCKGHGGGKRCTYQGGGICTKSVHGGTNFCVAHGGGKRCAVAGCT  474

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG-KGEIP  760
             KSARGRTD CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P SE+G + +  
Sbjct  475   KSARGRTDHCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGIQPDGA  534

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C SFARGKTGLCA H  LV D+RVHGG +LG +    + K  + +++     DM+   M 
Sbjct  535   CTSFARGKTGLCALHSGLVHDRRVHGGLSLGSLPDPRSSK-PDQLRQSLFDRDMEVAMMK  593

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpsls  400
             +     T+A   +   ++  +A+    G  P + V +PEGRVHGGSL++ML + S     
Sbjct  594   IGSG--TAAAQLNQLELASARASADEGGHFP-MSVAVPEGRVHGGSLMAMLTAGSGSGTR  650

Query  399   sSRG----TENPSEPRKAY-ITHQSWM  334
             +S G      +PS P K Y +  QSW+
Sbjct  651   TSTGKGIANIDPSMPIKGYNVMPQSWI  677


 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             RH   K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC Y
Sbjct  258   RHVNSKICQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEY  317

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  318   LGCTKSAEGRTDFCIAHGGGRRCSHDG---CSRAARGKSGLCIRHGGGKRCQRENCTKSA  374

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC      ++  +G  P   F
Sbjct  375   EGLSGLCISHGGGRRCQVAGCTKGAQGSTMFCKAHGGGKRCT-APGCTKGAEGSTP---F  430

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C   G  +  K VHGG    V 
Sbjct  431   CKGHGGGKRCTYQGGGICTKSVHGGTNFCVA  461



>ref|XP_006300404.1| hypothetical protein CARUB_v10019935mg [Capsella rubella]
 gb|EOA33302.1| hypothetical protein CARUB_v10019935mg [Capsella rubella]
Length=547

 Score =   368 bits (944),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 218/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  247   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSDGCTKGAQGSTMFCKAHGGGKR  306

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F+GG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  307   CTHSGCTKGAEGSTPFCKGHGGGKRCAFEGGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  366

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI--  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P +E+ +     
Sbjct  367   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAEQSSAG  426

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN     + ++M+ D
Sbjct  427   PCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEDYSGSQDNMNID  486

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             ++        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  487   TIKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  524


 Score =   182 bits (463),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 126/204 (62%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  155   KLCQVEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  214

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  215   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  271

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ +GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  272   LCISHGGGRRCQSDGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKR  331

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  332   CAFEGGDPCSKSVHGGTNFCVAHG  355



>ref|XP_006300405.1| hypothetical protein CARUB_v10019935mg [Capsella rubella]
 gb|EOA33303.1| hypothetical protein CARUB_v10019935mg [Capsella rubella]
Length=647

 Score =   370 bits (950),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 195/291 (67%), Positives = 218/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  347   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSDGCTKGAQGSTMFCKAHGGGKR  406

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F+GG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  407   CTHSGCTKGAEGSTPFCKGHGGGKRCAFEGGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  466

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI--  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P +E+ +     
Sbjct  467   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAEQSSAG  526

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN     + ++M+ D
Sbjct  527   PCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEDYSGSQDNMNID  586

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             ++        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  587   TIKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  624


 Score =   184 bits (467),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 126/204 (62%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  255   KLCQVEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  314

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  315   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  371

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ +GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  372   LCISHGGGRRCQSDGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKR  431

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  432   CAFEGGDPCSKSVHGGTNFCVAHG  455



>gb|EMS53361.1| hypothetical protein TRIUR3_16406 [Triticum urartu]
Length=629

 Score =   369 bits (948),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 211/287 (74%), Gaps = 32/287 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E CTKSAEG SGLCISHGGGRRCQ+P+C KGAQGST FCKAHGGGKR
Sbjct  348   LCIRHGGGKRCQQEKCTKSAEGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP+CKGHGGGKRCLF+GGGVCPKSVHGGT YCVAHGGGKRCA++DCT
Sbjct  408   CTFLGCTKGAEGSTPYCKGHGGGKRCLFEGGGVCPKSVHGGTQYCVAHGGGKRCAISDCT  467

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+F+GC KSAQGSTDFCKAHGGGKRC WG P S FG G   C
Sbjct  468   KSARGRTEYCVRHGGGKRCRFDGCVKSAQGSTDFCKAHGGGKRCSWGLPDSSFGIGTEQC  527

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  VHGG TLG V+         +  E+     +D  SM  
Sbjct  528   DKFARSKTGLCSAHTALVQDHCVHGGGTLGPVIHHFATDVKPDEMEVAAAVKVDPVSMQS  587

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             E                           PP     +PEGRVHGG LL
Sbjct  588   E---------------------------PP-----LPEGRVHGGGLL  602


 Score =   182 bits (461),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 119/192 (62%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  251   RNLNTKTCQFPGCGKGARGASGHCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCEF  310

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  311   LGCTKSAEGRTDHCIAHGGGRRCSNDG---CSRAARGRSGLCIRHGGGKRCQQEKCTKSA  367

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   
Sbjct  368   EGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKRCTF-----------LGCTKG  416

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  417   AEGSTPYCKGHG  428



>gb|EMT10026.1| hypothetical protein F775_05300 [Aegilops tauschii]
Length=630

 Score =   369 bits (947),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 211/287 (74%), Gaps = 32/287 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E CTKSAEG SGLCISHGGGRRCQ+P+C KGAQGST FCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQQEKCTKSAEGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP+CKGHGGGKRCLF+GGGVCPKSVHGGT YCVAHGGGKRCA++DCT
Sbjct  409   CTFLGCTKGAEGSTPYCKGHGGGKRCLFEGGGVCPKSVHGGTQYCVAHGGGKRCAISDCT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+F+GC KSAQGSTDFCKAHGGGKRC WG P S FG G   C
Sbjct  469   KSARGRTEYCVRHGGGKRCRFDGCVKSAQGSTDFCKAHGGGKRCSWGLPDSSFGIGTEQC  528

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  VHGG TLG V+         +  E+     +D  SM  
Sbjct  529   DKFARSKTGLCSAHTALVQDHCVHGGGTLGPVIHHFATDVKPDEMEVAAAVKVDPVSMQS  588

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             E                           PP     +PEGRVHGG LL
Sbjct  589   E---------------------------PP-----LPEGRVHGGGLL  603


 Score =   181 bits (460),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 119/192 (62%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  252   RNLNTKTCQFPGCGKGARGASGHCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCEF  311

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA
Sbjct  312   LGCTKSAEGRTDHCIAHGGGRRCSNDG---CSRAARGRSGLCIRHGGGKRCQQEKCTKSA  368

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   
Sbjct  369   EGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKRCTF-----------LGCTKG  417

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  418   AEGSTPYCKGHG  429



>ref|XP_010473665.1| PREDICTED: uncharacterized protein LOC104753083 [Camelina sativa]
 ref|XP_010473666.1| PREDICTED: uncharacterized protein LOC104753083 [Camelina sativa]
Length=653

 Score =   369 bits (947),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 201/291 (69%), Positives = 220/291 (76%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  353   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  413   CTHSGCTKGAEGSTPFCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  472

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP +E+       
Sbjct  473   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGQPETEYAGQSSSG  532

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN +E   ++DM+ D
Sbjct  533   PCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEEEFSGSQDMNID  592

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +M        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  593   TMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  630


 Score =   184 bits (466),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  261   KLCQVEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  320

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  321   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQKENCTKSAEGLSG  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  378   LCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKR  437

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  438   CAFQGGDPCSKSVHGGTNFCVAHG  461



>ref|XP_002441593.1| hypothetical protein SORBIDRAFT_09g029960 [Sorghum bicolor]
 gb|EES20023.1| hypothetical protein SORBIDRAFT_09g029960 [Sorghum bicolor]
Length=654

 Score =   369 bits (946),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 213/287 (74%), Gaps = 13/287 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ+ENC +SAEG SGLCISHGGGRRCQ+P CTKGAQGST FCKAHGGGKR
Sbjct  352   LCIKHGGGKRCQRENCKRSAEGYSGLCISHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGST  CKGHGGGKRC +QGGGVCPKSVHGGT YCVAHGGGKRC V+ CT
Sbjct  412   CTFPGCTKGAEGSTSLCKGHGGGKRCAYQGGGVCPKSVHGGTQYCVAHGGGKRCLVSGCT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  S FG G  PC
Sbjct  472   KSARGRTEYCVRHGGGKRCKFEGCAKSAQGSTDFCKAHGGGKRCSWGQEGSSFGVGGPPC  531

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR K GLCA H ALV+D  VHGG +LG  ++++T     N  EI      D   M  
Sbjct  532   DKFARSKIGLCAGHSALVEDHCVHGGGSLGPAIRQLTADC--NPDEIQAAAMKDDADM--  587

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                    ANG D  ++ +      +   P + P  +PEGRVHG  LL
Sbjct  588   -------ANGEDEAFLGWNDDDDNVEAQPSAPP--LPEGRVHGSGLL  625


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 117/185 (63%), Gaps = 14/185 (8%)
 Frame = -3

Query  1266  CQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGA  1087
             CQ   C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC Y GCTK A
Sbjct  262   CQFPGCEKGARGASGYCISHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQYLGCTKSA  321

Query  1086  EGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFC  907
             EG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +C +SA G +  C
Sbjct  322   EGRTDHCIAHGGGRRCSQEG---CSRAARGKSGLCIKHGGGKRCQRENCKRSAEGYSGLC  378

Query  906   VRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGL  727
             + HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   A G T L
Sbjct  379   ISHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKRCTFPG-----------CTKGAEGSTSL  427

Query  726   CASHG  712
             C  HG
Sbjct  428   CKGHG  432


 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 87/155 (56%), Gaps = 17/155 (11%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT GA  S    K     K C + GC KGA G++ +C  HGGG+RC   G   C K   G
Sbjct  245   CTSGATNSQ---KRSINTKCCQFPGCEKGARGASGYCISHGGGRRCQKPG---CQKGAEG  298

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTD C+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  299   RTIYCKAHGGGRRCQYLGCTKSAEGRTDHCIAHGGGRRCSQEGCSRAARGKSGLCIKHGG  358

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC               C   A G +GLC SHG
Sbjct  359   GKRCQREN-----------CKRSAEGYSGLCISHG  382



>emb|CDM83369.1| unnamed protein product [Triticum aestivum]
Length=630

 Score =   368 bits (944),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/287 (66%), Positives = 211/287 (74%), Gaps = 32/287 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ++ CTKSAEG SGLCISHGGGRRCQ+P+C KGAQGST FCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQQDKCTKSAEGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP+CKGHGGGKRCLF+GGGVCPKSVHGGT YCVAHGGGKRCA++DCT
Sbjct  409   CTFLGCTKGAEGSTPYCKGHGGGKRCLFEGGGVCPKSVHGGTQYCVAHGGGKRCAISDCT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+F+GC KSAQGSTDFCKAHGGGKRC WG P S FG G   C
Sbjct  469   KSARGRTEYCVRHGGGKRCRFDGCVKSAQGSTDFCKAHGGGKRCSWGLPDSSFGIGTEQC  528

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  VHGG TLG V+         +  E+     +D  SM  
Sbjct  529   DKFARSKTGLCSAHTALVQDHCVHGGGTLGPVIHHFATDVKPDEMEVAAAVKVDPVSMQS  588

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             E                           PP     +PEGRVHGG LL
Sbjct  589   E---------------------------PP-----LPEGRVHGGGLL  603


 Score =   181 bits (460),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 117/187 (63%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  257   KTCQFPGCGKGARGASGHCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCEFLGCTK  316

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA G + 
Sbjct  317   SAEGRTDHCIAHGGGRRCSNDG---CSRAARGRSGLCIRHGGGKRCQQDKCTKSAEGHSG  373

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  374   LCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKRCTF-----------LGCTKGAEGST  422

Query  732   GLCASHG  712
               C  HG
Sbjct  423   PYCKGHG  429



>ref|XP_009404457.1| PREDICTED: uncharacterized protein LOC103987782 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404458.1| PREDICTED: uncharacterized protein LOC103987782 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404459.1| PREDICTED: uncharacterized protein LOC103987782 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404460.1| PREDICTED: uncharacterized protein LOC103987782 [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   369 bits (946),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 218/288 (76%), Gaps = 11/288 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEG SGLCISHGGGRRC++P+CTKGAQGST FCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQKENCTKSAEGRSGLCISHGGGRRCRHPKCTKGAQGSTNFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GCTKGAEGST FCK HGGGKRC FQGG  C KSVHGGTL+CVAHGGGKRCA  +CT
Sbjct  409   CTYMGCTKGAEGSTTFCKAHGGGKRCAFQGG--CTKSVHGGTLFCVAHGGGKRCAAPECT  466

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARG+TDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC+WGQP S  G G  PC
Sbjct  467   KSARGKTDFCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCFWGQPGSNLGNGGPPC  526

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI-TPKRTENMKEIDTTEDMDADSMT  580
             + FARGK GLCA+H ALV+D  VHGG  L     E  T  + E MKEI   E +    M 
Sbjct  527   DRFARGKKGLCAAHTALVEDHCVHGGHQLMAATSENGTLSKHEKMKEIIDLEGL--LEMK  584

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               +S + S  G D K       T P+     S   ++PEGRVHGGSL+
Sbjct  585   NGKSTLFSFGGCDQK--EHMHTTNPL----NSRMSSVPEGRVHGGSLI  626


 Score =   187 bits (474),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 127/211 (60%), Gaps = 21/211 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SGLCI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  257   KNCQFPGCAKGARGASGLCIAHGGGRRCQKEGCHKGAEGRTIFCKAHGGGRRCQYLGCTK  316

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  317   SAEGRTDLCIAHGGGRRCSHED---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGRSG  373

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC+   C K AQGST+FCKAHGGGKRC +           + C   A G T
Sbjct  374   LCISHGGGRRCRHPKCTKGAQGSTNFCKAHGGGKRCTY-----------MGCTKGAEGST  422

Query  732   GLCASHGALVQ-------DKRVHGGATLGVV  661
               C +HG   +        K VHGG    V 
Sbjct  423   TFCKAHGGGKRCAFQGGCTKSVHGGTLFCVA  453



>ref|NP_176596.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF24563.1|AC007764_5 F22C12.10 [Arabidopsis thaliana]
 gb|AEE34200.1| uncharacterized protein AT1G64140 [Arabidopsis thaliana]
Length=646

 Score =   368 bits (945),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 219/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQG   C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  409   CTHSGCTKGAEGSTPFCKGHGGGKRCAFQGDDPCSKSVHGGTNFCVAHGGGKRCAVPECT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRCQ EGCGKSAQGSTDFCKAHGGGKRC WGQP +E+       
Sbjct  469   KSARGRTDFCVRHGGGKRCQSEGCGKSAQGSTDFCKAHGGGKRCAWGQPETEYAGQSSSG  528

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN +E   ++DM+ D
Sbjct  529   PCTSFARGKTGLCALHNSLVQDNRVHGGMTITSESQEPRVSSSETENEEEFSGSQDMNMD  588

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +M        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  589   TMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  626


 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+G++  C +HGGG+RC   GC KGAEG T +CK HGGG+RC F G   
Sbjct  257   KLCQVEGCHKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLG---  313

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C KS  G T +C+AHGGG+RC+  DCT++ARGR+  C+RHGGGKRCQ E C KSA+G + 
Sbjct  314   CTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  373

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              C +HGGG+RC               C   A+G T  C +HG
Sbjct  374   LCISHGGGRRCQ-----------SNGCTKGAQGSTMFCKAHG  404


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 72/131 (55%), Gaps = 15/131 (11%)
 Frame = -3

Query  1101  CTKG-AEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSAR  925
             CT G ++   P  K     K C  +G   C K   G +  C++HGGG+RC    C K A 
Sbjct  238   CTSGLSQQLKPQLKNSSSSKLCQVEG---CHKGARGASGRCISHGGGRRCQKHGCHKGAE  294

Query  924   GRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFA  745
             GRT +C  HGGG+RC+F GC KSA+G TDFC AHGGG+RC               C   A
Sbjct  295   GRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCS-----------HEDCTRAA  343

Query  744   RGKTGLCASHG  712
             RG++GLC  HG
Sbjct  344   RGRSGLCIRHG  354



>dbj|BAD43515.1| hypothetical protein [Arabidopsis thaliana]
Length=646

 Score =   367 bits (941),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 199/291 (68%), Positives = 219/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQG   C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  409   CTHSGCTKGAEGSTPFCKGHGGGKRCAFQGDDPCSKSVHGGTNFCVAHGGGKRCAVPECT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRCQ EGCGKSAQGSTDFCKAHGGGK+C WGQP +E+       
Sbjct  469   KSARGRTDFCVRHGGGKRCQSEGCGKSAQGSTDFCKAHGGGKKCAWGQPETEYAGQSSSG  528

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN +E   ++DM+ D
Sbjct  529   PCTSFARGKTGLCALHNSLVQDNRVHGGMTITSESQEPRVSSSETENEEEFSGSQDMNMD  588

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +M        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  589   TMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  626


 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+G++  C +HGGG+RC   GC KGAEG T +CK HGGG+RC F G   
Sbjct  257   KLCQVEGCHKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLG---  313

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C KS  G T +C+AHGGG+RC+  DCT++ARGR+  C+RHGGGKRCQ E C KSA+G + 
Sbjct  314   CTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  373

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              C +HGGG+RC               C   A+G T  C +HG
Sbjct  374   LCISHGGGRRCQ-----------SNGCTKGAQGSTMFCKAHG  404


 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 72/131 (55%), Gaps = 15/131 (11%)
 Frame = -3

Query  1101  CTKG-AEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSAR  925
             CT G ++   P  K     K C  +G   C K   G +  C++HGGG+RC    C K A 
Sbjct  238   CTSGLSQQLKPQLKNSSSSKLCQVEG---CHKGARGASGRCISHGGGRRCQKHGCHKGAE  294

Query  924   GRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFA  745
             GRT +C  HGGG+RC+F GC KSA+G TDFC AHGGG+RC               C   A
Sbjct  295   GRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCS-----------HEDCTRAA  343

Query  744   RGKTGLCASHG  712
             RG++GLC  HG
Sbjct  344   RGRSGLCIRHG  354



>ref|XP_010430532.1| PREDICTED: uncharacterized protein LOC104714775 [Camelina sativa]
 ref|XP_010430533.1| PREDICTED: uncharacterized protein LOC104714775 [Camelina sativa]
Length=655

 Score =   366 bits (939),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 219/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  355   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  414

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  415   CTHSGCTKGAEGSTPFCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  474

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP +E+       
Sbjct  475   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGQPETEYAGQSSSG  534

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN +E   ++DM+ D
Sbjct  535   PCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEEEFSGSQDMNID  594

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +M        SA GS    +   +    +           PE RVHGGSL+
Sbjct  595   TMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEERVHGGSLM  632


 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  263   KLCQVEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  322

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  323   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQKENCTKSAEGLSG  379

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  380   LCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKR  439

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  440   CAFQGGDPCSKSVHGGTNFCVAHG  463



>dbj|BAJ85365.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   365 bits (937),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 211/287 (74%), Gaps = 30/287 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E CTKSAEG SGLCISHGGGRRCQ+P+C KGAQGST FCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQQEKCTKSAEGHSGLCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP+CKGHGGGKRCLF+GGGVCPKSVHGGT YCVAHGGGKRCA++DCT
Sbjct  409   CTFLGCTKGAEGSTPYCKGHGGGKRCLFEGGGVCPKSVHGGTQYCVAHGGGKRCAISDCT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+F+GC KSAQGSTDFCKAHGGGKRC WG P S FG G   C
Sbjct  469   KSARGRTEYCVRHGGGKRCRFDGCVKSAQGSTDFCKAHGGGKRCSWGLPGSSFGIGTEQC  528

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  VHGG TLG V+            E+     +D  SM  
Sbjct  529   DKFARSKTGLCSAHTALVQDHCVHGGGTLGPVIHHFAADVKPGEMEVAAAVKVDPVSMQ-  587

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                     +GS                     P+  PEGRVHGG LL
Sbjct  588   --------SGS---------------------PLPEPEGRVHGGGLL  605


 Score =   178 bits (451),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 116/187 (62%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  257   KTCQFPGCGKGARGASGHCIAHGGGRRCQKAGCQKGAEGRTIYCKAHGGGRRCEFLGCTK  316

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC    CTKSA G + 
Sbjct  317   SAEGRTDHCIAHGGGRRCSNDG---CSRAARGRSGLCIRHGGGKRCQQEKCTKSAEGHSG  373

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  374   LCISHGGGRRCQFPECAKGAQGSTKFCKAHGGGKRCTF-----------LGCTKGAEGST  422

Query  732   GLCASHG  712
               C  HG
Sbjct  423   PYCKGHG  429



>emb|CDY38191.1| BnaA09g11980D [Brassica napus]
Length=644

 Score =   365 bits (938),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 216/289 (75%), Gaps = 17/289 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  350   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSSGCTKGAQGSTMFCKAHGGGKR  409

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQ G  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  410   CTHPGCTKGAEGSTPFCKGHGGGKRCAFQEGHPCSKSVHGGTNFCVAHGGGKRCAVPECT  469

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P +E+       
Sbjct  470   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAGQSSSG  529

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSM  583
             PC SFARGKTGLCA H +LV+D RVHGG T+    QE  P+ + + +E   ++DM+ D M
Sbjct  530   PCTSFARGKTGLCALHTSLVEDNRVHGGMTVTSESQE--PRISSSEEEFSGSQDMNMDRM  587

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 +V +     D             L    + P   PEGRVHGGSL+
Sbjct  588   KARSAVGSPETDID-------------LNENETGPGLAPEGRVHGGSLI  623


 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 105/160 (66%), Gaps = 14/160 (9%)
 Frame = -3

Query  1191  CQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCP  1012
             CQ   C KGA+G++  C +HGGG+RC   GC KGAEG T +CK HGGG+RC F G   C 
Sbjct  260   CQVEGCQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHGGGRRCEFLG---CT  316

Query  1011  KSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFC  832
             KS  G T +C+AHGGG+RC+  DCT++ARGR+  C+RHGGGKRCQ E C KSA+G +  C
Sbjct  317   KSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSGLC  376

Query  831   KAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              +HGGG+RC   Q S         C   A+G T  C +HG
Sbjct  377   ISHGGGRRC---QSSG--------CTKGAQGSTMFCKAHG  405


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 14/143 (10%)
 Frame = -3

Query  1140  KAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGK  961
             K+    K C  EGC KGA G++  C  HGGG+RC   G   C K   G T+YC AHGGG+
Sbjct  252   KSSSSSKLCQVEGCQKGARGASGRCISHGGGRRCQRHG---CHKGAEGRTVYCKAHGGGR  308

Query  960   RCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSE  781
             RC    CTKSA GRTDFC+ HGGG+RC  E C ++A+G +  C  HGGGKRC        
Sbjct  309   RCEFLGCTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQREN----  364

Query  780   FGKGEIPCNSFARGKTGLCASHG  712
                    C   A G +GLC SHG
Sbjct  365   -------CTKSAEGLSGLCISHG  380


 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 67/121 (55%), Gaps = 14/121 (12%)
 Frame = -3

Query  1074  PFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHG  895
             P  K     K C  +G   C K   G +  C++HGGG+RC    C K A GRT +C  HG
Sbjct  249   PQHKSSSSSKLCQVEG---CQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHG  305

Query  894   GGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASH  715
             GG+RC+F GC KSA+G TDFC AHGGG+RC               C   ARG++GLC  H
Sbjct  306   GGRRCEFLGCTKSAEGRTDFCIAHGGGRRC-----------SHEDCTRAARGRSGLCIRH  354

Query  714   G  712
             G
Sbjct  355   G  355



>ref|XP_009112807.1| PREDICTED: uncharacterized protein LOC103838138 [Brassica rapa]
 ref|XP_009112808.1| PREDICTED: uncharacterized protein LOC103838138 [Brassica rapa]
Length=646

 Score =   365 bits (937),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 216/289 (75%), Gaps = 17/289 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  350   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  409

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQ G  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  410   CTHPGCTKGAEGSTPFCKGHGGGKRCAFQEGHPCSKSVHGGTNFCVAHGGGKRCAVPECT  469

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG P +E+       
Sbjct  470   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAGQSSSG  529

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSM  583
             PC SFARGKTGLCA H +LV+D RVHGG T+    QE  P+ + + +E   ++DM+ D M
Sbjct  530   PCTSFARGKTGLCALHTSLVEDNRVHGGMTVTSESQE--PRVSSSEEEFSGSQDMNMDRM  587

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 +V +     D             L    + P   PEGRVHGGSL+
Sbjct  588   KARSAVGSPETDID-------------LNENETGPGLAPEGRVHGGSLI  623


 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 103/160 (64%), Gaps = 14/160 (9%)
 Frame = -3

Query  1191  CQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCP  1012
             CQ   C KGA+G++  C +HGGG+RC   GC KGAEG T +CK HGGG+RC F G   C 
Sbjct  260   CQVEGCQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHGGGRRCEFLG---CT  316

Query  1011  KSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFC  832
             KS  G T +C+AHGGG+RC+  DCT++ARGR+  C+RHGGGKRCQ E C KSA+G +  C
Sbjct  317   KSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSGLC  376

Query  831   KAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              +HGGG+RC               C   A+G T  C +HG
Sbjct  377   ISHGGGRRCQSNG-----------CTKGAQGSTMFCKAHG  405


 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 14/143 (10%)
 Frame = -3

Query  1140  KAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGK  961
             K+    K C  EGC KGA G++  C  HGGG+RC   G   C K   G T+YC AHGGG+
Sbjct  252   KSSSSSKLCQVEGCQKGARGASGRCISHGGGRRCQRHG---CHKGAEGRTVYCKAHGGGR  308

Query  960   RCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSE  781
             RC    CTKSA GRTDFC+ HGGG+RC  E C ++A+G +  C  HGGGKRC        
Sbjct  309   RCEFLGCTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQREN----  364

Query  780   FGKGEIPCNSFARGKTGLCASHG  712
                    C   A G +GLC SHG
Sbjct  365   -------CTKSAEGLSGLCISHG  380


 Score = 94.0 bits (232),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 67/121 (55%), Gaps = 14/121 (12%)
 Frame = -3

Query  1074  PFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHG  895
             P  K     K C  +G   C K   G +  C++HGGG+RC    C K A GRT +C  HG
Sbjct  249   PQHKSSSSSKLCQVEG---CQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHG  305

Query  894   GGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASH  715
             GG+RC+F GC KSA+G TDFC AHGGG+RC               C   ARG++GLC  H
Sbjct  306   GGRRCEFLGCTKSAEGRTDFCIAHGGGRRC-----------SHEDCTRAARGRSGLCIRH  354

Query  714   G  712
             G
Sbjct  355   G  355



>ref|XP_008795010.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103710875 
[Phoenix dactylifera]
Length=640

 Score =   365 bits (936),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 213/287 (74%), Gaps = 29/287 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENC KSAEG SGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR
Sbjct  348   LCIRHGGGKRCQRENCIKSAEGHSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC F GG  C KSVHGGT +CVAHGGGKRCA  +CT
Sbjct  408   CTFPGCTKGAEGSTPFCKGHGGGKRCAFPGG--CSKSVHGGTEFCVAHGGGKRCAAPECT  465

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGG RC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ  S FG G  PC
Sbjct  466   RSARGRTDFCVRHGGGXRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGQAGSVFGAGGPPC  525

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FARGK GLCA+H A V+D RVHGG               E MKE+    DM  + M  
Sbjct  526   DRFARGKIGLCAAHTAQVEDHRVHGGHI------------AEKMKEVVVDRDMFTN-MET  572

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              R   +S +G        K A  P+        V++PEGRVHGGSL+
Sbjct  573   GRQSQSSWSGHQ------KSAMHPV--------VSLPEGRVHGGSLM  605


 Score =   184 bits (467),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 126/211 (60%), Gaps = 21/211 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC Y GCTK
Sbjct  256   KYCQFQGCGKGARGASGLCIAHGGGRRCQRPGCHKGAEGRTIYCKAHGGGRRCEYLGCTK  315

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +C KSA G + 
Sbjct  316   SAEGRTDYCIAHGGGRRCSNDG---CTRAARGKSGLCIRHGGGKRCQRENCIKSAEGHSG  372

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  373   LCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCTF-----------PGCTKGAEGST  421

Query  732   GLCASHGALVQ-------DKRVHGGATLGVV  661
               C  HG   +        K VHGG    V 
Sbjct  422   PFCKGHGGGKRCAFPGGCSKSVHGGTEFCVA  452



>ref|XP_002886362.1| hypothetical protein ARALYDRAFT_474940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62621.1| hypothetical protein ARALYDRAFT_474940 [Arabidopsis lyrata subsp. 
lyrata]
Length=646

 Score =   363 bits (933),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 198/291 (68%), Positives = 218/291 (75%), Gaps = 17/291 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  349   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKR  408

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQG   C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  409   CTHSGCTKGAEGSTPFCKGHGGGKRCAFQGDDPCSKSVHGGTNFCVAHGGGKRCAVPECT  468

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP +E+       
Sbjct  469   KSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCGWGQPETEYAGQSSSG  528

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDAD  589
             PC SFARGKTGLCA H +LV D RVHGG T+    QE  ++   TEN +E   ++DM+ D
Sbjct  529   PCTSFARGKTGLCALHNSLVHDNRVHGGMTITSESQEPRVSSSETENEEEFSGSQDMNMD  588

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +M        SA GS    +   +    +           PEGRVHGGSL+
Sbjct  589   TMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  626


 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+G++  C +HGGG+RC   GC KGAEG T +CK HGGG+RC F G   
Sbjct  257   KLCQVEGCQKGARGASGRCISHGGGRRCQKHGCHKGAEGRTVYCKAHGGGRRCEFLG---  313

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C KS  G T +C+AHGGG+RC+  DCT++ARGR+  C+RHGGGKRCQ E C KSA+G + 
Sbjct  314   CTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQRENCTKSAEGLSG  373

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              C +HGGG+RC               C   A+G T  C +HG
Sbjct  374   LCISHGGGRRCQ-----------SNGCTKGAQGSTMFCKAHG  404


 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 72/131 (55%), Gaps = 15/131 (11%)
 Frame = -3

Query  1101  CTKG-AEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSAR  925
             CT G ++   P  K     K C  +G   C K   G +  C++HGGG+RC    C K A 
Sbjct  238   CTSGLSQQLKPQLKNSSSSKLCQVEG---CQKGARGASGRCISHGGGRRCQKHGCHKGAE  294

Query  924   GRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFA  745
             GRT +C  HGGG+RC+F GC KSA+G TDFC AHGGG+RC               C   A
Sbjct  295   GRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCS-----------HEDCTRAA  343

Query  744   RGKTGLCASHG  712
             RG++GLC  HG
Sbjct  344   RGRSGLCIRHG  354



>ref|XP_009421229.1| PREDICTED: uncharacterized protein LOC104000817 [Musa acuminata 
subsp. malaccensis]
Length=664

 Score =   364 bits (934),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/289 (67%), Positives = 216/289 (75%), Gaps = 13/289 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEG SGLCI+HGGGRRC+YP+CTKGAQGST FCKAHGGGKR
Sbjct  345   LCIRHGGGKRCQRENCTKSAEGHSGLCIAHGGGRRCKYPECTKGAQGSTNFCKAHGGGKR  404

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GCTKGAEG TPFCK HGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  405   CTYLGCTKGAEGCTPFCKAHGGGKRCAFQGG--CTKSVHGGTQFCVAHGGGKRCAVPNCT  462

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARG+TDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGG RC WGQP S  G    PC
Sbjct  463   KSARGKTDFCVRHGGGKRCKTEGCGKSAQGSTDFCKAHGGGNRCTWGQPGSNIGTDGAPC  522

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE-ITPKRTENMKEIDTTEDMDADS-M  583
             + FARGK GLCA+H ALV+D  VHGG  L  V  E   P + E MKEI     +D D  +
Sbjct  523   DRFARGKLGLCAAHTALVEDHCVHGGHQLVTVNSEHQIPSKPEKMKEI-----VDPDRFL  577

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              +E     +   S      +   T P+     S+  ++PEGRVHGGSL+
Sbjct  578   EIENRKNMTFGWSGIHQTEYIHPTNPL----NSMMASLPEGRVHGGSLV  622


 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 130/216 (60%), Gaps = 21/216 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   C K A G SGLCI+HGGGRRCQ   C KGA+G T+FCKAHGGGKRC Y
Sbjct  248   RNSNIKNCQFPGCAKGARGASGLCIAHGGGRRCQKDGCHKGAEGRTIFCKAHGGGKRCQY  307

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC  +G   C K+  G +  C+ HGGGKRC   +CTKSA
Sbjct  308   LGCTKSAEGRTDCCIAHGGGRRCSHEG---CTKASRGKSGLCIRHGGGKRCQRENCTKSA  364

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RC++  C K AQGST+FCKAHGGGKRC +           + C   
Sbjct  365   EGHSGLCIAHGGGRRCKYPECTKGAQGSTNFCKAHGGGKRCTY-----------LGCTKG  413

Query  747   ARGKTGLCASHGALVQ-------DKRVHGGATLGVV  661
             A G T  C +HG   +        K VHGG    V 
Sbjct  414   AEGCTPFCKAHGGGKRCAFQGGCTKSVHGGTQFCVA  449


 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 88/159 (55%), Gaps = 14/159 (9%)
 Frame = -3

Query  1188  QYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPK  1009
             Q  + +  A G T   + +   K C + GC KGA G++  C  HGGG+RC   G   C K
Sbjct  231   QMLKNSVAASGVTQTQQRNSNIKNCQFPGCAKGARGASGLCIAHGGGRRCQKDG---CHK  287

Query  1008  SVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCK  829
                G T++C AHGGGKRC    CTKSA GRTD C+ HGGG+RC  EGC K+++G +  C 
Sbjct  288   GAEGRTIFCKAHGGGKRCQYLGCTKSAEGRTDCCIAHGGGRRCSHEGCTKASRGKSGLCI  347

Query  828   AHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
              HGGGKRC               C   A G +GLC +HG
Sbjct  348   RHGGGKRCQ-----------RENCTKSAEGHSGLCIAHG  375



>ref|XP_004961068.1| PREDICTED: uncharacterized protein LOC101783602 isoform X1 [Setaria 
italica]
 ref|XP_004961069.1| PREDICTED: uncharacterized protein LOC101783602 isoform X2 [Setaria 
italica]
Length=684

 Score =   362 bits (930),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/288 (65%), Positives = 215/288 (75%), Gaps = 17/288 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ+ENC +SAEG +GLCISHGGGRRCQ+P CTKGAQGST FCKAHGGGKR
Sbjct  353   LCIKHGGGKRCQRENCKRSAEGYTGLCISHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST FCKGHGGGKRC +QGGGVCPKSVHGGT YCVAHGGGKRC+V+ CT
Sbjct  413   CTFPGCAKGAEGSTSFCKGHGGGKRCSYQGGGVCPKSVHGGTQYCVAHGGGKRCSVSGCT  472

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  S FG G  PC
Sbjct  473   KSARGRTEYCVRHGGGKRCKFEGCAKSAQGSTDFCKAHGGGKRCSWGQEGSSFGVGGPPC  532

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPK-RTENMKEIDTTEDMDADSMT  580
             + FAR K GLCA+H AL++D  VHGG +L   +++ T   +++ M    T  D+D  +  
Sbjct  533   DKFARSKIGLCAAHSALIEDHCVHGGGSLDPAIKQFTTDAKSDEMNVTATKGDVDMANSD  592

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              E  +V S +G              I   P + P   PEGRVHG  LL
Sbjct  593   NEAVMVWSDHG--------------IPTDPGTTP--FPEGRVHGSGLL  624


 Score =   185 bits (469),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 129/211 (61%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC Y
Sbjct  256   RNTNTKCCQFPGCEKGARGASGYCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQY  315

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +C +SA
Sbjct  316   LGCTKSAEGRTDHCIAHGGGRRCSQEG---CSRAARGKSGLCIKHGGGKRCQRENCKRSA  372

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G T  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +        KG     SF
Sbjct  373   EGYTGLCISHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKRCTF----PGCAKGAEGSTSF  428

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   C+  G  V  K VHGG    V 
Sbjct  429   CKGHGGGKRCSYQGGGVCPKSVHGGTQYCVA  459


 Score =   120 bits (300),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 88/155 (57%), Gaps = 17/155 (11%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT GA   T   K +   K C + GC KGA G++ +C  HGGG+RC   G   C K   G
Sbjct  246   CTSGA---TNPLKRNTNTKCCQFPGCEKGARGASGYCIAHGGGRRCQKPG---CQKGAEG  299

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTD C+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  300   RTIYCKAHGGGRRCQYLGCTKSAEGRTDHCIAHGGGRRCSQEGCSRAARGKSGLCIKHGG  359

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC               C   A G TGLC SHG
Sbjct  360   GKRCQREN-----------CKRSAEGYTGLCISHG  383



>ref|XP_009415164.1| PREDICTED: uncharacterized protein LOC103996074 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415165.1| PREDICTED: uncharacterized protein LOC103996074 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415166.1| PREDICTED: uncharacterized protein LOC103996074 [Musa acuminata 
subsp. malaccensis]
Length=632

 Score =   359 bits (922),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 219/288 (76%), Gaps = 21/288 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC++ENCTKSAEG SG CISHGGGRRCQ+P C+KGAQGSTMFCKAHGGGKR
Sbjct  352   LCIKHGGGKRCRRENCTKSAEGHSGFCISHGGGRRCQFPACSKGAQGSTMFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP+CKGHGGGKRCLFQGGGVCPKSVHGGTL+CVAHGGGKRCAV  CT
Sbjct  412   CTFLGCTKGAEGSTPYCKGHGGGKRCLFQGGGVCPKSVHGGTLFCVAHGGGKRCAVPGCT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+  GCGKSAQGSTDFCKAHGGG RC WG   S+FG G+ PC
Sbjct  472   KSARGRTNYCVRHGGGKRCKSVGCGKSAQGSTDFCKAHGGGNRCAWGHVGSKFGTGDPPC  531

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI-TPKRTENMKEIDTTEDMDADSMT  580
               FAR K GLCA+H ALVQD  V GG TL +      T  ++  MKE+     +    M+
Sbjct  532   ERFARTKAGLCAAHDALVQDHCVRGGGTLAISTTLFPTSIKSGMMKEV----AIGGKGMS  587

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +        +GSD K  +  Q T   L       V++PEGRVHGGSL+
Sbjct  588   IW-------SGSDTK--AHPQVTQCGL-------VSLPEGRVHGGSLM  619


 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 130/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  260   KNCQFQGCVKRARGASGLCIAHGGGRRCQKPGCQKGAEGRTIFCKAHGGGRRCEHLGCTK  319

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC  +    C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  320   SAEGRTDYCIAHGGGKRCSHE---CCGRAARGKSGLCIKHGGGKRCRRENCTKSAEGHSG  376

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  377   FCISHGGGRRCQFPACSKGAQGSTMFCKAHGGGKRCTF-----------LGCTKGAEGST  425

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
               C  HG     L Q      K VHGG    V 
Sbjct  426   PYCKGHGGGKRCLFQGGGVCPKSVHGGTLFCVA  458



>gb|EAY75008.1| hypothetical protein OsI_02907 [Oryza sativa Indica Group]
Length=650

 Score =   359 bits (921),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 211/291 (73%), Gaps = 23/291 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENC +SAEG SG CISHGGGRRCQ+P+CTKGAQGST FCKAHGGGKR
Sbjct  353   LCIRHGGGKRCQKENCIRSAEGHSGFCISHGGGRRCQFPECTKGAQGSTKFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST FCKGHGGGKRCLFQGGGVCPKSVHGGT YCVAHGGGKRCA++ CT
Sbjct  413   CTFSGCNKGAEGSTLFCKGHGGGKRCLFQGGGVCPKSVHGGTQYCVAHGGGKRCAISGCT  472

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  S FG G   C
Sbjct  473   KSARGRTEYCVRHGGGKRCKFEGCAKSAQGSTDFCKAHGGGKRCSWGQVDSNFGVGAPQC  532

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  V GG       Q  T  + + M+      D  A + + 
Sbjct  533   DKFARSKTGLCSAHCALVQDHCVRGGTLGAATFQFATDAKFDEMEVTPVKGDPHAQASSD  592

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVT----IPEGRVHGGSLL  436
             ++S +  A+                   PP++P        EGRVHGG LL
Sbjct  593   DQSHLGGAH-------------------PPAVPAITSDRFSEGRVHGGGLL  624


 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 125/207 (60%), Gaps = 23/207 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  261   KNCQFPGCVKGARGASGHCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQFLGCTK  320

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +C +SA G + 
Sbjct  321   SAEGRTDHCIAHGGGRRCSHDG---CSRAARGKSGLCIRHGGGKRCQKENCIRSAEGHSG  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             CN  A G T
Sbjct  378   FCISHGGGRRCQFPECTKGAQGSTKFCKAHGGGKRCTFSG-----------CNKGAEGST  426

Query  732   GLCASHGA----LVQ-----DKRVHGG  679
               C  HG     L Q      K VHGG
Sbjct  427   LFCKGHGGGKRCLFQGGGVCPKSVHGG  453



>ref|XP_008672306.1| PREDICTED: uncharacterized protein LOC100217230 isoform X1 [Zea 
mays]
 ref|XP_008672307.1| PREDICTED: uncharacterized protein LOC100217230 isoform X1 [Zea 
mays]
 ref|XP_008672308.1| PREDICTED: uncharacterized protein LOC100217230 isoform X1 [Zea 
mays]
 ref|XP_008672309.1| PREDICTED: uncharacterized protein LOC100217230 isoform X1 [Zea 
mays]
 ref|XP_008672310.1| PREDICTED: uncharacterized protein LOC100217230 isoform X1 [Zea 
mays]
 gb|ACN31952.1| unknown [Zea mays]
 tpg|DAA58531.1| TPA: hypothetical protein ZEAMMB73_328441 [Zea mays]
 tpg|DAA58532.1| TPA: hypothetical protein ZEAMMB73_328441 [Zea mays]
Length=644

 Score =   358 bits (919),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 211/287 (74%), Gaps = 20/287 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQKENCTKSAEG SGLCI+HGGGRRCQ+P CTKGAQGST FCKAHGGGKR
Sbjct  346   LCIKHGGGKRCQKENCTKSAEGHSGLCIAHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKR  405

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCT+GAEGST FCKGHGGGKRC FQGGGVCPKSVHGGT YCVAHGGGKRCA   CT
Sbjct  406   CTFVGCTRGAEGSTSFCKGHGGGKRCAFQGGGVCPKSVHGGTQYCVAHGGGKRCASFGCT  465

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FE C KSAQGSTDFCKAHGGG RC WGQ  + FG G   C
Sbjct  466   KSARGRTEYCVRHGGGKRCKFESCTKSAQGSTDFCKAHGGGTRCLWGQADTSFGAGAQQC  525

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + F R KTGLC++H AL+QD  VHGG TLG  + +           +  TE ++ D   +
Sbjct  526   DKFVRSKTGLCSAHSALIQDHCVHGGGTLGSAIYQSV--------HVKPTEMINGDKTLL  577

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             + ++  + +G             P+L      P  +PEGRVHGG LL
Sbjct  578   DPAIPVTNSG----------VHPPVLAQSMIDP--LPEGRVHGGGLL  612


 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 121/192 (63%), Gaps = 14/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC +
Sbjct  249   RNSNAKSCQFPGCVKGARGASGRCIAHGGGRRCQKPGCEKGAEGRTIYCKAHGGGRRCQF  308

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  309   LGCTKSAEGRTDHCIAHGGGRRCSHEG---CSRAARGKSGLCIKHGGGKRCQKENCTKSA  365

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C   
Sbjct  366   EGHSGLCIAHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKRCTF-----------VGCTRG  414

Query  747   ARGKTGLCASHG  712
             A G T  C  HG
Sbjct  415   AEGSTSFCKGHG  426



>ref|XP_009112900.1| PREDICTED: uncharacterized protein LOC103838232 [Brassica rapa]
Length=650

 Score =   357 bits (917),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 192/289 (66%), Positives = 214/289 (74%), Gaps = 13/289 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E+CTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  352   LCIRHGGGKRCQREDCTKSAEGLSGLCISHGGGRRCQSSGCTKGAQGSTMFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQ G  C KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  412   CTHLGCTKGAEGSTPFCKGHGGGKRCAFQEGDPCSKSVHGGTNFCVAHGGGKRCAVPECT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEI  763
             KSARGRTDFCVRHGGGKRC+ +GCGKSAQGSTDFCKAHGGGKRC WG P +E+       
Sbjct  472   KSARGRTDFCVRHGGGKRCKSDGCGKSAQGSTDFCKAHGGGKRCAWGHPETEYAGQSSSG  531

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSM  583
             PC SFARGKTGLCA H +LVQD RV+GG T+    QE    R  + +  +  E   +  M
Sbjct  532   PCTSFARGKTGLCALHNSLVQDNRVYGGMTVTSGSQE---PRVSSSETENEEEFSGSQDM  588

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              ++R    SA+GS    I   +    +           PEGRVHGGSL+
Sbjct  589   NMDRMKARSADGSPETDIDLNEYEAGL--------GLAPEGRVHGGSLI  629


 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  260   KLCQVEGCPKGARGASGRCISHGGGRRCQRHGCQKGAEGRTVYCKAHGGGRRCEFLGCTK  319

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    C ++  G +  C+ HGGGKRC   DCTKSA G + 
Sbjct  320   SAEGRTDFCIAHGGGRRCSHED---CTRAARGRSGLCIRHGGGKRCQREDCTKSAEGLSG  376

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW------GQPSSEFGKGE-----  766
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC         + S+ F KG      
Sbjct  377   LCISHGGGRRCQSSGCTKGAQGSTMFCKAHGGGKRCTHLGCTKGAEGSTPFCKGHGGGKR  436

Query  765   ------IPCNSFARGKTGLCASHG  712
                    PC+    G T  C +HG
Sbjct  437   CAFQEGDPCSKSVHGGTNFCVAHG  460



>ref|NP_001043607.1| Os01g0621900 [Oryza sativa Japonica Group]
 dbj|BAB21076.1| disease resistance protein-like [Oryza sativa Japonica Group]
 dbj|BAF05521.1| Os01g0621900 [Oryza sativa Japonica Group]
 gb|EAZ12729.1| hypothetical protein OsJ_02649 [Oryza sativa Japonica Group]
 dbj|BAG94203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score =   357 bits (915),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/291 (64%), Positives = 210/291 (72%), Gaps = 23/291 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENC +SAEG SG CISHGGGRRCQ+P+CTKGAQGST FCKAHGGGKR
Sbjct  353   LCIRHGGGKRCQKENCIRSAEGHSGFCISHGGGRRCQFPECTKGAQGSTKFCKAHGGGKR  412

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST FCKGHGGGKRCLFQGGGVCPKSVHGGT YCVAHGGGKRCA++ CT
Sbjct  413   CTFSGCNKGAEGSTLFCKGHGGGKRCLFQGGGVCPKSVHGGTQYCVAHGGGKRCAISGCT  472

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ    FG G   C
Sbjct  473   KSARGRTEYCVRHGGGKRCKFEGCAKSAQGSTDFCKAHGGGKRCSWGQVDLNFGVGAPQC  532

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + FAR KTGLC++H ALVQD  V GG       Q  T  + + M+      D  A + + 
Sbjct  533   DKFARSKTGLCSAHCALVQDHCVRGGTLGAATFQFATDAKFDEMEVTPVKGDPHAQASSD  592

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVT----IPEGRVHGGSLL  436
             ++S +  A+                   PP++P        EGRVHGG LL
Sbjct  593   DQSHLGGAH-------------------PPAVPAITSDRFSEGRVHGGGLL  624


 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 125/207 (60%), Gaps = 23/207 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  261   KNCQFPGCVKGARGASGHCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQFLGCTK  320

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +C +SA G + 
Sbjct  321   SAEGRTDHCIAHGGGRRCSHDG---CSRAARGKSGLCIRHGGGKRCQKENCIRSAEGHSG  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             CN  A G T
Sbjct  378   FCISHGGGRRCQFPECTKGAQGSTKFCKAHGGGKRCTFSG-----------CNKGAEGST  426

Query  732   GLCASHGA----LVQ-----DKRVHGG  679
               C  HG     L Q      K VHGG
Sbjct  427   LFCKGHGGGKRCLFQGGGVCPKSVHGG  453



>ref|XP_002455972.1| hypothetical protein SORBIDRAFT_03g028290 [Sorghum bicolor]
 gb|EES01092.1| hypothetical protein SORBIDRAFT_03g028290 [Sorghum bicolor]
Length=649

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 214/291 (74%), Gaps = 17/291 (6%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQKENCTKSAEG SGLCI+HGGGRRCQ+P CTKGAQGST FCKAHGGGKRC
Sbjct  337   CIKHGGGKRCQKENCTKSAEGHSGLCIAHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKRC  396

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              + GCT+GAEGST FCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCA   CTK
Sbjct  397   TFFGCTRGAEGSTSFCKGHGGGKRCAFQGGGVCPKSVHGGTQFCVAHGGGKRCASHGCTK  456

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  + FG G   C+
Sbjct  457   SARGRTEYCVRHGGGKRCKFEGCTKSAQGSTDFCKAHGGGKRCSWGQADTSFGAGAQQCD  516

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEI---DTTEDMDAD  589
              F R KT LC++H ALVQD  VHGG TLG  + +  +  K TE    +   D  E ++ D
Sbjct  517   RFVRSKTDLCSAHSALVQDHCVHGGGTLGSAIYQFAVDVKPTEMKVALVKGDPREKINGD  576

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              + ++       +G             P+L    S+   +PEGRVHGG LL
Sbjct  577   KILLDPGSSVPNSG----------VHHPVL--VQSMVDPLPEGRVHGGGLL  615


 Score =   187 bits (474),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 132/214 (62%), Gaps = 13/214 (6%)
 Frame = -3

Query  1290  IRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCI  1111
             +R+   K CQ   C K A G SG CI+HGGG+RC    C KGA+G T++CKAHGGG+RC 
Sbjct  238   LRNNNTKSCQFPGCMKGARGASGRCIAHGGGKRCHKSGCQKGAEGRTIYCKAHGGGRRCQ  297

Query  1110  YEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKS  931
             + GCTK AEG T  C  HGGG+RC  +G   CP++  G +  C+ HGGGKRC   +CTKS
Sbjct  298   FLGCTKSAEGRTDHCIAHGGGRRCSHEG---CPRAARGKSGSCIKHGGGKRCQKENCTKS  354

Query  930   ARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEIPC  757
             A G +  C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +      FG  +G    
Sbjct  355   AEGHSGLCIAHGGGRRCQFPDCTKGAQGSTKFCKAHGGGKRCTF------FGCTRGAEGS  408

Query  756   NSFARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              SF +G  G   CA  G  V  K VHGG    V 
Sbjct  409   TSFCKGHGGGKRCAFQGGGVCPKSVHGGTQFCVA  442



>ref|XP_001771537.1| predicted protein [Physcomitrella patens]
 gb|EDQ63737.1| predicted protein, partial [Physcomitrella patens]
Length=385

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 212/299 (71%), Gaps = 23/299 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEG SGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  93    LCIRHGGGKRCQIEGCTKSAEGYSGLCISHGGGRRCQFAGCTKGAQGSTMFCKAHGGGKR  152

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI + C KGAEGSTP CKGHGGGKRC F GGG+C KSVHGGTLYCVAHGGGKRCAV  C 
Sbjct  153   CIIQDCNKGAEGSTPLCKGHGGGKRCAFDGGGICTKSVHGGTLYCVAHGGGKRCAVEGCG  212

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG------  775
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG   S FG      
Sbjct  213   KSARGRTDFCVRHGGGKRCKIEGCGKSAQGSTDFCKAHGGGKRCQWGAEGSNFGDLLKDK  272

Query  774   KGE----IPCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE-ITPKRTENMKEIDT  610
              GE     PC+ FARGKTGLCA+H ALV D++VHGG+ +G  +   + P  + +      
Sbjct  273   NGEPVSGSPCDKFARGKTGLCAAHSALVTDRQVHGGSVIGSAIAPGLAPALSRSSMSQGF  332

Query  609   TEDMDADSMTVERS-VVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             +  MD  + ++ R+        SD     F    +           ++PEGRVHGG L+
Sbjct  333   SGSMDTTNPSMSRNGRPPRPQLSDADEGVFNMGLL-----------SLPEGRVHGGGLM  380


 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 131/205 (64%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+   C K   G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC   GCTK
Sbjct  1     KVCKFRGCGKGPRGASGLCIAHGGGRRCQKHGCNKGAEGRTVYCKAHGGGRRCQNLGCTK  60

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC FQG   C K+  G +  C+ HGGGKRC +  CTKSA G + 
Sbjct  61    SAEGKTDYCIGHGGGRRCSFQG---CDKAARGRSGLCIRHGGGKRCQIEGCTKSAEGYSG  117

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC   Q  ++  +G  P C     GK
Sbjct  118   LCISHGGGRRCQFAGCTKGAQGSTMFCKAHGGGKRCII-QDCNKGAEGSTPLCKGHGGGK  176

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                CA  G  +  K VHGG    V 
Sbjct  177   R--CAFDGGGICTKSVHGGTLYCVA  199



>ref|XP_009406798.1| PREDICTED: uncharacterized protein LOC103989624 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406799.1| PREDICTED: uncharacterized protein LOC103989624 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406800.1| PREDICTED: uncharacterized protein LOC103989624 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406801.1| PREDICTED: uncharacterized protein LOC103989624 [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 211/287 (74%), Gaps = 18/287 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEG S LCISHGGGRRCQ+P C+KGAQGST+FCKAHGGGKR
Sbjct  351   LCIRHGGGKRCQRENCTKSAEGYSRLCISHGGGRRCQFPACSKGAQGSTLFCKAHGGGKR  410

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGTL+CVAHGGGKRCA+  CT
Sbjct  411   CSFSGCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTLFCVAHGGGKRCAILGCT  470

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT FCVRHGGGKRC+   C KSAQG+TDFCKAHGGGKRC W Q  S+FG G+ PC
Sbjct  471   KSARGRTSFCVRHGGGKRCKSMDCRKSAQGNTDFCKAHGGGKRCAWDQAGSKFGTGDAPC  530

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             + F+R K GLCA H ALVQD  V GG T+     EI+P +       +  +D+  D    
Sbjct  531   DRFSRTKAGLCAGHDALVQDHCVRGGGTI-----EISPTKYPASIRSEKMKDVAVDG---  582

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              + V    +     +    Q  +          V++PEGRVHGGSL+
Sbjct  583   GKRVFGFCSSETEMHSPLTQCRL----------VSLPEGRVHGGSLM  619


 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 129/206 (63%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  259   KNCQFQGCVKRARGASGLCIAHGGGRRCQKPGCQKGAEGRTIFCKAHGGGRRCEHLGCTK  318

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   C ++    +  C+ HGGGKRC   +CTKSA G + 
Sbjct  319   SAEGRTDYCIAHGGGRRCGHDG---CSRAARDKSGLCIRHGGGKRCQRENCTKSAEGYSR  375

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +    S   KG      F +G  
Sbjct  376   LCISHGGGRRCQFPACSKGAQGSTLFCKAHGGGKRCSF----SGCTKGAEGSTPFCKGHG  431

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   C+  G  V  K VHGG    V 
Sbjct  432   GGKRCSFQGGGVCPKSVHGGTLFCVA  457



>ref|XP_010671562.1| PREDICTED: uncharacterized protein LOC104888325 [Beta vulgaris 
subsp. vulgaris]
Length=626

 Score =   352 bits (902),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 214/288 (74%), Gaps = 13/288 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CIRHGGGKRC+ E+CTKSAEGL+GLCI+HGGGRRC  P+CTKGAQG T FCKAHGGGKR
Sbjct  335   FCIRHGGGKRCKIESCTKSAEGLAGLCIAHGGGRRCHVPECTKGAQGGTKFCKAHGGGKR  394

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST FCKGHGGGKRC FQGGGVC KSVHGGTLYCV+HGGGKRCAV  CT
Sbjct  395   CTFLGCNKGAEGSTAFCKGHGGGKRCTFQGGGVCTKSVHGGTLYCVSHGGGKRCAVLGCT  454

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGK-GEIP  760
             KSARGRT+FCVRHGGGKRC++EGC KSAQGSTDFCKAHGGGKRC WG   S + + G+ P
Sbjct  455   KSARGRTNFCVRHGGGKRCKYEGCEKSAQGSTDFCKAHGGGKRCLWGLQGSGYDEDGDSP  514

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C+ FARGK GLCA+H A +QDKRVHG  T+G+ ++EI    + N  +     + +A S  
Sbjct  515   CDKFARGKIGLCAAHSAQIQDKRVHGNGTVGLKMKEIA---SGNFSKCTNKINTEATS--  569

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                   T  +G D + +       P+  S  S+     EGRVHGG L+
Sbjct  570   ------TVWDGFDLQMV-LPDDDEPLFHSGQSLNSQSLEGRVHGGGLI  610


 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 117/187 (63%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CISHGGGRRCQ   C KGA+G T FCKAHGGG+RC + GCTK
Sbjct  242   KTCQFPGCQKGARGASGHCISHGGGRRCQRDGCQKGAEGRTAFCKAHGGGRRCEHLGCTK  301

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGGKRC F GG  C ++  G + +C+ HGGGKRC +  CTKSA G   
Sbjct  302   SAEGRTDFCIAHGGGKRCGFDGG--CNRAARGKSGFCIRHGGGKRCKIESCTKSAEGLAG  359

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC    C K AQG T FCKAHGGGKRC +           + CN  A G T
Sbjct  360   LCIAHGGGRRCHVPECTKGAQGGTKFCKAHGGGKRCTF-----------LGCNKGAEGST  408

Query  732   GLCASHG  712
               C  HG
Sbjct  409   AFCKGHG  415



>ref|XP_008791483.1| PREDICTED: uncharacterized protein LOC103708365 [Phoenix dactylifera]
 ref|XP_008791484.1| PREDICTED: uncharacterized protein LOC103708365 [Phoenix dactylifera]
 ref|XP_008791486.1| PREDICTED: uncharacterized protein LOC103708365 [Phoenix dactylifera]
Length=719

 Score =   352 bits (902),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 218/294 (74%), Gaps = 23/294 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCT+SAEG SGLCISHGGG+RCQ+  C+KGAQGSTMFCKAHGGGKR
Sbjct  354   LCIRHGGGKRCQRENCTRSAEGYSGLCISHGGGKRCQFSGCSKGAQGSTMFCKAHGGGKR  413

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  414   CTFLGCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTQFCVAHGGGKRCAVPGCT  473

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ EGCGKSAQGST+FCKAHGGGKRC WG            C
Sbjct  474   KSARGRTDSCVRHGGGKRCKLEGCGKSAQGSTEFCKAHGGGKRCSWGH----------VC  523

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI-TPKRTENMKEIDTTEDM-----D  595
             + FARGK GLCA+  ALVQD  VHGG+TLG  V    T  +T+ MK+I    D+     D
Sbjct  524   DRFARGKIGLCAADTALVQDHCVHGGSTLGSSVTHCPTLVKTQKMKDITAEGDVFFQKGD  583

Query  594   ADS-MTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             A S M  +       +GSD K I      MP L    S   ++PEGRV GGSL+
Sbjct  584   AYSRMGKDGESFVGWSGSDMKNI------MPHLIPCQSGSGSLPEGRVRGGSLM  631


 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 123/187 (66%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ + C K A G SGLCI+HGGGRRCQ P C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  262   KACQFQGCGKRARGASGLCIAHGGGRRCQTPGCHKGAEGRTIFCKAHGGGRRCQYLGCTK  321

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CT+SA G + 
Sbjct  322   SAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQRENCTRSAEGYSG  378

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGGKRCQF GC K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  379   LCISHGGGKRCQFSGCSKGAQGSTMFCKAHGGGKRCTF-----------LGCTKGAEGST  427

Query  732   GLCASHG  712
               C  HG
Sbjct  428   PFCKGHG  434



>ref|XP_011076067.1| PREDICTED: uncharacterized protein LOC105160403 [Sesamum indicum]
 ref|XP_011076068.1| PREDICTED: uncharacterized protein LOC105160403 [Sesamum indicum]
Length=657

 Score =   347 bits (890),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 191/328 (58%), Positives = 233/328 (71%), Gaps = 11/328 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ ENC+KSAEG+SGLCISHGGGRRCQYP+CTKGAQGSTMFCKAHGGG+R
Sbjct  334   LCIRHGGGKRCKMENCSKSAEGISGLCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRR  393

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGSTPFCKGHGGGKRC  +G   C KSVHGGTL+CV+HGGGKRCA+  CT
Sbjct  394   CTVLGCTKGAEGSTPFCKGHGGGKRCTSEG---CTKSVHGGTLFCVSHGGGKRCAMPGCT  450

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEF-GKGEIP  760
             KSARGRT +CVRHGGGKRC+F GC KSAQGSTDFCKAHGGGKRC WGQ  SEF  +G +P
Sbjct  451   KSARGRTSYCVRHGGGKRCKFAGCPKSAQGSTDFCKAHGGGKRCSWGQLGSEFSSQGAVP  510

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C+ FARGK+GLCA+H A VQ+K +HG   L    Q+ +   +   K I           T
Sbjct  511   CDKFARGKSGLCAAHNAQVQEKDIHGSFELVSTTQDTSSNTSTQTKGIFPAGTHIPYPCT  570

Query  579   VE----RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsd  412
              +    RSV + ++G     +        ++G+     +++PEGRVHGGSL++ML   + 
Sbjct  571   TDNNGARSVGSISHGHQPISLPIMAQENFVVGNACLDRLSLPEGRVHGGSLMAMLKGGTA  630

Query  411   pslssSRGTENPSE--PRKAYITHQSWM  334
              + S++   +N  E  P K++     W+
Sbjct  631   FATSNNT-QDNSGELVPEKSFPMSHRWV  657


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 130/209 (62%), Gaps = 20/209 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+ E CT+ A G SGLCI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  242   KTCRFEGCTRGARGASGLCIAHGGGRRCQKAGCQKGAEGRTVFCKAHGGGRRCQHLGCTK  301

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC  +G   C ++  G +  C+ HGGGKRC + +C+KSA G + 
Sbjct  302   SAEGRTDYCIGHGGGRRCSHEG---CSRAARGKSGLCIRHGGGKRCKMENCSKSAEGISG  358

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGG+RC             + C   A G T
Sbjct  359   LCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRRCTV-----------LGCTKGAEGST  407

Query  732   GLCASHGALVQ------DKRVHGGATLGV  664
               C  HG   +       K VHGG    V
Sbjct  408   PFCKGHGGGKRCTSEGCTKSVHGGTLFCV  436



>ref|XP_006644380.1| PREDICTED: uncharacterized protein LOC102713682 [Oryza brachyantha]
Length=646

 Score =   345 bits (886),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 209/291 (72%), Gaps = 26/291 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENC +SAEG SG CISHGGGRRCQ+P+C+KGAQGST FCKAHGGGKR
Sbjct  352   LCIRHGGGKRCQKENCIRSAEGHSGFCISHGGGRRCQFPECSKGAQGSTKFCKAHGGGKR  411

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC+KGAEGST FCKGHGGGKRC+FQGGGVCPKSVHGGT YCVAHGGGKRCA++ CT
Sbjct  412   CTFLGCSKGAEGSTLFCKGHGGGKRCIFQGGGVCPKSVHGGTQYCVAHGGGKRCAISGCT  471

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT++CVRHGGGKRC+FEGC KSAQGSTDFCKAHGGGKRC WGQ  S FG G   C
Sbjct  472   KSARGRTEYCVRHGGGKRCKFEGCAKSAQGSTDFCKAHGGGKRCSWGQVDSGFGIGAPQC  531

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FAR KTGLC++H A VQD  V GG       Q  T  + + M+      D        
Sbjct  532   EKFARSKTGLCSAHCAFVQDHCVRGGG----AYQFATDVKFDEMEVAPVNGD--------  579

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPP----SIPVTIPEGRVHGGSLL  436
                 +T  +G D + +          G PP    + P  + EGRVHGG LL
Sbjct  580   ---PLTKTSGDDDRSLLGN-------GRPPAALAATPDQLSEGRVHGGGLL  620


 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 120/187 (64%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  260   KNCQFPGCVKGARGASGRCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQFLGCTK  319

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +C +SA G + 
Sbjct  320   SAEGRTDHCIAHGGGRRCSHEG---CSRAARGKSGLCIRHGGGKRCQKENCIRSAEGHSG  376

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +           + C+  A G T
Sbjct  377   FCISHGGGRRCQFPECSKGAQGSTKFCKAHGGGKRCTF-----------LGCSKGAEGST  425

Query  732   GLCASHG  712
               C  HG
Sbjct  426   LFCKGHG  432



>ref|XP_009405756.1| PREDICTED: uncharacterized protein LOC103988833 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405757.1| PREDICTED: uncharacterized protein LOC103988833 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405758.1| PREDICTED: uncharacterized protein LOC103988833 [Musa acuminata 
subsp. malaccensis]
Length=619

 Score =   344 bits (883),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 189/233 (81%), Gaps = 1/233 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ +NCTKSAEG SGLCISHGGGRRC +  CTKGAQGST+FCKAHGGGKR
Sbjct  343   LCIRHGGGKRCQIKNCTKSAEGSSGLCISHGGGRRCHFHGCTKGAQGSTLFCKAHGGGKR  402

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C    CTKGAEGSTPFCKGHGGGKRC FQGGGVCPKSVHGGT +CVAHGGGKRCAV  C 
Sbjct  403   CTVVRCTKGAEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTSFCVAHGGGKRCAVAGCP  462

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT FCVRHGGGKRC+FEGCGKSAQGSTDFCK HGGGKRC W Q  S+F  GE  C
Sbjct  463   KSARGRTSFCVRHGGGKRCKFEGCGKSAQGSTDFCKVHGGGKRCTWSQLGSKFDVGETLC  522

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG-VVVQEITPKRTENMKEIDTTED  601
             + +ARGKTGLCA+H ALVQD  VHGG  LG    Q   P + E M ++   E+
Sbjct  523   DKYARGKTGLCAAHSALVQDHCVHGGGMLGPPTTQYPVPVKLEKMNDVAAEEE  575


 Score =   189 bits (480),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 130/218 (60%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K CQ   CTK A G S LCI+HGGGRRCQ P+C KGA+G T++CKAHGGG+RC +
Sbjct  246   RNNRTKYCQFHGCTKGARGASSLCIAHGGGRRCQRPECQKGAEGRTIYCKAHGGGRRCQH  305

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC       C ++  G +  C+ HGGGKRC + +CTKSA
Sbjct  306   LGCTKSAEGRTDYCIAHGGGRRCSHLS---CTRAARGKSGLCIRHGGGKRCQIKNCTKSA  362

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RC F GC K AQGST FCKAHGGGKRC             + C   
Sbjct  363   EGSSGLCISHGGGRRCHFHGCTKGAQGSTLFCKAHGGGKRCT-----------VVRCTKG  411

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T  C  H         G  V  K VHGG +  V 
Sbjct  412   AEGSTPFCKGHGGGKRCSFQGGGVCPKSVHGGTSFCVA  449



>emb|CDP05114.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   344 bits (882),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 213/289 (74%), Gaps = 12/289 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ ENCTKSAEG+SGLCISHGGGRRCQYP C KGAQGST+FCKAHGGGKR
Sbjct  330   LCIRHGGGKRCKMENCTKSAEGISGLCISHGGGRRCQYPTCAKGAQGSTVFCKAHGGGKR  389

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y GCTKGAEGSTP CKGHGGGKRC F+G   C KSVHGGTL+CV+HGGGKRC++  CT
Sbjct  390   CTYLGCTKGAEGSTPLCKGHGGGKRCTFEG---CTKSVHGGTLFCVSHGGGKRCSMAGCT  446

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEF-GKGEIP  760
             KSARGRT+FCVRHGGGKRC+ EGC KSAQGSTDFCKAHGGGKRC W Q  SEF G+  +P
Sbjct  447   KSARGRTNFCVRHGGGKRCKHEGCTKSAQGSTDFCKAHGGGKRCSWEQVGSEFGGQATVP  506

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSM  583
             C+ FARGK+GLCA+H A VQ+K VHG   L V +++     + E MK +         + 
Sbjct  507   CDKFARGKSGLCAAHTAQVQEKLVHGDGVLMVPILENRLFSKLERMKGVFAVSSGTDTTN  566

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 SV  S++G        K A   +         ++PEGRVHGGSL+
Sbjct  567   RGAISVGMSSHG-------HKDACCRMPPQDNLDEFSLPEGRVHGGSLM  608


 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 130/209 (62%), Gaps = 20/209 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+ E C + A G SGLCI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  238   KTCRFEGCIRGARGASGLCIAHGGGRRCQRAGCQKGAEGRTVFCKAHGGGRRCQHLGCTK  297

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC GHGGG+RC   G   C ++  G +  C+ HGGGKRC + +CTKSA G + 
Sbjct  298   SAEGRTDFCIGHGGGRRCNHDG---CTRAARGKSGLCIRHGGGKRCKMENCTKSAEGISG  354

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +           + C   A G T
Sbjct  355   LCISHGGGRRCQYPTCAKGAQGSTVFCKAHGGGKRCTY-----------LGCTKGAEGST  403

Query  732   GLCASHGALVQ------DKRVHGGATLGV  664
              LC  HG   +       K VHGG    V
Sbjct  404   PLCKGHGGGKRCTFEGCTKSVHGGTLFCV  432



>ref|XP_004965502.1| PREDICTED: hornerin-like isoform X1 [Setaria italica]
 ref|XP_004965503.1| PREDICTED: hornerin-like isoform X2 [Setaria italica]
Length=626

 Score =   338 bits (868),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 206/290 (71%), Gaps = 22/290 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQKENCTKSAEG SG CI+HGGGRRC++  CTKGAQGST FCK+HGGGKR
Sbjct  329   LCIKHGGGKRCQKENCTKSAEGQSGFCIAHGGGRRCKHEGCTKGAQGSTNFCKSHGGGKR  388

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +  C+KGAEGST FCKGHGGGKRC  +G   CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  389   CTHPNCSKGAEGSTLFCKGHGGGKRCGAEG---CPKSVHGGTEFCVAHGGGKRCVVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRCQF GC KSAQGSTDFCKAHGGGKRC WGQP SE G    PC
Sbjct  446   KSARGRTDCCVRHGGGKRCQFAGCSKSAQGSTDFCKAHGGGKRCLWGQPGSELGTSSTPC  505

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               F+RGK GLC +H ALV+D RV GG TLG +                 +     ++M  
Sbjct  506   ERFSRGKNGLCVAHNALVEDSRVRGGETLGAM----------------GSPGPVVNNMVS  549

Query  576   ERSVVTSANGSDWKYISFKQATMPIL---GSPPSIPVTIPEGRVHGGSLL  436
               S+  +A+G  +   +F +    IL    + P  P++ PEGRV GG+++
Sbjct  550   HGSISRTADGEAFNPFNFSERASNILRPAETLPQAPISAPEGRVRGGNIV  599


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 132/210 (63%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C +  C+K A G SG CISHGGGRRCQ   C +GA+G T+FCK+HGGG+RC + GCTK
Sbjct  237   KICSQPGCSKGARGSSGRCISHGGGRRCQREGCKRGAEGKTIFCKSHGGGRRCEHLGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C K+  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  297   SAEGRTDFCIAHGGGRRCRNEG---CKKAARGKSGLCIKHGGGKRCQKENCTKSAEGQSG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RC+ EGC K AQGST+FCK+HGGGKRC    P+         C+  A G T
Sbjct  354   FCIAHGGGRRCKHEGCTKGAQGSTNFCKSHGGGKRCT--HPN---------CSKGAEGST  402

Query  732   GLCASH------GALVQDKRVHGGATLGVV  661
               C  H      GA    K VHGG    V 
Sbjct  403   LFCKGHGGGKRCGAEGCPKSVHGGTEFCVA  432



>ref|XP_006842938.1| PREDICTED: uncharacterized protein LOC18432776 [Amborella trichopoda]
 gb|ERN04613.1| hypothetical protein AMTR_s00075p00169840 [Amborella trichopoda]
Length=658

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 191/288 (66%), Positives = 211/288 (73%), Gaps = 10/288 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEG SGLCISHGGGRRCQYP C+KGAQGST FCKAHGGGKR
Sbjct  358   LCIRHGGGKRCQHEGCTKSAEGFSGLCISHGGGRRCQYPACSKGAQGSTPFCKAHGGGKR  417

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVT-DC  940
             C   GCTKGAEGSTPFCKGHGGGKRC F GGGVCPKSVHGGT +CVAHGGGKRCA    C
Sbjct  418   CTVPGCTKGAEGSTPFCKGHGGGKRCSFGGGGVCPKSVHGGTRFCVAHGGGKRCAAPGGC  477

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTDFCVRHGGGKRC+++GCGKSAQGSTDFCKAHGGGKRC WG  S +   G   
Sbjct  478   TKSARGRTDFCVRHGGGKRCKYDGCGKSAQGSTDFCKAHGGGKRCSWGTHSQDQQGG---  534

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C+ FARGKTGLCA+H ALVQDKRVHGG +    +   +    E  + I     M + + +
Sbjct  535   CDRFARGKTGLCAAHSALVQDKRVHGGGS----LGLPSSSSYEKQQPIVIVRPMTSTTTS  590

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 V   A  S      F +     LG   +   ++PEGRVHGGSL+
Sbjct  591   SADKVEFVAGKSIGHCCGFPEVHARGLGGAGT--SSLPEGRVHGGSLM  636


 Score =   171 bits (433),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 124/218 (57%), Gaps = 36/218 (17%)
 Frame = -3

Query  1290  IRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCI  1111
             +R+G G+ CQ + C K A G SGLCI+HGGGRRCQ   C KGA+G T +CKAHGGG+RC 
Sbjct  260   VRNGNGRNCQFKGCRKGARGASGLCIAHGGGRRCQKLGCHKGAEGRTAYCKAHGGGRRCQ  319

Query  1110  YEGCTKGAEGSTPFCKG-------------------------HGGGKRCLFQGGGVCPKS  1006
             + GCTK AEG T  C                           HGGGKRC  +G   C KS
Sbjct  320   FLGCTKSAEGRTDLCIAHGGGRRCGRDGCTRAARGKSGLCIRHGGGKRCQHEG---CTKS  376

Query  1005  VHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKA  826
               G +  C++HGGG+RC    C+K A+G T FC  HGGGKRC   GC K A+GST FCK 
Sbjct  377   AEGFSGLCISHGGGRRCQYPACSKGAQGSTPFCKAHGGGKRCTVPGCTKGAEGSTPFCKG  436

Query  825   HGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             HGGGKRC        FG G + C     G T  C +HG
Sbjct  437   HGGGKRC-------SFGGGGV-CPKSVHGGTRFCVAHG  466



>emb|CBI34417.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 215/320 (67%), Gaps = 36/320 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ + C K A G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC +
Sbjct  220   RSTSSKTCQFKGCGKGARGASGLCIAHGGGRRCQKTGCHKGAEGRTVYCKAHGGGRRCEF  279

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +    C K   G T+YC AHGGGKRC V +CTKSA
Sbjct  280   LGCTKSAEGRTDYCIAHGGGRRCSHE---ACTKGAQGSTMYCKAHGGGKRCTVPECTKSA  336

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
             RGRTD+CVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQ  S+FG  + PC+SF
Sbjct  337   RGRTDYCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCSWGQVGSQFGSQDGPCSSF  396

Query  747   ARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVERS  568
             ARGKTGLCASH ALVQDKRVHGGATL   VQ  +P + E MK++  TEDM+ D M +   
Sbjct  397   ARGKTGLCASHNALVQDKRVHGGATLAHTVQIPSPSKPEKMKDVVATEDMNVDIMKM---  453

Query  567   VVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslssSRG  388
                                M IL          PEGRVHGGSL++MLA +   S S S+ 
Sbjct  454   -------------------MGILA---------PEGRVHGGSLMAMLAGSPGLSPSDSKT  485

Query  387   TEN--PSEPRKAYITHQSWM  334
               +  PSEPRK Y+  QSWM
Sbjct  486   LISGGPSEPRKPYMMPQSWM  505



>gb|KHN25665.1| Putative WRKY transcription factor 19 [Glycine soja]
Length=721

 Score =   337 bits (864),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 211/293 (72%), Gaps = 11/293 (4%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CIRHGGGKRC++ENCTK++EGL GLCIS GGG RCQ   CT+GAQGSTMFCKAHGGGKRC
Sbjct  401   CIRHGGGKRCERENCTKNSEGLPGLCISRGGGCRCQASGCTEGAQGSTMFCKAHGGGKRC  460

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
                GCTKGAEG+TP CKGHGGGK C   GGG+C KSVHGGT +CVAHGGG RC+V DC K
Sbjct  461   TAPGCTKGAEGTTPLCKGHGGGKCCADHGGGICTKSVHGGTNFCVAHGGGMRCSVPDCMK  520

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE-IPC  757
             SAR ++D+C+ HGGGKRC+FEGCGKSA G TDFC AHGG KRC WG P SE+   +   C
Sbjct  521   SARQQSDYCICHGGGKRCKFEGCGKSAPGGTDFCNAHGGRKRCSWGHPGSEYINQQGGSC  580

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             +SFARGKTGLCA H  LV DKRVHGG TLG V+Q+    + +  K+I   +D+D D M +
Sbjct  581   SSFARGKTGLCALHSGLVLDKRVHGGVTLGPVIQDSHVSKLDEPKQIVINQDIDVDMMKM  640

Query  576   ----ERSVVTSANGSDWKYISFKQATMPI--LGSPPSIPVTIPEGRVHGGSLL  436
                    V+T    SD K        +P    G  P + V +PEGRVHGGSL+
Sbjct  641   GSPRAAGVITC---SDVKLNEVASTRLPSGEDGHTP-MSVAVPEGRVHGGSLM  689


 Score =   167 bits (424),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 123/209 (59%), Gaps = 7/209 (3%)
 Frame = -3

Query  1284  HGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYE  1105
             +   K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CK+HG G+ C Y 
Sbjct  304   NSNSKTCQVEGCGKGARGASGRCISHGGGRRCQKPGCNKGAEGRTVYCKSHGEGRGCEYL  363

Query  1104  GCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSAR  925
              CT   EG T FC  HGG +RC  +G   C ++  G +  C+ HGGGKRC   +CTK++ 
Sbjct  364   SCTNSVEGHTNFCIAHGGDQRCSHEG---CFRAARGKSGSCIRHGGGKRCERENCTKNSE  420

Query  924   GRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSF  748
             G    C+  GGG RCQ  GC + AQGST FCKAHGGGKRC      ++  +G  P C   
Sbjct  421   GLPGLCISRGGGCRCQASGCTEGAQGSTMFCKAHGGGKRCT-APGCTKGAEGTTPLCKGH  479

Query  747   ARGKTGLCASHGALVQDKRVHGGATLGVV  661
               GK   CA HG  +  K VHGG    V 
Sbjct  480   GGGKC--CADHGGGICTKSVHGGTNFCVA  506



>ref|XP_003517492.1| PREDICTED: uncharacterized protein LOC100809074 isoform X1 [Glycine 
max]
 ref|XP_006573797.1| PREDICTED: uncharacterized protein LOC100809074 isoform X2 [Glycine 
max]
 ref|XP_006573798.1| PREDICTED: uncharacterized protein LOC100809074 isoform X3 [Glycine 
max]
 ref|XP_006573799.1| PREDICTED: uncharacterized protein LOC100809074 isoform X4 [Glycine 
max]
Length=670

 Score =   335 bits (860),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 181/293 (62%), Positives = 210/293 (72%), Gaps = 11/293 (4%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CIRHGGGKRC+ ENCTK++EGL GLCIS GGG RCQ   CT+GAQGSTMFCKAHGGGKRC
Sbjct  350   CIRHGGGKRCEIENCTKNSEGLPGLCISRGGGCRCQASGCTEGAQGSTMFCKAHGGGKRC  409

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
                GCTKGAEG+TP CKGHGGGK C   GGG+C KSVHGGT +CVAHGGG RC+V DC K
Sbjct  410   TAPGCTKGAEGTTPLCKGHGGGKCCADHGGGICTKSVHGGTNFCVAHGGGMRCSVPDCMK  469

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE-IPC  757
             SAR ++D+C+ HGGGKRC+FEGCGKSA G TDFC AHGG KRC WG P SE+   +   C
Sbjct  470   SARQQSDYCICHGGGKRCKFEGCGKSAPGGTDFCNAHGGRKRCSWGHPGSEYINQQGGSC  529

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             +SFARGKTGLCA H  LV DKRVHGG TLG V+Q+    + +  K+I   +D+D D M +
Sbjct  530   SSFARGKTGLCALHSGLVLDKRVHGGVTLGPVIQDSHVSKLDEPKQIVINQDIDVDMMKM  589

Query  576   ----ERSVVTSANGSDWKYISFKQATMPI--LGSPPSIPVTIPEGRVHGGSLL  436
                    V+T    SD K        +P    G  P + V +PEGRVHGGSL+
Sbjct  590   GSPRAAGVITC---SDVKLNEVASTRLPSGEDGHTP-MSVAVPEGRVHGGSLM  638


 Score =   169 bits (429),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 123/205 (60%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CK+HG G+ C Y  CT 
Sbjct  257   KTCQVEGCGKGARGASGRCISHGGGRRCQKPGCNKGAEGRTVYCKSHGEGRGCEYLSCTN  316

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
               EG T FC  HGG +RC  +G   C ++  G +  C+ HGGGKRC + +CTK++ G   
Sbjct  317   SVEGHTNFCIAHGGDQRCSHEG---CFRAARGKSGSCIRHGGGKRCEIENCTKNSEGLPG  373

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+  GGG RCQ  GC + AQGST FCKAHGGGKRC      ++  +G  P C     GK
Sbjct  374   LCISRGGGCRCQASGCTEGAQGSTMFCKAHGGGKRCT-APGCTKGAEGTTPLCKGHGGGK  432

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                CA HG  +  K VHGG    V 
Sbjct  433   --CCADHGGGICTKSVHGGTNFCVA  455



>ref|XP_001760338.1| predicted protein [Physcomitrella patens]
 gb|EDQ74729.1| predicted protein, partial [Physcomitrella patens]
Length=313

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 181/220 (82%), Gaps = 10/220 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CTKSAEG SGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  93    LCIRHGGGKRCQIEGCTKSAEGYSGLCISHGGGRRCQFAGCTKGAQGSTMFCKAHGGGKR  152

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI + C KGAEGSTP CKGHGGGKRC F GGG+C KSVHGGTL+CVAHGGGKRCAV  C 
Sbjct  153   CIIQDCNKGAEGSTPLCKGHGGGKRCAFDGGGICTKSVHGGTLFCVAHGGGKRCAVEGCG  212

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGK-----  772
             KSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WG     FG+     
Sbjct  213   KSARGRTDFCVRHGGGKRCKVEGCGKSAQGSTDFCKAHGGGKRCQWGTEGFNFGELVRDK  272

Query  771   -----GEIPCNSFARGKTGLCASHGALVQDKRVHGGATLG  667
                     PC+ FARGKTGLCA+H ALV D++VHGG+ +G
Sbjct  273   NKEPVSGAPCDKFARGKTGLCAAHSALVTDRQVHGGSAVG  312


 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 131/205 (64%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+   C K   G SGLCI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC   GCTK
Sbjct  1     KVCKFRGCGKGPRGASGLCIAHGGGRRCQKHGCNKGAEGRTVYCKAHGGGRRCQSLGCTK  60

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC FQG   C K+  G +  C+ HGGGKRC +  CTKSA G + 
Sbjct  61    SAEGKTDYCIGHGGGRRCSFQG---CGKAARGRSGLCIRHGGGKRCQIEGCTKSAEGYSG  117

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC   Q  ++  +G  P C     GK
Sbjct  118   LCISHGGGRRCQFAGCTKGAQGSTMFCKAHGGGKRCII-QDCNKGAEGSTPLCKGHGGGK  176

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                CA  G  +  K VHGG    V 
Sbjct  177   R--CAFDGGGICTKSVHGGTLFCVA  199



>ref|XP_002968151.1| hypothetical protein SELMODRAFT_33558, partial [Selaginella moellendorffii]
 ref|XP_002994499.1| hypothetical protein SELMODRAFT_23229, partial [Selaginella moellendorffii]
 gb|EFJ04434.1| hypothetical protein SELMODRAFT_23229, partial [Selaginella moellendorffii]
 gb|EFJ30405.1| hypothetical protein SELMODRAFT_33558, partial [Selaginella moellendorffii]
Length=304

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 182/212 (86%), Gaps = 7/212 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ E CTKSAEGLSGLCISHGGGRRCQ P CTKGAQGSTMFCKAHGGGKR
Sbjct  93    LCIKHGGGKRCQHEGCTKSAEGLSGLCISHGGGRRCQVPGCTKGAQGSTMFCKAHGGGKR  152

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C+ EGC KGAEGSTP CKGHGGGKRC+F+GGG+CPKSVHGGT +CVAHGGGKRCAV DC+
Sbjct  153   CMIEGCGKGAEGSTPLCKGHGGGKRCMFEGGGICPKSVHGGTQFCVAHGGGKRCAVQDCS  212

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE---  766
             KSARGRT FCV+HGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQ  S +G  E   
Sbjct  213   KSARGRTAFCVKHGGGKRCKTEGCGKSAQGSTDFCKAHGGGKRCTWGQEGSLYGPREGSS  272

Query  765   ----IPCNSFARGKTGLCASHGALVQDKRVHG  682
                  PC+ FARGK GLCA+H ++VQ+++  G
Sbjct  273   ELSKGPCDRFARGKLGLCAAHSSIVQEEKASG  304


 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 127/205 (62%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C+   C K A G SGLCI+HGGGRRCQ   C+KGA+G T +CKAHGGG+RC   GCTK
Sbjct  1     KACKFAGCGKGARGASGLCIAHGGGRRCQKDGCSKGAEGRTAYCKAHGGGRRCQTLGCTK  60

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C GHGGG+RC ++G   C K+  G +  C+ HGGGKRC    CTKSA G + 
Sbjct  61    SAEGKTDLCIGHGGGRRCAYEG---CTKAARGRSGLCIKHGGGKRCQHEGCTKSAEGLSG  117

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC   +   +  +G  P C     GK
Sbjct  118   LCISHGGGRRCQVPGCTKGAQGSTMFCKAHGGGKRCMI-EGCGKGAEGSTPLCKGHGGGK  176

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  177   R--CMFEGGGICPKSVHGGTQFCVA  199



>ref|XP_006584992.1| PREDICTED: uncharacterized protein LOC102666151 [Glycine max]
Length=639

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 182/315 (58%), Positives = 213/315 (68%), Gaps = 37/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +C KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQYQECNKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  380   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVAHGGGKRCAVAGCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC++EGCGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  440   KSARGRTDCCVRHGGGKRCKYEGCGKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT------ENMKEIDTTEDM  598
               FARGK+GLCA+H +LVQ++ ++ G  +   + + + P  +      EN      +   
Sbjct  491   EKFARGKSGLCAAHSSLVQEREMNKGGLIAPGLFRGLVPSASTACSSFENNSSSGVSVLS  550

Query  597   DA-DSM--------TVERSVVTSANGSDWKYISFKQATMPIL------------GSPPSI  481
             D+ DSM         + + V+   +     Y SF  A                 G+   I
Sbjct  551   DSYDSMETPAKRQHLIPKEVLVPLSMKSPSYSSFLAAKKSDQDRNCQSLAAGGSGAQKGI  610

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  611   DFNLPEGRVHGGDLM  625


 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 130/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KRCRFFGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC + GG  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  287   SAEGKTDYCIAHGGGRRCGYPGG--CNKAARGKSGLCIRHGGGKRCRIEGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ++ C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  345   LCISHGGGRRCQYQECNKGAQGSTMYCKAHGGGKRCSFAG-----------CTKGAEGST  393

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  394   PLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVA  426



>ref|XP_006580009.1| PREDICTED: uncharacterized protein LOC100806841 isoform X1 [Glycine 
max]
 ref|XP_006580010.1| PREDICTED: uncharacterized protein LOC100806841 isoform X2 [Glycine 
max]
 ref|XP_006580011.1| PREDICTED: uncharacterized protein LOC100806841 isoform X3 [Glycine 
max]
Length=639

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 211/315 (67%), Gaps = 37/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +C+KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQYQECSKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GG +CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  380   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGSICPKSVHGGTNFCVAHGGGKRCAVAGCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  440   KSARGRTDCCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT------EN---------M  625
               FARGK+GLCA+H +LVQ++ ++ G+ +   + + + P  +      EN          
Sbjct  491   EKFARGKSGLCAAHSSLVQEREMNKGSLIAPGLFRGLVPSASTACSSFENNSSSGVSVLS  550

Query  624   KEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPIL------------GSPPSI  481
                D+ E        + + V+   +     Y +F  A  P               +   +
Sbjct  551   DSYDSVETPAKRQHLIPKEVLVPLSMKSPSYSNFLAAKKPDQDRNCQSSAAGCSSAQKGL  610

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  611   DFNLPEGRVHGGDLM  625


 Score =   187 bits (475),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KRCRFFGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  287   SAEGKTDYCIAHGGGRRCGYPDG--CTKAARGKSGLCIRHGGGKRCRIEGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ++ C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  345   LCISHGGGRRCQYQECSKGAQGSTMYCKAHGGGKRCSFAG-----------CTKGAEGST  393

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  394   PLCKAHGGGKRCLFNGGSICPKSVHGGTNFCVA  426



>ref|XP_010939550.1| PREDICTED: uncharacterized protein LOC105058355 [Elaeis guineensis]
 ref|XP_010939551.1| PREDICTED: uncharacterized protein LOC105058355 [Elaeis guineensis]
 ref|XP_010939552.1| PREDICTED: uncharacterized protein LOC105058355 [Elaeis guineensis]
 ref|XP_010939553.1| PREDICTED: uncharacterized protein LOC105058355 [Elaeis guineensis]
Length=653

 Score =   327 bits (839),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/312 (59%), Positives = 206/312 (66%), Gaps = 38/312 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CT+SAEG +GLCISHGGGRRCQ+  C KGAQGSTMFCKAHGGGKR
Sbjct  340   LCIRHGGGKRCTVEGCTRSAEGQAGLCISHGGGRRCQFTGCCKGAQGSTMFCKAHGGGKR  399

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEGSTP CKGHGGGKRC F+GGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  400   CIFEGCTKGAEGSTPLCKGHGGGKRCRFEGGGVCPKSVHGGTDFCVAHGGGKRCAVPACT  459

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WGQ           C
Sbjct  460   KSARGRTDCCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCTWGQ----------GC  509

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTT------EDMD  595
               FARGK+GLCA+HG+LV  ++       G +   I P     +  I TT       +  
Sbjct  510   EKFARGKSGLCAAHGSLVLSQQEREAGKSGSM---IGPGLFHGIVSISTTVGSSIDNEHP  566

Query  594   ADSMTVERSVVTSANGSDWKYISFKQATMPILGSPP-------------------SIPVT  472
             + +M+     V S        +   Q  +P+    P                   S    
Sbjct  567   SSAMSTLWDCVESQESLGRMQLIPSQVLVPLSMKSPSQSSGLTDVGRDGAGSQKKSFGFV  626

Query  471   IPEGRVHGGSLL  436
             IPEGRVHGG L+
Sbjct  627   IPEGRVHGGGLM  638


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 126/213 (59%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  248   KKCRFNGCSKGARGSSGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLGCTK  307

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  308   SAEGKTDFCIAHGGGRRCAHAG---CTKAARGKSGLCIRHGGGKRCTVEGCTRSAEGQAG  364

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  365   LCISHGGGRRCQFTGCCKGAQGSTMFCKAHGGGKRCIFEG-----------CTKGAEGST  413

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG    V 
Sbjct  414   PLCKGHGGGKRCRFEGGGVCPKSVHGGTDFCVA  446



>gb|KHN24351.1| Putative WRKY transcription factor 19 [Glycine soja]
Length=639

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 179/315 (57%), Positives = 211/315 (67%), Gaps = 37/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +C+KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQYQECSKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GG +CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  380   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGSICPKSVHGGTNFCVAHGGGKRCAVAGCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  440   KSARGRTDCCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT------EN---------M  625
               FARGK+GLCA+H +LVQ++ ++ G+ +   + + + P  +      EN          
Sbjct  491   EKFARGKSGLCAAHSSLVQEREMNKGSLIAPGLFRGLVPSASTACSSFENNSSSGVSVLS  550

Query  624   KEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPIL------------GSPPSI  481
                D+ E        + + V+   +     Y +F  A                 G+   I
Sbjct  551   DSYDSVETPAKRQHLIPKEVLVPLSMKSPSYSNFLAAKKSDQDRNCQSLAAGGSGAQKGI  610

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  611   DFNLPEGRVHGGDLM  625


 Score =   187 bits (475),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KRCRFFGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  287   SAEGKTDYCIAHGGGRRCGYPDG--CTKAARGKSGLCIRHGGGKRCRIEGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ++ C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  345   LCISHGGGRRCQYQECSKGAQGSTMYCKAHGGGKRCSFAG-----------CTKGAEGST  393

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  394   PLCKAHGGGKRCLFNGGSICPKSVHGGTNFCVA  426



>ref|XP_004504771.1| PREDICTED: uncharacterized protein LOC101489214 isoform X1 [Cicer 
arietinum]
 ref|XP_004504772.1| PREDICTED: uncharacterized protein LOC101489214 isoform X2 [Cicer 
arietinum]
 ref|XP_004504773.1| PREDICTED: uncharacterized protein LOC101489214 isoform X3 [Cicer 
arietinum]
Length=636

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 210/316 (66%), Gaps = 38/316 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +C+KGAQGSTMFCKAHGGGKR
Sbjct  316   LCIRHGGGKRCKIEGCTRSAEGQAGLCISHGGGRRCQYRECSKGAQGSTMFCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT YCVAHGGGKRCAV+ CT
Sbjct  376   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGGICPKSVHGGTNYCVAHGGGKRCAVSGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  436   KSARGRTDCCVRHGGGKRCRFDSCGKSAQGSTDFCKAHGGGKRCNWGD-----GK----C  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTE----------------N  628
               FARGK+GLCA+H +LVQ+  ++ G+ +   + + + P  +                  
Sbjct  487   EKFARGKSGLCAAHCSLVQESGMNKGSLIAPGLFRGLVPSASTACSSFENNNSSSGVSVV  546

Query  627   MKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPIL------------GSPPS  484
                 D+ E        + + V+   +     Y +F  A  P              G+   
Sbjct  547   SDSYDSMETPTRRQHLIPKEVLVPLSMKSPSYSNFLAANKPAQDRNLHSIAAGCSGAKKG  606

Query  483   IPVTIPEGRVHGGSLL  436
             +   +PEGRVHGG L+
Sbjct  607   LDFDLPEGRVHGGDLM  622


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 121/187 (65%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  223   KRCRFFGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  283   SAEGKTDYCIAHGGGRRCGYPDG--CTKAARGKSGLCIRHGGGKRCKIEGCTRSAEGQAG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQYRECSKGAQGSTMFCKAHGGGKRCSFAG-----------CTKGAEGST  389

Query  732   GLCASHG  712
              LC +HG
Sbjct  390   PLCKAHG  396



>gb|KHN39202.1| Putative WRKY transcription factor 19 [Glycine soja]
Length=634

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 213/315 (68%), Gaps = 37/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +C KGAQGSTM+CKAHGGGKR
Sbjct  315   LCIRHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQYQECNKGAQGSTMYCKAHGGGKR  374

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  375   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVAHGGGKRCAVAGCT  434

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC++EGCGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  435   KSARGRTDCCVRHGGGKRCKYEGCGKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  485

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT------ENMKEIDTTEDM  598
               FARGK+GLCA+H +LVQ++ ++ G  +   + + + P  +      EN      +   
Sbjct  486   EKFARGKSGLCAAHSSLVQEREMNKGGLIAPGLFRGLVPSASTACSSFENNSSSGVSVLS  545

Query  597   DA-DSM--------TVERSVVTSANGSDWKYISFKQATMPIL------------GSPPSI  481
             D+ DSM         + + V+   +     Y +F  A                 G+   I
Sbjct  546   DSYDSMETPAKRQHLIPKEVLVPLSMKSPSYSNFLAAKKSDQDRNCQSLAAGGSGAQKGI  605

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  606   DFNLPEGRVHGGDLM  620


 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 127/213 (60%), Gaps = 27/213 (13%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KRCRFFGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +     GG+RC + GG  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  287   SAEGKTDY-----GGRRCGYPGG--CNKAARGKSGLCIRHGGGKRCRIEGCTRSAEGQAG  339

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ++ C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  340   LCISHGGGRRCQYQECNKGAQGSTMYCKAHGGGKRCSFAG-----------CTKGAEGST  388

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  389   PLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVA  421



>ref|XP_007222059.1| hypothetical protein PRUPE_ppa003189mg [Prunus persica]
 gb|EMJ23258.1| hypothetical protein PRUPE_ppa003189mg [Prunus persica]
Length=594

 Score =   324 bits (831),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 212/318 (67%), Gaps = 42/318 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQY  C KGAQGSTM+CKAHGGGKR
Sbjct  274   LCIRHGGGKRCKVDGCTRSAEGQAGLCISHGGGRRCQYQGCAKGAQGSTMYCKAHGGGKR  333

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  334   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  393

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W     E GK    C
Sbjct  394   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW-----EEGK----C  444

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++VQD+ ++ G  +G  +   +    +      D   +  +  ++
Sbjct  445   EKFARGKSGLCAAHSSMVQDREINKGGLIGPGLFHGLVSASSTAGSSFDN--NHSSSGIS  502

Query  579   VERSVVTSANGSDWKYISFKQATMPI-----------LGSP-------------------  490
             V    V S      +++   Q  +P+            GS                    
Sbjct  503   VISDSVESLEKPGKRHLIPSQVLVPLSMKSSSSYSNFFGSEKPDEQRNEYGIGVDSSDGI  562

Query  489   PSIPVTIPEGRVHGGSLL  436
              S+   IPEGRVHGG L+
Sbjct  563   KSLDFKIPEGRVHGGPLM  580


 Score =   189 bits (479),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  181   KKCKFFGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  240

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  241   SAEGKTDYCIAHGGGKRCGYPGG--CTKAARGRSGLCIRHGGGKRCKVDGCTRSAEGQAG  298

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ++GC K AQGST +CKAHGGGKRC + Q  ++  +G  P C     GK
Sbjct  299   LCISHGGGRRCQYQGCAKGAQGSTMYCKAHGGGKRCIF-QGCTKGAEGSTPLCKGHGGGK  357

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  358   R--CLFDGGGICPKSVHGGTNFCVA  380



>ref|XP_007159079.1| hypothetical protein PHAVU_002G206700g [Phaseolus vulgaris]
 gb|ESW31073.1| hypothetical protein PHAVU_002G206700g [Phaseolus vulgaris]
Length=633

 Score =   325 bits (834),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 207/313 (66%), Gaps = 35/313 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  + CT+SAEG +GLCISHGGGRRCQ   CTKGAQGSTM+CKAHGGGKR
Sbjct  316   LCIRHGGGKRCTIDGCTRSAEGQAGLCISHGGGRRCQLEGCTKGAQGSTMYCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  376   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVAHGGGKRCAVAGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  436   KSARGRTDCCVRHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRT-------ENMKEIDTTEDM  598
               FARGK+GLCA+H +LVQ++ ++ G     + + + P  +        N     +    
Sbjct  487   EKFARGKSGLCAAHSSLVQEREMNKGLIAPGLFRGLVPAASTACSSFENNSSSGVSVVSD  546

Query  597   DADSM-------TVERSVVTSANGSDWKYISFKQATMPILGSPPSIPV------------  475
               DSM        + + V+   +     Y +F  A  P        PV            
Sbjct  547   SYDSMETPPQRNLIPKEVLVPVSMKSPSYSNFLTAKKPDQDRNCHSPVEGCSTAQKGLDF  606

Query  474   TIPEGRVHGGSLL  436
              +PEGRVHGG L+
Sbjct  607   NLPEGRVHGGDLM  619


 Score =   189 bits (481),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  223   KRCRFFGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  283   SAEGKTDYCIAHGGGRRCGYSDG--CTKAARGKSGLCIRHGGGKRCTIDGCTRSAEGQAG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ EGC K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQLEGCTKGAQGSTMYCKAHGGGKRCSFAG-----------CTKGAEGST  389

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  390   PLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVA  422



>ref|XP_002437055.1| hypothetical protein SORBIDRAFT_10g020110 [Sorghum bicolor]
 gb|EER88422.1| hypothetical protein SORBIDRAFT_10g020110 [Sorghum bicolor]
Length=619

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 203/290 (70%), Gaps = 29/290 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQKENCTKSAEG SG CI+HGGGRRC++  CTKGAQGST FCK+HGGGKR
Sbjct  329   LCIKHGGGKRCQKENCTKSAEGQSGFCIAHGGGRRCKHEGCTKGAQGSTSFCKSHGGGKR  388

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y  C+KGAEGST FCKGHGGGKRC  +G   CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  389   CTYPNCSKGAEGSTLFCKGHGGGKRCAAEG---CPKSVHGGTEFCVAHGGGKRCVVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRCQF GC KSAQGSTDFCKAHGGGKRC WGQ  S+ G G  PC
Sbjct  446   KSARGRTDCCVRHGGGKRCQFAGCSKSAQGSTDFCKAHGGGKRCLWGQLGSDLGAGSSPC  505

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               F+RGK GLC +H ALV+D RV GG TLG                + ++  +   + T+
Sbjct  506   ERFSRGKNGLCVAHNALVEDSRVRGGETLGA---------------MGSSGSVMNSTGTM  550

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSI---PVTIPEGRVHGGSLL  436
             E     S+N        F + T  +     ++    ++ PEGRV GG+++
Sbjct  551   ESGAFDSSN--------FGEGTSNVAHPAEALGHTLISAPEGRVRGGNIM  592


 Score =   186 bits (473),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 129/210 (61%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C +  C K A G SG CISHGGGRRCQ   C +GA+G T+FCKAHGGG+RC + GCTK
Sbjct  237   KTCSEPGCFKGARGSSGRCISHGGGRRCQREGCKRGAEGKTIFCKAHGGGRRCEHLGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C K+  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  297   SAEGRTDFCIAHGGGRRCSNEG---CKKAARGKSGLCIKHGGGKRCQKENCTKSAEGQSG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RC+ EGC K AQGST FCK+HGGGKRC +             C+  A G T
Sbjct  354   FCIAHGGGRRCKHEGCTKGAQGSTSFCKSHGGGKRCTYPN-----------CSKGAEGST  402

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C  HG   +       K VHGG    V 
Sbjct  403   LFCKGHGGGKRCAAEGCPKSVHGGTEFCVA  432



>ref|XP_010243331.1| PREDICTED: uncharacterized protein LOC104587418 [Nelumbo nucifera]
Length=640

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 211/306 (69%), Gaps = 38/306 (12%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CIRHGGGKRC  E CT+SAEG +GLCISHGGGRRCQ+P CTKGAQGSTM+CKAHGGGKRC
Sbjct  329   CIRHGGGKRCNVEGCTRSAEGQAGLCISHGGGRRCQFPGCTKGAQGSTMYCKAHGGGKRC  388

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I+ GCTKGAEGSTP CKGHGGGKRCLFQGGG+CPKSVHGGT YCVAHGGGKRCAV  CTK
Sbjct  389   IFAGCTKGAEGSTPLCKGHGGGKRCLFQGGGICPKSVHGGTDYCVAHGGGKRCAVPGCTK  448

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC WGQ +         C 
Sbjct  449   SARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTWGQGT---------CE  499

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT--ENMKEIDTTEDMDADSM  583
              FARGK+GLCA+H ++VQD+    G  +G  + + + P  T   +M+   ++  + A S 
Sbjct  500   KFARGKSGLCAAHSSMVQDRNTDKGNMIGPGLFRGLVPVSTVGSSMENEYSSSGVSAISD  559

Query  582   TVERSVVTSANGSDWKYISFKQATMPI----------------------LGSPPSIPVTI  469
               +    +  N +  +++   Q  +P+                      +G   +    +
Sbjct  560   CTD----SPENPAKRQHLIPPQVLVPLSMKSSSSSGMLGAEREEEGSSRVGGTRNFDFMV  615

Query  468   PEGRVH  451
             PEGRVH
Sbjct  616   PEGRVH  621


 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 129/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  236   KKCKFDGCSKGARGASGLCIAHGGGQRCQKPGCNKGAESKTAYCKAHGGGRRCQRLGCTK  295

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  296   SAEGKTDYCIAHGGGRRCGQPG---CTKAARGKSGRCIRHGGGKRCNVEGCTRSAEGQAG  352

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  353   LCISHGGGRRCQFPGCTKGAQGSTMYCKAHGGGKRCIFAG-----------CTKGAEGST  401

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L Q      K VHGG    V 
Sbjct  402   PLCKGHGGGKRCLFQGGGICPKSVHGGTDYCVA  434



>ref|XP_009354077.1| PREDICTED: uncharacterized protein LOC103945257 [Pyrus x bretschneideri]
 ref|XP_009354078.1| PREDICTED: uncharacterized protein LOC103945257 [Pyrus x bretschneideri]
 ref|XP_009354079.1| PREDICTED: uncharacterized protein LOC103945257 [Pyrus x bretschneideri]
Length=644

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 216/324 (67%), Gaps = 54/324 (17%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ + CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTM+CKAHGGG+R
Sbjct  324   LCIRHGGGKRCQVDGCTRSAEGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  384   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL------GVVVQEITPKRTENMKEIDTTEDMD  595
               FARGK+GLCA+H ++VQD+ ++ G  +      G+V    T   + +     +     
Sbjct  495   EKFARGKSGLCAAHSSMVQDRGINKGGLIGPGLFHGLVSASSTAGSSFDNNHSSSGISAI  554

Query  594   ADSM-TVERSVVTSANGSDWKYISFKQATMPI---------------------------L  499
             +DSM ++E+   T        ++   Q  +P+                           +
Sbjct  555   SDSMDSLEKPAKT--------HLIPSQVLVPLSMKSSSSYSHFLSSEKPEEGRDGYGIGV  606

Query  498   GS---PPSIPVTIPEGRVHGGSLL  436
             GS     S+   IPEGRVHGG L+
Sbjct  607   GSCSGIKSLDFKIPEGRVHGGPLM  630


 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 133/210 (63%), Gaps = 6/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC +
Sbjct  226   RTGNLKKCKFLGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQH  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  286   LGCTKSAEGKTDYCIAHGGGKRCGYPGG--CTKAARGKSGLCIRHGGGKRCQVDGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G+   C+ HGGG+RCQ+E C K AQGST +CKAHGGG+RC + Q  ++  +G  P C  
Sbjct  344   EGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRRCIF-QGCTKGAEGSTPLCKG  402

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   C   G  +  K VHGG    V 
Sbjct  403   HGGGKR--CLFDGGGICPKSVHGGTNFCVA  430



>ref|XP_009409436.1| PREDICTED: uncharacterized protein LOC103991649 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/288 (61%), Positives = 202/288 (70%), Gaps = 32/288 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENC KSAEG SGLCISHGGGRRC++PQCTKGAQGST  CKAHGGGKR
Sbjct  350   LCIRHGGGKRCQKENCKKSAEGQSGLCISHGGGRRCKFPQCTKGAQGSTNLCKAHGGGKR  409

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGST FCKGHGGGKRC F GG  C KSVHGGTL+CVAHGGGKRCA+ +CT
Sbjct  410   CTHLGCTKGAEGSTLFCKGHGGGKRCAFLGG--CSKSVHGGTLFCVAHGGGKRCAIHECT  467

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTDFCVRHGGGKRC+ EGCGK+AQGSTDFCKAHG  KRC WG+P S  G G+ PC
Sbjct  468   RSARGRTDFCVRHGGGKRCKSEGCGKAAQGSTDFCKAHGRRKRCTWGRPGSNLGAGDSPC  527

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDAD-SMT  580
             +     K GLC  H ALV+D  VHGG T+    + +T +   + K      D D + S+ 
Sbjct  528   DRLVGTKIGLCIEHTALVEDHCVHGGNTM----EAVTSQNPISSKPEKINGDCDGNLSLN  583

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             V+         +D     F                 + EGRVHGG+++
Sbjct  584   VQ---------NDQNIYLFP----------------LSEGRVHGGNIM  606


 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 125/211 (59%), Gaps = 21/211 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ   C K A G SGLCI+HGGGRRCQ   C KGA+G T+FCK+HGGG+RC + GCTK
Sbjct  258   KLCQFPGCGKGARGASGLCIAHGGGRRCQKSGCQKGAEGRTIFCKSHGGGRRCEHLGCTK  317

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +C KSA G++ 
Sbjct  318   SAEGRTSCCIAHGGGRRCSHEG---CTRAARGRSGLCIRHGGGKRCQKENCKKSAEGQSG  374

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC+F  C K AQGST+ CKAHGGGKRC             + C   A G T
Sbjct  375   LCISHGGGRRCKFPQCTKGAQGSTNLCKAHGGGKRCT-----------HLGCTKGAEGST  423

Query  732   GLCASHGALVQ-------DKRVHGGATLGVV  661
               C  HG   +        K VHGG    V 
Sbjct  424   LFCKGHGGGKRCAFLGGCSKSVHGGTLFCVA  454



>gb|KEH31245.1| loricrin-like protein [Medicago truncatula]
Length=636

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 211/316 (67%), Gaps = 38/316 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CT+SAEG +GLCISHGGGRRCQY +C+KGAQGSTMFCKAHGGGKR
Sbjct  316   LCIRHGGGKRCTIEGCTRSAEGQAGLCISHGGGRRCQYRECSKGAQGSTMFCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV+ CT
Sbjct  376   CSFAGCTKGAEGSTPLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVAHGGGKRCAVSGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  436   KSARGRTDCCVRHGGGKRCKFESCGKSAQGSTDFCKAHGGGKRCNWGD-----GK----C  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRT------EN---------M  625
               FARGK+GLCA+H +L+Q+  +  G+ +   + + + P  +      EN          
Sbjct  487   EKFARGKSGLCAAHCSLLQESEMSKGSLIAPGLFRGLVPSASTACSSYENNTSSGVSVVS  546

Query  624   KEIDTTED-MDADSMTVERSVVTSANGSDWKYISFKQATMPIL------------GSPPS  484
                D+TE         + + V+   +     Y +F  A  P              G+  +
Sbjct  547   DSYDSTETPTRRHHHLIPKEVLVPLSMKSPSYSNFLAANKPTQDRNLQNIAAGCSGTKKA  606

Query  483   IPVTIPEGRVHGGSLL  436
                 +PEGRVHGG L+
Sbjct  607   SDFNLPEGRVHGGDLM  622


 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  223   KRCRFFGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC + GG  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  283   SAEGKTDYCIAHGGGRRCGYPGG--CAKAARGKSGLCIRHGGGKRCTIEGCTRSAEGQAG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQYRECSKGAQGSTMFCKAHGGGKRCSFAG-----------CTKGAEGST  389

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  390   PLCKAHGGGKRCLFNGGGICPKSVHGGTNFCVA  422



>ref|XP_010261088.1| PREDICTED: uncharacterized protein LOC104599999 [Nelumbo nucifera]
Length=641

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 206/303 (68%), Gaps = 32/303 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTM+CKAHGGGKRC
Sbjct  330   CIKHGGGKRCKAEGCTRSAEGQAGLCISHGGGRRCQYSGCTKGAQGSTMYCKAHGGGKRC  389

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I+ GCTKGAEGSTP CKGHGGGKRCLFQGGG+CPKSVHGGT YCVAHGGGKRCAV  CTK
Sbjct  390   IFAGCTKGAEGSTPLCKGHGGGKRCLFQGGGICPKSVHGGTDYCVAHGGGKRCAVPSCTK  449

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W Q +         C 
Sbjct  450   SARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTWRQGT---------CE  500

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARGK+GLCA+H ++VQD+    G  +G  +       +     +D      A S  + 
Sbjct  501   KFARGKSGLCAAHSSMVQDRDTSKGGMIGPGLFRGLVSVSTVGSSMDNGYSSSAVS-AIS  559

Query  573   RSVVTSANGSDWKYISFKQATMP----------ILGS------------PPSIPVTIPEG  460
               + +  N +  +++   Q  +P          ILG+              S+   +PEG
Sbjct  560   DCIDSPENPAKRQHLLPPQVLVPLSMKFSSSSGILGAEREEGRSNQGGGARSLDFMVPEG  619

Query  459   RVH  451
             RVH
Sbjct  620   RVH  622


 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  237   KKCKFDGCSKGARGASGLCIAHGGGQRCHKPGCNKGAESKTAYCKAHGGGRRCQHLGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC    CT+SA G+  
Sbjct  297   SAEGKTDFCIAHGGGRRCGQPG---CTKAARGKSGRCIKHGGGKRCKAEGCTRSAEGQAG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+ GC K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  354   LCISHGGGRRCQYSGCTKGAQGSTMYCKAHGGGKRCIFAG-----------CTKGAEGST  402

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L Q      K VHGG    V 
Sbjct  403   PLCKGHGGGKRCLFQGGGICPKSVHGGTDYCVA  435



>ref|XP_009347826.1| PREDICTED: uncharacterized protein LOC103939456 [Pyrus x bretschneideri]
 ref|XP_009347827.1| PREDICTED: uncharacterized protein LOC103939456 [Pyrus x bretschneideri]
 ref|XP_009347828.1| PREDICTED: uncharacterized protein LOC103939456 [Pyrus x bretschneideri]
 ref|XP_009347829.1| PREDICTED: uncharacterized protein LOC103939456 [Pyrus x bretschneideri]
Length=644

 Score =   323 bits (829),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 211/316 (67%), Gaps = 38/316 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTM+CKAHGGG+R
Sbjct  324   LCIRHGGGKRCKVDGCTRSAEGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  384   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG-------VVVQEITPKRTEN----------  628
               FARGK+GLCA+H ++VQD+ ++ G  +G       V V        +N          
Sbjct  495   EKFARGKSGLCAAHSSMVQDRGINKGGLIGPGLFHGLVSVSSTAGSSFDNNHSSSGISAI  554

Query  627   MKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSP------------PS  484
                +D+ E      +   + +V  +  S   Y  F  +  P  G               S
Sbjct  555   SDSMDSLEKPAKTHLIPSQVLVPLSMKSSSSYSHFLSSKKPEEGRDGYDIGVGSCSGIKS  614

Query  483   IPVTIPEGRVHGGSLL  436
             +   IPEGRVHGG L+
Sbjct  615   LDFKIPEGRVHGGPLM  630


 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 133/210 (63%), Gaps = 6/210 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC +
Sbjct  226   RTGNLKKCKFLGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQH  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  286   LGCTKSAEGKTDYCIAHGGGKRCGYPGG--CTKAARGKSGLCIRHGGGKRCKVDGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNS  751
              G+   C+ HGGG+RCQ+E C K AQGST +CKAHGGG+RC + Q  ++  +G  P C  
Sbjct  344   EGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRRCIF-QGCTKGAEGSTPLCKG  402

Query  750   FARGKTGLCASHGALVQDKRVHGGATLGVV  661
                GK   C   G  +  K VHGG    V 
Sbjct  403   HGGGKR--CLFDGGGICPKSVHGGTNFCVA  430



>gb|AFW81273.1| hypothetical protein ZEAMMB73_277508, partial [Zea mays]
Length=333

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 204/294 (69%), Gaps = 23/294 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ+E+C +SAEG SGLCISHGGGRRCQ+P+C KGAQGST  CKAHGGGKR
Sbjct  33    LCIKHGGGKRCQRESCRRSAEGHSGLCISHGGGRRCQFPECAKGAQGSTGLCKAHGGGKR  92

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGG---VCPKSVHGGTLYCVAHGGGKRCAVT  946
             C + GCT+GAEGST  CK HGGGKRC  QGGG    CPKSVHGGT YCVAHGGGKRC V 
Sbjct  93    CTFPGCTRGAEGSTWLCKAHGGGKRCAHQGGGGGGACPKSVHGGTRYCVAHGGGKRCLVA  152

Query  945   DCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE  766
              CT+SARGRT+ CVRHGGG+RC+ EGC KSAQGSTDFCKAHGGGKRC WGQ  S  G G 
Sbjct  153   GCTRSARGRTEHCVRHGGGRRCRAEGCAKSAQGSTDFCKAHGGGKRCVWGQEGSSLGAGG  212

Query  765   IPCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADS  586
              PC+ FAR + GLCA HGALV+D+ VHGG +LG             + ++ T  D +  +
Sbjct  213   PPCDRFARSRVGLCAGHGALVEDRCVHGGGSLGPA---------PAIGQLTT--DCEPAA  261

Query  585   MTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIP----EGRVHGGSLL  436
                 R     A+G +  ++     T+   G   S   T P    EGRVHG  LL
Sbjct  262   AAATRGDADMADGDEEAFL-----TLGWNGDGESAGATAPAPFMEGRVHGSGLL  310


 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 78/135 (58%), Gaps = 8/135 (6%)
 Frame = -3

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C  +GC++ A G +  C  HGGGKRC  +    C +S  G +  C++HGGG+RC   +C 
Sbjct  18    CSQDGCSRAARGRSGLCIKHGGGKRCQRE---SCRRSAEGHSGLCISHGGGRRCQFPECA  74

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             K A+G T  C  HGGGKRC F GC + A+GST  CKAHGGGKRC     + + G G   C
Sbjct  75    KGAQGSTGLCKAHGGGKRCTFPGCTRGAEGSTWLCKAHGGGKRC-----AHQGGGGGGAC  129

Query  756   NSFARGKTGLCASHG  712
                  G T  C +HG
Sbjct  130   PKSVHGGTRYCVAHG  144



>ref|XP_008457144.1| PREDICTED: uncharacterized protein LOC103496890 [Cucumis melo]
 ref|XP_008457145.1| PREDICTED: uncharacterized protein LOC103496890 [Cucumis melo]
Length=638

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 179/210 (85%), Gaps = 9/210 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY +CTKGAQGSTM+CKAHGGGKR
Sbjct  319   LCIRHGGGKRCKMEGCTRSAEGHAGLCISHGGGRRCQYERCTKGAQGSTMYCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V+ CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVVSGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  439   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
               FARGK+GLCA+H +++QD+  + G+ +G
Sbjct  490   EKFARGKSGLCAAHSSMIQDRETNKGSLIG  519


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 126/213 (59%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G SGLCI HGGG RCQ P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  226   KRCKYFGCEKGARGASGLCIGHGGGHRCQKPGCNKGAESRTAYCKAHGGGRRCQHLGCTK  285

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC + GG  C K+  G +  C+ HGGGKRC +  CT+SA G   
Sbjct  286   SAEGKTEFCIAHGGGRRCGYSGG--CAKAARGKSGLCIRHGGGKRCKMEGCTRSAEGHAG  343

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+E C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  344   LCISHGGGRRCQYERCTKGAQGSTMYCKAHGGGKRCIFA-----------GCTKGAEGST  392

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  +  K VHGG    V 
Sbjct  393   PLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVA  425



>ref|XP_008339251.1| PREDICTED: uncharacterized protein LOC103402288 [Malus domestica]
Length=729

 Score =   325 bits (833),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 218/324 (67%), Gaps = 54/324 (17%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  + CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTM+CKAHGGG+R
Sbjct  409   LCIRHGGGKRCMVDGCTRSAEGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRR  468

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  469   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  528

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC WG+     GK    C
Sbjct  529   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTWGE-----GK----C  579

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL------GVVVQEITPKRTENMKEIDTTEDMD  595
               FARGK+GLCA+H ++VQD+ ++ G  +      G+V    T   + +     +     
Sbjct  580   EKFARGKSGLCAAHSSMVQDRGINKGGLIGPGLFHGLVSASSTAGSSFDNNHSSSGISAI  639

Query  594   ADSM-TVERSVVTSANGSDWKYISFKQATMPI---------------------------L  499
             +DSM ++E+ V T        ++   Q  +P+                           +
Sbjct  640   SDSMDSLEKPVKT--------HLIPSQVLVPLSMKSSSSYSHFLSSEKPEEGRDGYGVGV  691

Query  498   GS---PPSIPVTIPEGRVHGGSLL  436
             GS     S+   IPEGRVHGG L+
Sbjct  692   GSCSGIKSLDFKIPEGRVHGGPLM  715


 Score =   188 bits (477),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 122/192 (64%), Gaps = 13/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC +
Sbjct  311   RTSNPKKCKFLGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQH  370

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  371   LGCTKSAEGKTDYCIAHGGGKRCGYPGG--CTKAARGKSGLCIRHGGGKRCMVDGCTRSA  428

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ+E C K AQGST +CKAHGGG+RC +             C   
Sbjct  429   EGQAGLCISHGGGRRCQYEACTKGAQGSTMYCKAHGGGRRCIFQG-----------CTKG  477

Query  747   ARGKTGLCASHG  712
             A G T LC  HG
Sbjct  478   AEGSTPLCKGHG  489



>ref|XP_010418466.1| PREDICTED: uncharacterized protein LOC104704045 [Camelina sativa]
 ref|XP_010418467.1| PREDICTED: uncharacterized protein LOC104704045 [Camelina sativa]
Length=550

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/283 (64%), Positives = 199/283 (70%), Gaps = 21/283 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CIS     RCQ   CTKGAQGSTMFCKAHGGGKRC + GCTK
Sbjct  262   KLCQVEGCQKGARGASGRCIS----XRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTK  317

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
             GAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHGGGKRCAV +CTKSARGRTD
Sbjct  318   GAEGSTPFCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHGGGKRCAVPECTKSARGRTD  377

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFG--KGEIPCNSFARG  739
             FCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP +E+       PC SFARG
Sbjct  378   FCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGQPETEYAGQSSSGPCTSFARG  437

Query  738   KTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDADSMTVERSV  565
             KTGLCA H +LVQD RVHGG T+    QE  ++   TEN +E   ++DM+ D+M      
Sbjct  438   KTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEEEFSGSQDMNIDTMKAR---  494

Query  564   VTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               SA GS    +   +    +           PEGRVHGGSL+
Sbjct  495   --SATGSPETDVDLNEYEAGL--------GLAPEGRVHGGSLM  527


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 59/107 (55%), Gaps = 8/107 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              C+ HGGGKRC    CTKSA G +  C+ HGGG+RC+   C K AQGST FCKAHGGGKR
Sbjct  353   FCVAHGGGKRCAVPECTKSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKR  412

Query  1116  CIY---EGCTKGAEGSTP---FCKGHGGGKRCLFQGGGVCPKSVHGG  994
             C +   E    G   S P   F +G  G   C      V    VHGG
Sbjct  413   CAWGQPETEYAGQSSSGPCTSFARGKTG--LCALHNSLVQDNRVHGG  457



>ref|XP_011013775.1| PREDICTED: uncharacterized protein LOC105117722 [Populus euphratica]
 ref|XP_011013776.1| PREDICTED: uncharacterized protein LOC105117722 [Populus euphratica]
Length=642

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 207/315 (66%), Gaps = 38/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRC Y  CTKGAQGSTMFCKAHGGG+R
Sbjct  324   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCLYQACTKGAQGSTMFCKAHGGGRR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GC+KGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCSKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTDFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFEDCGKSAQGSTDFCKAHGGGKRCAW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++VQ+++ +    +G  +   +    +     IDT       S  
Sbjct  495   EKFARGKSGLCAAHSSMVQERKANKTGLIGPGLFHGLVSASSVTGSSIDTNHSYSGVS-A  553

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---------------------------GSPPSI  481
             +  S+ +    +  +++   Q  +P+                            G     
Sbjct  554   ISDSIDSLEKPAKRQHLIPPQVLVPLSMKVSSSCTGFMNTENLEEGTNGYGASNGGIKDC  613

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG+L+
Sbjct  614   DYLVPEGRVHGGALM  628


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 121/187 (65%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  231   KKCKFFGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  291   SAEGKTENCIAHGGGRRCGFPGG--CAKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC ++ C K AQGST FCKAHGGG+RC +             C+  A G T
Sbjct  349   LCISHGGGRRCLYQACTKGAQGSTMFCKAHGGGRRCIFAG-----------CSKGAEGST  397

Query  732   GLCASHG  712
              LC  HG
Sbjct  398   PLCKGHG  404



>ref|XP_010103840.1| hypothetical protein L484_024142 [Morus notabilis]
 gb|EXB97281.1| hypothetical protein L484_024142 [Morus notabilis]
Length=631

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 206/321 (64%), Gaps = 50/321 (16%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E C +SAEG +GLCISHGGGRRCQ+  C+KGAQGSTMFCKAHGGGKR
Sbjct  313   LCIRHGGGKRCKIEGCARSAEGQAGLCISHGGGRRCQFQGCSKGAQGSTMFCKAHGGGKR  372

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  373   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  432

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC++E CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  433   KSARGRTDCCVRHGGGKRCKYENCGKSAQGSTDFCKAHGGGKRCNW---------GEGKC  483

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENM-KEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++ Q++ +  G  +G       P+    +     TT     +  T
Sbjct  484   EKFARGKSGLCAAHSSMAQERELSKGGLIG-------PRLFHGLVSAASTTAGSSNNHST  536

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSP------------------------------  490
                SVV+    S  K    +Q   P +  P                              
Sbjct  537   SGISVVSDCINSLEKRAKRRQLIPPQVLVPLSMKSSSSYSNILNAEKAEGNRFDIGVGSS  596

Query  489   ---PSIPVTIPEGRVHGGSLL  436
                 S    IPEGRVHGG L+
Sbjct  597   SGRKSFDFDIPEGRVHGGPLM  617


 Score =   190 bits (482),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 132/211 (63%), Gaps = 7/211 (3%)
 Frame = -3

Query  1290  IRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCI  1111
             +R    KRC    CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC+
Sbjct  215   LRTSNPKRCNFLGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCL  274

Query  1110  YEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKS  931
             + GCTK AEG T +C  HGGG+RC   G   C K+  G +  C+ HGGGKRC +  C +S
Sbjct  275   HLGCTKSAEGKTDYCIAHGGGRRC---GHPRCTKAARGRSGLCIRHGGGKRCKIEGCARS  331

Query  930   ARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CN  754
             A G+   C+ HGGG+RCQF+GC K AQGST FCKAHGGGKRC + Q  ++  +G  P C 
Sbjct  332   AEGQAGLCISHGGGRRCQFQGCSKGAQGSTMFCKAHGGGKRCIF-QGCTKGAEGSTPLCK  390

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVV  661
                 GK   C   G  +  K VHGG    V 
Sbjct  391   GHGGGKR--CLFDGGGICPKSVHGGTNFCVA  419



>gb|EYU19611.1| hypothetical protein MIMGU_mgv1a002990mg [Erythranthe guttata]
Length=618

 Score =   321 bits (822),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 226/345 (66%), Gaps = 43/345 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+   CTKSAEG+SGLCISHGGGRRCQYP+CTKGAQGSTMFCKAHGGG+R
Sbjct  293   LCIRHGGGKRCKIAECTKSAEGISGLCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRR  352

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGSTPFCKGHGGGKRC  +G   C KSVHGGT +CV+HGGGKRCAV +CT
Sbjct  353   CTFLGCMKGAEGSTPFCKGHGGGKRCTSEG---CTKSVHGGTNFCVSHGGGKRCAVAECT  409

Query  936   KSARGRTDFCVRHGGGKRCQFE-GCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGK--GE  766
             KSARGRTDFCVRHGGGKRC+FE GC KSAQGSTDFCKAHGGGKRC WGQ   EFG    +
Sbjct  410   KSARGRTDFCVRHGGGKRCKFEGGCTKSAQGSTDFCKAHGGGKRCSWGQLGLEFGGVCVK  469

Query  765   IPCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADS  586
             + C+ FARGK+GLC +H A  Q+                    + +   + T+++ ++  
Sbjct  470   VSCDKFARGKSGLCVAHSAQAQENS----------------GLSSSYPGMSTSQEPESSM  513

Query  585   MTVERSVVTSANGSDWKYISFKQAT-------------MPIL-------GSPPSIPVTIP  466
              T  R VV S N      +    AT             +PIL       GS    P+++P
Sbjct  514   STYTRGVVVSGNSLSHPGMMDCGATSVGPIGYANGFRPLPILPHGNIVSGSSCLDPMSLP  573

Query  465   EGRVHGGSLLsmlasnsdpslssSRGTEN-PSEPRKAYITHQSWM  334
             EGRVHGG L++ML   S    S++    N   EP K+     SW+
Sbjct  574   EGRVHGGGLMAMLKGASGFGTSNANQEPNGQLEPGKSCDLPHSWV  618


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 129/209 (62%), Gaps = 20/209 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C  E CT+ A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGGKRC + GCTK
Sbjct  201   KICSFEGCTRGARGASGRCIAHGGGRRCQRAGCDKGAEGKTVFCKAHGGGKRCQHLGCTK  260

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC + G   CP++  G +  C+ HGGGKRC + +CTKSA G + 
Sbjct  261   SAEGRTEYCISHGGGRRCNYDG---CPRASRGKSGLCIRHGGGKRCKIAECTKSAEGISG  317

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCKAHGGG+RC +           + C   A G T
Sbjct  318   LCISHGGGRRCQYPECTKGAQGSTMFCKAHGGGRRCTF-----------LGCMKGAEGST  366

Query  732   GLCASHGALVQ------DKRVHGGATLGV  664
               C  HG   +       K VHGG    V
Sbjct  367   PFCKGHGGGKRCTSEGCTKSVHGGTNFCV  395



>ref|XP_010937059.1| PREDICTED: uncharacterized protein LOC105056536 [Elaeis guineensis]
Length=652

 Score =   321 bits (822),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 177/291 (61%), Positives = 203/291 (70%), Gaps = 19/291 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CT+SAEG +GLCISHGGGRRCQYP C KGAQGST FCKAHGGG+R
Sbjct  340   LCIRHGGGKRCTVEGCTRSAEGQAGLCISHGGGRRCQYPGCGKGAQGSTKFCKAHGGGRR  399

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEGSTP CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  400   CIFEGCTKGAEGSTPLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVAHGGGKRCTVPGCT  459

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+GCGKSAQGSTDFCKAHGGGKRC W Q           C
Sbjct  460   KSARGRTDCCVRHGGGKRCKFDGCGKSAQGSTDFCKAHGGGKRCLWSQ----------GC  509

Query  756   NSFARGKTGLCASHGALVQDKRV----HGGATLGV-VVQEITPKRTENMKEIDTTEDMDA  592
               FARG++GLCA+HG+L+   +       G+ +G  + Q I    T     I+   +  +
Sbjct  510   EKFARGRSGLCAAHGSLMLSPQECNAGKSGSMIGPGLFQGIVSTFTAAKSSIN---EHSS  566

Query  591   DSMTVERSVVTSANGSDWKYISFKQATMPI-LGSPPSIPVTIPEGRVHGGS  442
               M+     V S      K +   Q  +P+ + SP    V +  GR  GGS
Sbjct  567   SGMSTISDSVESEESMGRKQLIPPQVLVPLSMKSPSPSSVLMDAGREEGGS  617


 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 130/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  248   KKCRFTGCSKGARGASGLCIAHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLGCTK  307

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC GHGGG+RC+  G   C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  308   SAEGKTDFCIGHGGGRRCVHPG---CTKAARGKSGLCIRHGGGKRCTVEGCTRSAEGQAG  364

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+ GCGK AQGST FCKAHGGG+RC +             C   A G T
Sbjct  365   LCISHGGGRRCQYPGCGKGAQGSTKFCKAHGGGRRCIFEG-----------CTKGAEGST  413

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG    V 
Sbjct  414   PLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVA  446



>ref|XP_007158547.1| hypothetical protein PHAVU_002G161400g [Phaseolus vulgaris]
 gb|ESW30541.1| hypothetical protein PHAVU_002G161400g [Phaseolus vulgaris]
Length=669

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 215/323 (67%), Gaps = 4/323 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHG  KR Q E CTK++EGL+GLCISHGGG RCQ   CTKGAQG+TMFC+AHG GK 
Sbjct  345   LCIRHGSSKRHQTEKCTKNSEGLAGLCISHGGGHRCQASGCTKGAQGNTMFCRAHGVGKC  404

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTK A G+TP CKGHGGGK C +QGGG+C KSVHGGT +CVAHGGG RCAV DC 
Sbjct  405   CTAPGCTKDAGGTTPLCKGHGGGKCCAYQGGGICTKSVHGGTNFCVAHGGGMRCAVPDCL  464

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE-IP  760
             K ARGR D CV  G GKRC+FEGCGKSAQ  T+FC+A GG KRC WG P SE+   +  P
Sbjct  465   KRARGRADPCVCRGRGKRCKFEGCGKSAQADTNFCEARGGRKRCSWGHPGSEYSDQQGGP  524

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
               S ARGKTGLCA H  LV DKRVHGG + G V+Q+    +   +K+I   +DMD D + 
Sbjct  525   SYSLARGKTGLCALHSGLVLDKRVHGGVSSGPVIQDTHDSKLGELKQIVINQDMDVDMIK  584

Query  579   V-ERSVVTSANGSDWKYISFKQATMPI-LGSPPSIPVTIPEGRVHGGSLLsmlasnsdps  406
             +       S   S  K      A +P        +PV +PEGRVHGGSL++ML  NS   
Sbjct  585   MGNPQTDDSITCSVAKLNEVASAHLPSGEDDYTPMPVAVPEGRVHGGSLMAMLKGNSSLD  644

Query  405   lssSRG-TENPSEPRKAYITHQS  340
             +S  RG   +PS+  KA +  Q+
Sbjct  645   MSIRRGLLSDPSDTSKACMVSQT  667


 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 108/202 (53%), Gaps = 5/202 (2%)
 Frame = -3

Query  1266  CQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGA  1087
             CQ E   K  +G SG CISHGGGR C    C KG +G T++CK+ GGG+RC Y GCT   
Sbjct  255   CQVEGYGKGYQGASGCCISHGGGR-CHKACCNKGTEGWTLYCKSRGGGRRCEYLGCTIST  313

Query  1086  EGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFC  907
             EG T FC  HG  +RC    G  C ++  G +  C+ HG  KR     CTK++ G    C
Sbjct  314   EGHTDFCIAHGDSQRCTHHEG--CIQAARGKSGLCIRHGSSKRHQTEKCTKNSEGLAGLC  371

Query  906   VRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGL  727
             + HGGG RCQ  GC K AQG+T FC+AHG GK C     + + G     C     GK   
Sbjct  372   ISHGGGHRCQASGCTKGAQGNTMFCRAHGVGKCCTAPGCTKDAGGTTPLCKGHGGGK--C  429

Query  726   CASHGALVQDKRVHGGATLGVV  661
             CA  G  +  K VHGG    V 
Sbjct  430   CAYQGGGICTKSVHGGTNFCVA  451



>ref|XP_004138941.1| PREDICTED: delta-like protein C [Cucumis sativus]
 ref|XP_004138942.1| PREDICTED: delta-like protein C [Cucumis sativus]
 gb|KGN61438.1| hypothetical protein Csa_2G122020 [Cucumis sativus]
Length=638

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 178/210 (85%), Gaps = 9/210 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTM+CKAHGGGKR
Sbjct  319   LCIRHGGGKRCKMDGCTRSAEGHAGLCISHGGGRRCQYECCTKGAQGSTMYCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V+ CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVVSGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  439   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
               FARGK+GLCA+H +++QD+  + G+ +G
Sbjct  490   EKFARGKSGLCAAHSSMIQDRETNKGSLIG  519


 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G SGLCI HGGG RCQ P CTKGA+  T +CKAHGGG+RC + GCTK
Sbjct  226   KRCKYFGCEKGARGASGLCIGHGGGHRCQKPGCTKGAESRTAYCKAHGGGRRCQHLGCTK  285

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC + GG  C K+  G +  C+ HGGGKRC +  CT+SA G   
Sbjct  286   SAEGKTEFCIAHGGGRRCGYSGG--CAKAARGKSGLCIRHGGGKRCKMDGCTRSAEGHAG  343

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+E C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  344   LCISHGGGRRCQYECCTKGAQGSTMYCKAHGGGKRCIFAG-----------CTKGAEGST  392

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  +  K VHGG    V 
Sbjct  393   PLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVA  425



>ref|XP_008352811.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103416331 
[Malus domestica]
Length=644

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 214/324 (66%), Gaps = 54/324 (17%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  + CT+SAEG +GLCISHGGGRRCQY  CTKG QGSTM+CKAHGGG+R
Sbjct  324   LCIRHGGGKRCXVDGCTRSAEGQAGLCISHGGGRRCQYEXCTKGXQGSTMYCKAHGGGRR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGG RCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  384   CIFQGCTKGAEGSTPLCKGHGGGXRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGQC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL------GVVVQEITPKRTENMKEIDTTEDMD  595
               FARGK+GLCA+H ++VQD+ ++ G  +      G+V    T   + +     +     
Sbjct  495   EKFARGKSGLCAAHSSMVQDRGINKGGLIGPGLFHGLVSASSTAGSSFDNNHSSSGISAI  554

Query  594   ADSM-TVERSVVTSANGSDWKYISFKQATMPI---------------------------L  499
             +DSM ++E+ V T        ++   Q  +P+                           +
Sbjct  555   SDSMDSLEKPVKT--------HLIPSQVLVPLSMKSSSSYSHFLSSEKPEEGRDGYGVGV  606

Query  498   GS---PPSIPVTIPEGRVHGGSLL  436
             GS     S+   IPEGRVHGG L+
Sbjct  607   GSCSGIKSLDFKIPEGRVHGGPLM  630


 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  231   KKCKFLGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  291   SAEGKTDYCIAHGGGKRCGYPGG--CTKAARGKSGLCIRHGGGKRCXVDGCTRSAEGQAG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+E C K  QGST +CKAHGGG+RC +             C   A G T
Sbjct  349   LCISHGGGRRCQYEXCTKGXQGSTMYCKAHGGGRRCIF-----------QGCTKGAEGST  397

Query  732   GLCASHGALVQ---------DKRVHGGATLGVV  661
              LC  HG   +          K VHGG    V 
Sbjct  398   PLCKGHGGGXRCLFDGGGICPKSVHGGTNFCVA  430



>ref|XP_009410374.1| PREDICTED: loricrin-like [Musa acuminata subsp. malaccensis]
Length=658

 Score =   320 bits (819),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 178/309 (58%), Positives = 207/309 (67%), Gaps = 32/309 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CTKSAEG +G CISHGGGRRCQY  C KGAQGSTM+CKAHGGGKR
Sbjct  344   LCIRHGGGKRCTVEGCTKSAEGQAGRCISHGGGRRCQYQGCGKGAQGSTMYCKAHGGGKR  403

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGC KGAEGSTP CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRCA+  CT
Sbjct  404   CIFEGCNKGAEGSTPLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVAHGGGKRCAMPGCT  463

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC  EGCGKSAQGSTDFCKAHGGGKRC W           + C
Sbjct  464   KSARGRTDCCVRHGGGKRCTSEGCGKSAQGSTDFCKAHGGGKRCTWA----------MGC  513

Query  756   NSFARGKTGLCASHGALVQDKRVHG--------GATL--GVVVQEITPKRTENMK-----  622
               FARGK+GLCA+HG+L+   R H         G+ L  G+V     P  +++ +     
Sbjct  514   EKFARGKSGLCAAHGSLMVSPREHEVGNFGSMIGSDLFRGIVSTSTAPGNSKDNELSSSG  573

Query  621   -----EIDTTEDMDADSMTVERSVVT--SANGSDWKYISFKQATMPILGSPPSIPVTIPE  463
                  + ++ + M ++   +   V+   S   S + +               S  + IPE
Sbjct  574   VSSLSDCESFDSMGSEQHLIPPQVLVPISMQSSSYAFGLIGGVREEGESQDKSFGLVIPE  633

Query  462   GRVHGGSLL  436
             GRVHGG L+
Sbjct  634   GRVHGGGLM  642


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 130/218 (60%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
              H   K+C+   C+K A G SGLCI+HGGG+RCQ P C KGA+    +CKAHGGG+RC  
Sbjct  247   NHHQSKKCRFNGCSKGARGSSGLCIAHGGGQRCQKPGCNKGAESRAAYCKAHGGGRRCQQ  306

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CTKSA
Sbjct  307   LGCTKSAEGKTDFCIAHGGGRRCGHPG---CSKAARGKSGLCIRHGGGKRCTVEGCTKSA  363

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ++GCGK AQGST +CKAHGGGKRC +             CN  
Sbjct  364   EGQAGRCISHGGGRRCQYQGCGKGAQGSTMYCKAHGGGKRCIF-----------EGCNKG  412

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  V  K VHGG    V 
Sbjct  413   AEGSTPLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVA  450



>ref|XP_002299680.1| hypothetical protein POPTR_0001s21410g [Populus trichocarpa]
 gb|EEE84485.1| hypothetical protein POPTR_0001s21410g [Populus trichocarpa]
Length=642

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 207/315 (66%), Gaps = 38/315 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRC +  CTKGAQGSTMFCKAHGGG+R
Sbjct  324   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCLHQACTKGAQGSTMFCKAHGGGRR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GC+KGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCSKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTDFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFEDCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++VQ+++ +    +G  +   +    +     IDT       S  
Sbjct  495   EKFARGKSGLCAAHSSMVQERKANKTGLIGPGLFHGLVSASSVAGSSIDTNHSYSGVS-A  553

Query  579   VERSVVTSANGSDWKYISFKQATMPIL---------------------------GSPPSI  481
             V  S+ +    +  +++   Q  +P+                            G     
Sbjct  554   VSDSIDSLEKPAKRQHLIPAQVLVPLSMKVSSSCTGFMNTENLEEGTNGYGASNGGIKGC  613

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG+L+
Sbjct  614   DYLVPEGRVHGGALM  628


 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 119/187 (64%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RC  P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  231   KKCKFFGCSKGARGASGLCIGHGGGQRCHKPGCNKGAESRTAYCKAHGGGRRCQHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  291   SAEGKTENCIAHGGGRRCGFPGG--CAKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC  + C K AQGST FCKAHGGG+RC +             C+  A G T
Sbjct  349   LCISHGGGRRCLHQACTKGAQGSTMFCKAHGGGRRCIFAG-----------CSKGAEGST  397

Query  732   GLCASHG  712
              LC  HG
Sbjct  398   PLCKGHG  404



>ref|XP_002271060.2| PREDICTED: uncharacterized protein LOC100249189 [Vitis vinifera]
Length=653

 Score =   318 bits (815),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 176/210 (84%), Gaps = 9/210 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTMFCKAHGGGKR
Sbjct  324   LCIKHGGGKRCKIEGCTRSAEGQAGLCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
               FARGK+GLCA+H +LVQ++    G  +G
Sbjct  495   EKFARGKSGLCAAHSSLVQERETKKGGMIG  524


 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 130/218 (60%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K+C+  +CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC  
Sbjct  226   RNNNPKKCKFMDCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQ  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC    G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  286   LGCTKSAEGKTNFCIAHGGGRRCGHPAG--CTKAARGKSGLCIKHGGGKRCKIEGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ++GC K AQGST FCKAHGGGKRC +             C   
Sbjct  344   EGQAGLCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKG  392

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  +  K VHGG    V 
Sbjct  393   AEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVA  430



>ref|XP_008804473.1| PREDICTED: uncharacterized protein LOC103717758 [Phoenix dactylifera]
Length=659

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 205/311 (66%), Gaps = 36/311 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CT+SAEG +GLCISHGGGRRC +P C KGAQGSTMFCKAHGGGKR
Sbjct  346   LCIRHGGGKRCTVEGCTRSAEGQAGLCISHGGGRRCHFPGCCKGAQGSTMFCKAHGGGKR  405

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEGSTP CKGHGGGKRC F+GGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  406   CIFEGCTKGAEGSTPLCKGHGGGKRCRFEGGGVCPKSVHGGTDFCVAHGGGKRCAVPGCT  465

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+F GCGKSAQGSTDFCKAHGGGKRC W Q           C
Sbjct  466   KSARGRTDCCVKHGGGKRCKFLGCGKSAQGSTDFCKAHGGGKRCTWDQ----------GC  515

Query  756   NSFARGKTGLCASHGALV--QDKRVHG--GATLGV-VVQEITPKRTENMKEIDTTEDMDA  592
               FARGK+GLCA+HG+L+  Q +R  G  G+ +G  +   I    T     ID   +  +
Sbjct  516   EKFARGKSGLCAAHGSLMLSQQEREAGNSGSMIGPGLFHGIVSTSTTVRSSID--NEHPS  573

Query  591   DSMTVERSVVTSANGSDWKYISFKQATMPIL-------------------GSPPSIPVTI  469
               M+       S       ++   Q  +P+                        S    I
Sbjct  574   SVMSTISDCAESQESMRRMHLIPPQVLVPLSMKSSSPSSGLTDVDRDGAGSQEKSFGFVI  633

Query  468   PEGRVHGGSLL  436
             PEGRVHGG L+
Sbjct  634   PEGRVHGGGLM  644


 Score =   181 bits (459),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 125/213 (59%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C++ A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  254   KKCRFNGCSRGARGSSGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQRLGCTK  313

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  314   SAEGKTDFCIAHGGGRRC---GNPGCTKAARGKSGLCIRHGGGKRCTVEGCTRSAEGQAG  370

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC F GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  371   LCISHGGGRRCHFPGCCKGAQGSTMFCKAHGGGKRCIFEG-----------CTKGAEGST  419

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG    V 
Sbjct  420   PLCKGHGGGKRCRFEGGGVCPKSVHGGTDFCVA  452



>emb|CAN82910.1| hypothetical protein VITISV_015279 [Vitis vinifera]
Length=692

 Score =   318 bits (816),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 176/210 (84%), Gaps = 9/210 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTMFCKAHGGGKR
Sbjct  324   LCIKHGGGKRCKIEGCTRSAEGQAGLCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
               FARGK+GLCA+H +LVQ++    G  +G
Sbjct  495   EKFARGKSGLCAAHSSLVQERETKKGGMIG  524


 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 123/192 (64%), Gaps = 13/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K+C+  +CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC  
Sbjct  226   RNNNPKKCKFMDCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQ  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC    G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  286   LGCTKSAEGKTNFCIAHGGGRRCGHPAG--CTKAARGKSGLCIKHGGGKRCKIEGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ++GC K AQGST FCKAHGGGKRC +             C   
Sbjct  344   EGQAGLCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKG  392

Query  747   ARGKTGLCASHG  712
             A G T LC  HG
Sbjct  393   AEGSTPLCKGHG  404



>ref|XP_012079959.1| PREDICTED: uncharacterized protein LOC105640258 [Jatropha curcas]
 gb|KDP46973.1| hypothetical protein JCGZ_02409 [Jatropha curcas]
Length=647

 Score =   317 bits (812),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 201/317 (63%), Gaps = 39/317 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY  CTKGAQGSTMFCKAHGGGKR
Sbjct  326   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  386   CIFAGCTKGAEGSTPLCKGHGGGKRCLYDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  446   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCNW---------GEGKC  496

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARGK+GLCA+H ++VQ++    G  +G  +         N           +    V
Sbjct  497   EKFARGKSGLCAAHSSMVQERGSKKGNLIGPGLFHGLVSAVSNAGSSINNNYSSSGISAV  556

Query  576   ERSVVTSANGSDWKYISFKQATMPI------------------------------LGSPP  487
                  +    +  +++   Q  +P                               +G   
Sbjct  557   SDCTDSLEKPAKRQHLIPAQVLVPSSMKSSSSYSSFLSAEKQEEDRNGYGTGIASIGRIT  616

Query  486   SIPVTIPEGRVHGGSLL  436
             +    +PEGRVHGG L+
Sbjct  617   NFDYMVPEGRVHGGGLM  633


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 130/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ   C KG++  T +CKAHGGG+RC + GCTK
Sbjct  233   KKCKFFGCSKGARGASGLCIGHGGGQRCQKAGCNKGSESRTAYCKAHGGGRRCQHLGCTK  292

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  293   SAEGKTDFCIAHGGGRRCGFAGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ++GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYQGCTKGAQGSTMFCKAHGGGKRCIFA-----------GCTKGAEGST  399

Query  732   GLCASHGA---LVQD------KRVHGGATLGVV  661
              LC  HG     + D      K VHGG    V 
Sbjct  400   PLCKGHGGGKRCLYDGGGICPKSVHGGTNFCVA  432



>ref|XP_004300691.1| PREDICTED: uncharacterized protein LOC101302269 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465593.1| PREDICTED: uncharacterized protein LOC101302269 [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   317 bits (811),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 207/318 (65%), Gaps = 42/318 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQY  C KGAQGSTM+CKAHGGGKR
Sbjct  313   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQYECCAKGAQGSTMYCKAHGGGKR  372

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V+ CT
Sbjct  373   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVSGCT  432

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  433   KSARGRTDCCVRHGGGKRCRSDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  483

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H +LV ++    G  +G  +   +    +      D T    +  ++
Sbjct  484   EKFARGKSGLCAAHSSLVLERETSKGGLIGPGLFHGLVSATSTAGSSFDYTH--SSSGVS  541

Query  579   VERSVVTSANGSDWKYISFKQATMPI---------------------------LGSPP--  487
             V    + S      +++   Q  +P+                           +GS    
Sbjct  542   VISDSIDSLENPGTRHLIPAQVLVPLSMKSSSSYSNLLSSEKPEEERNGCGTGVGSSDGR  601

Query  486   -SIPVTIPEGRVHGGSLL  436
                   IPEGRVHGG L+
Sbjct  602   KGFDFKIPEGRVHGGPLM  619


 Score =   184 bits (467),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 130/205 (63%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  220   KKCKFLGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  279

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  280   SAEGKTDNCIAHGGGRRCGYSGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAG  337

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ+E C K AQGST +CKAHGGGKRC + Q  ++  +G  P C     GK
Sbjct  338   LCISHGGGRRCQYECCAKGAQGSTMYCKAHGGGKRCIF-QGCTKGAEGSTPLCKGHGGGK  396

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  397   R--CLFDGGGICPKSVHGGTNFCVA  419



>ref|XP_008391437.1| PREDICTED: uncharacterized protein LOC103453654 [Malus domestica]
 ref|XP_008391445.1| PREDICTED: uncharacterized protein LOC103453654 [Malus domestica]
 ref|XP_008391448.1| PREDICTED: uncharacterized protein LOC103453654 [Malus domestica]
 ref|XP_008344151.1| PREDICTED: uncharacterized protein LOC103406965 [Malus domestica]
 ref|XP_008344152.1| PREDICTED: uncharacterized protein LOC103406965 [Malus domestica]
 ref|XP_008344153.1| PREDICTED: uncharacterized protein LOC103406965 [Malus domestica]
Length=640

 Score =   317 bits (811),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 207/318 (65%), Gaps = 42/318 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQ+  C KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCKVDGCTRSAEGQAGLCISHGGGRRCQHEACAKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  380   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  440   RSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++VQD+ +     +G  +   +    +      D        S  
Sbjct  491   EKFARGKSGLCAAHSSMVQDRGIDKAGLIGPGLFHGLVSAASTAGSSFDNNHSSSGTSAI  550

Query  579   VERSVVTSANGSDWKYISFKQATMPI---------------------------LGS---P  490
              +   + S    +  ++   Q  +P+                           +GS    
Sbjct  551   SDS--MDSLEKPEKTHLIPSQVLVPLSMKSSSSYSQFSSSEKPEEGRDGYGVGVGSCSGI  608

Query  489   PSIPVTIPEGRVHGGSLL  436
              S+   IPEGRVHGG L+
Sbjct  609   KSLEFKIPEGRVHGGPLM  626


 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 130/205 (63%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KKCKFFGCRKGARGASGLCIGHGGGQRCQKPGCKKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  287   SAEGKTEYCIAHGGGKRCSYPGG--CTKAARGKSGLCIRHGGGKRCKVDGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ E C K AQGST +CKAHGGGKRC + Q  ++  +G  P C     GK
Sbjct  345   LCISHGGGRRCQHEACAKGAQGSTMYCKAHGGGKRCIF-QGCTKGAEGSTPLCKGHGGGK  403

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  404   R--CLFDGGGICPKSVHGGTNFCVA  426



>ref|XP_006493281.1| PREDICTED: uncharacterized protein LOC102617837 isoform X1 [Citrus 
sinensis]
 ref|XP_006493282.1| PREDICTED: uncharacterized protein LOC102617837 isoform X2 [Citrus 
sinensis]
 ref|XP_006493283.1| PREDICTED: uncharacterized protein LOC102617837 isoform X3 [Citrus 
sinensis]
 ref|XP_006493284.1| PREDICTED: uncharacterized protein LOC102617837 isoform X4 [Citrus 
sinensis]
 ref|XP_006493285.1| PREDICTED: uncharacterized protein LOC102617837 isoform X5 [Citrus 
sinensis]
 ref|XP_006493286.1| PREDICTED: uncharacterized protein LOC102617837 isoform X6 [Citrus 
sinensis]
 ref|XP_006493287.1| PREDICTED: uncharacterized protein LOC102617837 isoform X7 [Citrus 
sinensis]
Length=633

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 207/310 (67%), Gaps = 32/310 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG  GLCISHGGGRRC+   C KGAQGSTMFCKAHGGGKR
Sbjct  319   LCIKHGGGKRCKMEGCTRSAEGQVGLCISHGGGRRCRCEGCNKGAQGSTMFCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE C KSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  439   KSARGRTDCCVRHGGGKRCKFENCAKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRTENMKEIDTTEDMDA  592
               FARGK+GLCA+H +LVQ+++   G  +G      +V   +   + +     +T  + A
Sbjct  490   EKFARGKSGLCAAHSSLVQEQQTSKGGLIGPGLFHGLVSTASTAASCSFDNTYSTSGVSA  549

Query  591   DSMTVERSVV------------------TSANGSDWKYISFKQATMPILGSPPSIPVTIP  466
              S  +E   +                   S+       IS KQ     + S  ++ + +P
Sbjct  550   VSDCIESLEMPVKQQQLLPPLLLVPLSMKSSTSYSSFLISEKQKEQRKVFSGQNLDLVVP  609

Query  465   EGRVHGGSLL  436
             EGRVHGG  +
Sbjct  610   EGRVHGGGFM  619


 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 128/218 (59%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGG+RC  
Sbjct  221   RTGNTKRCEFPGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQQ  280

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  281   LGCTKSAEGKTDLCIAHGGGRRCQFPEG--CAKAARGKSGLCIKHGGGKRCKMEGCTRSA  338

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RC+ EGC K AQGST FCKAHGGGKRC +             C   
Sbjct  339   EGQVGLCISHGGGRRCRCEGCNKGAQGSTMFCKAHGGGKRCIFA-----------GCTKG  387

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  +  K VHGG    V 
Sbjct  388   AEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVA  425



>ref|XP_009379709.1| PREDICTED: hornerin-like [Pyrus x bretschneideri]
 ref|XP_009379717.1| PREDICTED: hornerin-like [Pyrus x bretschneideri]
 ref|XP_009379725.1| PREDICTED: hornerin-like [Pyrus x bretschneideri]
Length=640

 Score =   315 bits (808),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 206/318 (65%), Gaps = 42/318 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQ+  C KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCKVDGCTRSAEGQAGLCISHGGGRRCQHEACAKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  380   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             +SARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  440   RSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARGK+GLCA+H ++VQD+ +     +G  +   +    +      D        S  
Sbjct  491   EKFARGKSGLCAAHSSMVQDRGIDKAGLIGPGLFHGLVSAASTAGSSFDNNHSSSGTSAI  550

Query  579   VERSVVTSANGSDWKYISFKQATMPI---------------------------LGS---P  490
              +   + S    +  ++   Q  +P+                           +GS    
Sbjct  551   SDS--MDSLEKPEKTHLIPSQVLVPLSMKSSSSYSHFSSSEKPEEGRDGYGVGVGSCSRI  608

Query  489   PSIPVTIPEGRVHGGSLL  436
              S    IPEGRVHGG L+
Sbjct  609   KSFEFKIPEGRVHGGPLM  626


 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 129/205 (63%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C  GA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KKCKFFGCRKGARGASGLCIGHGGGQRCQKPGCKNGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  287   SAEGKTEYCIAHGGGKRCGYPGG--CTKAARGKSGLCIRHGGGKRCKVDGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ E C K AQGST +CKAHGGGKRC + Q  ++  +G  P C     GK
Sbjct  345   LCISHGGGRRCQHEACAKGAQGSTMYCKAHGGGKRCIF-QGCTKGAEGSTPLCKGHGGGK  403

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  404   R--CLFDGGGICPKSVHGGTNFCVA  426



>ref|XP_008218884.1| PREDICTED: uncharacterized protein LOC103319151 [Prunus mume]
Length=639

 Score =   315 bits (807),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 207/317 (65%), Gaps = 41/317 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + CT+SAEG +GLCISHGGGRRCQY  C KGAQGSTM+CKAHGGGKR
Sbjct  320   LCIRHGGGKRCKVDGCTRSAEGQAGLCISHGGGRRCQYQGCAKGAQGSTMYCKAHGGGKR  379

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V DCT
Sbjct  380   CIFQGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPDCT  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+F+ CGKSAQGSTDFCKAHGGGKRC W     E GK    C
Sbjct  440   KSARGRTDCCVRHGGGKRCKFDNCGKSAQGSTDFCKAHGGGKRCTW-----EEGK----C  490

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARG +G   +H ++VQD+  + G  +G  +   +    +      D   +  +  ++
Sbjct  491   EKFARGTSGXXXAHSSMVQDRETNKGGLIGPGLFHGLVSASSTAGSSFDN--NHSSSGIS  548

Query  579   VERSVVTSANGSDWKYISFKQATMPI-----------LGSPP------------------  487
             V    V S      +++   Q  +P+               P                  
Sbjct  549   VISDSVESLEKPGKRHLIPSQVLVPLSMKSSSYSNFFSSEKPDERRNEYGIGVDSSDGIK  608

Query  486   SIPVTIPEGRVHGGSLL  436
             S+   IPEGRVHGG L+
Sbjct  609   SLDFKIPEGRVHGGPLM  625


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 132/205 (64%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  227   KKCKFFGCRKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCQHLGCTK  286

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  287   SAEGKTDYCIAHGGGKRCGYPGG--CTKAARGRSGLCIRHGGGKRCKVDGCTRSAEGQAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ++GC K AQGST +CKAHGGGKRC + Q  ++  +G  P C     GK
Sbjct  345   LCISHGGGRRCQYQGCAKGAQGSTMYCKAHGGGKRCIF-QGCTKGAEGSTPLCKGHGGGK  403

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  404   R--CLFDGGGICPKSVHGGTNFCVA  426



>ref|XP_008656082.1| PREDICTED: loricrin-like [Zea mays]
 ref|XP_008656083.1| PREDICTED: loricrin-like [Zea mays]
 gb|ACN27817.1| unknown [Zea mays]
 gb|ACN29176.1| unknown [Zea mays]
 gb|AFW81272.1| hypothetical protein ZEAMMB73_277508 [Zea mays]
Length=628

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 204/294 (69%), Gaps = 23/294 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ+E+C +SAEG SGLCISHGGGRRCQ+P+C KGAQGST  CKAHGGGKR
Sbjct  328   LCIKHGGGKRCQRESCRRSAEGHSGLCISHGGGRRCQFPECAKGAQGSTGLCKAHGGGKR  387

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGG---VCPKSVHGGTLYCVAHGGGKRCAVT  946
             C + GCT+GAEGST  CK HGGGKRC  QGGG    CPKSVHGGT YCVAHGGGKRC V 
Sbjct  388   CTFPGCTRGAEGSTWLCKAHGGGKRCAHQGGGGGGACPKSVHGGTRYCVAHGGGKRCLVA  447

Query  945   DCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGE  766
              CT+SARGRT+ CVRHGGG+RC+ EGC KSAQGSTDFCKAHGGGKRC WGQ  S  G G 
Sbjct  448   GCTRSARGRTEHCVRHGGGRRCRAEGCAKSAQGSTDFCKAHGGGKRCVWGQEGSSLGAGG  507

Query  765   IPCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADS  586
              PC+ FAR + GLCA HGALV+D+ VHGG +LG             + ++  T D +  +
Sbjct  508   PPCDRFARSRVGLCAGHGALVEDRCVHGGGSLGPA---------PAIGQL--TTDCEPAA  556

Query  585   MTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIP----EGRVHGGSLL  436
                 R     A+G +  ++     T+   G   S   T P    EGRVHG  LL
Sbjct  557   AAATRGDADMADGDEEAFL-----TLGWNGDGESAGATAPAPFMEGRVHGSGLL  605


 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 115/185 (62%), Gaps = 14/185 (8%)
 Frame = -3

Query  1266  CQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGA  1087
             CQ   C K A G SG CI+HGGGRRCQ P C KGA+G T++CKAHGGG+RC Y GCTK A
Sbjct  238   CQFPGCEKGARGASGYCIAHGGGRRCQKPGCQKGAEGRTIYCKAHGGGRRCQYLGCTKSA  297

Query  1086  EGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFC  907
             EG T  C  HGGG+RC   G   C ++  G +  C+ HGGGKRC    C +SA G +  C
Sbjct  298   EGRTDHCIAHGGGRRCSQDG---CSRAARGRSGLCIKHGGGKRCQRESCRRSAEGHSGLC  354

Query  906   VRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGL  727
             + HGGG+RCQF  C K AQGST  CKAHGGGKRC +             C   A G T L
Sbjct  355   ISHGGGRRCQFPECAKGAQGSTGLCKAHGGGKRCTF-----------PGCTRGAEGSTWL  403

Query  726   CASHG  712
             C +HG
Sbjct  404   CKAHG  408



>ref|XP_003563651.1| PREDICTED: uncharacterized protein LOC100836935 [Brachypodium 
distachyon]
Length=620

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/286 (59%), Positives = 197/286 (69%), Gaps = 30/286 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC++ENC+KSAEG SGLCI+HGGGRRCQ+  C KG+QGST FCKAHGGGKRC
Sbjct  339   CIKHGGGKRCRQENCSKSAEGRSGLCIAHGGGRRCQHDGCGKGSQGSTAFCKAHGGGKRC  398

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  CTKGAEGSTPFCKGHGGGKRC   G   C KSVHGGT +CVAHGGGKRC V  CTK
Sbjct  399   THPNCTKGAEGSTPFCKGHGGGKRCSGHG---CTKSVHGGTQFCVAHGGGKRCVVEGCTK  455

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRC + GC KSAQGSTDFCKAHGGGKRC WG P S+ G G  PC+
Sbjct  456   SARGRTDRCVGHGGGKRCIYAGCDKSAQGSTDFCKAHGGGKRCLWGHPGSDLGVGGPPCD  515

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK G+C  H  L+ D R+HGG TLG      T   + ++ +  +  ++  DS+ + 
Sbjct  516   RLARGKNGMCVHHNPLLDDDRIHGGRTLGAFSVTST---SRDLGDCLSNAEISRDSILMH  572

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                                   P+      +PV +PEGRVHGG+L+
Sbjct  573   ----------------------PV--EDCHVPVPVPEGRVHGGNLV  594


 Score =   181 bits (459),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 127/210 (60%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRC    C KGA+G T+FCKAHGGG+RC   GCTK
Sbjct  246   KVCSHPGCIKGARGSSGRCIAHGGGRRCHKEGCNKGAEGKTIFCKAHGGGRRCENLGCTK  305

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC+ +G   C ++  G +  C+ HGGGKRC   +C+KSA GR+ 
Sbjct  306   SAEGRTDFCIAHGGGQRCIHEG---CRRASRGKSGRCIKHGGGKRCRQENCSKSAEGRSG  362

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ +GCGK +QGST FCKAHGGGKRC    P+         C   A G T
Sbjct  363   LCIAHGGGRRCQHDGCGKGSQGSTAFCKAHGGGKRCT--HPN---------CTKGAEGST  411

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C  HG   +       K VHGG    V 
Sbjct  412   PFCKGHGGGKRCSGHGCTKSVHGGTQFCVA  441



>ref|XP_006656131.1| PREDICTED: uncharacterized protein LOC102710413 [Oryza brachyantha]
Length=629

 Score =   315 bits (806),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 171/212 (81%), Gaps = 3/212 (1%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQK+NCTKSAEG SG CI+HGGGRRC++  CTKGAQGST FCKAHGGGKR
Sbjct  339   LCIKHGGGKRCQKQNCTKSAEGQSGFCIAHGGGRRCKHEGCTKGAQGSTNFCKAHGGGKR  398

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C Y  CTKGAEGST  CK HGGGKRC   G   CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  399   CTYLNCTKGAEGSTALCKAHGGGKRCSADG---CPKSVHGGTEFCVAHGGGKRCVVPGCT  455

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRCQF GC KSAQGSTDFCKAHGGGKRC WGQP S  G G   C
Sbjct  456   KSARGRTDCCVRHGGGKRCQFTGCSKSAQGSTDFCKAHGGGKRCLWGQPGSGIGDGSGTC  515

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK GLC +H ALV+D RV GG T+G +
Sbjct  516   ERFARGKKGLCVAHNALVEDSRVRGGQTVGAM  547


 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 132/210 (63%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C +  C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  247   KICSQPGCAKGARGSSGRCIAHGGGRRCQREGCRKGAEGKTIFCKAHGGGRRCEHLGCTK  306

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C K+  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  307   SAEGRTDYCIAHGGGRRCSREG---CRKAARGKSGLCIKHGGGKRCQKQNCTKSAEGQSG  363

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RC+ EGC K AQGST+FCKAHGGGKRC +           + C   A G T
Sbjct  364   FCIAHGGGRRCKHEGCTKGAQGSTNFCKAHGGGKRCTY-----------LNCTKGAEGST  412

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
              LC +HG   +       K VHGG    V 
Sbjct  413   ALCKAHGGGKRCSADGCPKSVHGGTEFCVA  442



>ref|XP_011092406.1| PREDICTED: uncharacterized protein LOC105172591 isoform X2 [Sesamum 
indicum]
Length=604

 Score =   313 bits (802),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 180/231 (78%), Gaps = 10/231 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG  GLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  289   LCIRHGGGKRCKVEGCTRSAEGQVGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  348

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  349   CIFAGCTKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  408

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  409   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  459

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTT  607
               FARGK+GLCA+H +L+Q +       +G  + + + P  +      D T
Sbjct  460   EKFARGKSGLCAAHTSLLQGRETKKEGMIGPGLFRGLVPATSAARSSFDNT  510


 Score =   189 bits (480),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   CTK A G +GLCI HGGG RCQ P C KGA+  T FCKAHGGG+RC + GCTK
Sbjct  196   KKCKFAGCTKGARGATGLCIGHGGGERCQKPGCNKGAESRTAFCKAHGGGRRCQHLGCTK  255

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  256   SAEGKTDFCIAHGGGRRCGHPGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQVG  313

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  314   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKGAEGST  362

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  +  K VHGG    V 
Sbjct  363   PLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVA  395



>ref|XP_011092401.1| PREDICTED: uncharacterized protein LOC105172591 isoform X1 [Sesamum 
indicum]
 ref|XP_011092403.1| PREDICTED: uncharacterized protein LOC105172591 isoform X1 [Sesamum 
indicum]
 ref|XP_011092404.1| PREDICTED: uncharacterized protein LOC105172591 isoform X1 [Sesamum 
indicum]
 ref|XP_011092405.1| PREDICTED: uncharacterized protein LOC105172591 isoform X1 [Sesamum 
indicum]
Length=636

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 180/231 (78%), Gaps = 10/231 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG  GLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  321   LCIRHGGGKRCKVEGCTRSAEGQVGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  380

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  381   CIFAGCTKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  440

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  441   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  491

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTT  607
               FARGK+GLCA+H +L+Q +       +G  + + + P  +      D T
Sbjct  492   EKFARGKSGLCAAHTSLLQGRETKKEGMIGPGLFRGLVPATSAARSSFDNT  542


 Score =   189 bits (481),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   CTK A G +GLCI HGGG RCQ P C KGA+  T FCKAHGGG+RC + GCTK
Sbjct  228   KKCKFAGCTKGARGATGLCIGHGGGERCQKPGCNKGAESRTAFCKAHGGGRRCQHLGCTK  287

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   GG  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  288   SAEGKTDFCIAHGGGRRCGHPGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQVG  345

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  346   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKGAEGST  394

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  +  K VHGG    V 
Sbjct  395   PLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVA  427



>gb|KJB79709.1| hypothetical protein B456_013G063300 [Gossypium raimondii]
 gb|KJB79710.1| hypothetical protein B456_013G063300 [Gossypium raimondii]
Length=645

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 175/209 (84%), Gaps = 9/209 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ+P CTKGAQGSTMFCKAHGGGKR
Sbjct  324   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQFPACTKGAQGSTMFCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTD CKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDLCKAHGGGKRCSW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL  670
               FARG++GLCA+H +++Q+++   G  +
Sbjct  495   EKFARGRSGLCAAHSSMLQERQASKGGLI  523


 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 121/192 (63%), Gaps = 13/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G +GLCI HGGG+RCQ   C KGA+  T+FCKAHGGG+RC +
Sbjct  226   RTSNSKKCKFAGCFKGARGATGLCIGHGGGQRCQKAGCNKGAESRTVFCKAHGGGRRCQH  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  286   LGCTKSAEGKTDFCIAHGGGRRCGFSGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   
Sbjct  344   EGQAGLCISHGGGRRCQFPACTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKG  392

Query  747   ARGKTGLCASHG  712
             A G T LC  HG
Sbjct  393   AEGSTPLCKGHG  404



>ref|XP_003579890.1| PREDICTED: uncharacterized protein LOC100843615 [Brachypodium 
distachyon]
 ref|XP_010239985.1| PREDICTED: uncharacterized protein LOC100843615 [Brachypodium 
distachyon]
Length=631

 Score =   314 bits (804),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 203/303 (67%), Gaps = 32/303 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  329   CIKHGGGKRCAMEGCIRSAEGKAGLCISHGGGRRCQYPDCGKGAQGSTLYCKAHGGGKRC  388

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC++GAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT +CVAHGGGKRCA   CTK
Sbjct  389   IFDGCSRGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTDFCVAHGGGKRCAAPGCTK  448

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  449   SARGRTDSCVKHGGGKRCRIDNCGKSAQGSTDFCKAHGGGKRCTWGS----------GCE  498

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARGK+GLCA+HG L   ++ HG    G  +  I P     +    TT    A SMT E
Sbjct  499   KFARGKSGLCAAHGTLRARQQEHGVVKNGGSM--IGPGLFSGIVVSSTTA---ASSMTNE  553

Query  573   RSVVTSANGSDWKYISFKQATMP-----------ILGSPPSIP------VTIPEGRVHGG  445
              S    +  SD       Q+ +P              S P++         +PEGRVHGG
Sbjct  554   HSSSGISTASDSDGTVRSQSMIPPQLLVPRSMMPSSSSEPTVRGGREGGCVVPEGRVHGG  613

Query  444   SLL  436
              L+
Sbjct  614   DLM  616


 Score =   184 bits (467),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 130/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  236   KKCRFKGCSKGARGSSGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEQLGCTK  295

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC       CPK+  G +  C+ HGGGKRCA+  C +SA G+  
Sbjct  296   SAEGKTDYCIAHGGGRRCEHPD---CPKAARGKSGRCIKHGGGKRCAMEGCIRSAEGKAG  352

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  CGK AQGST +CKAHGGGKRC +             C+  A G T
Sbjct  353   LCISHGGGRRCQYPDCGKGAQGSTLYCKAHGGGKRCIFDG-----------CSRGAEGST  401

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  V  K VHGG    V 
Sbjct  402   PLCKAHGGGKRCMFEGGGVCPKSVHGGTDFCVA  434



>ref|XP_010030066.1| PREDICTED: uncharacterized protein LOC104419929 [Eucalyptus grandis]
 gb|KCW57025.1| hypothetical protein EUGRSUZ_I02691 [Eucalyptus grandis]
Length=641

 Score =   313 bits (803),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 206/313 (66%), Gaps = 40/313 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ+P C+KGAQGSTM+CKAHGGGKR
Sbjct  319   LCIRHGGGKRCKMEGCTRSAEGQAGLCISHGGGRRCQHPACSKGAQGSTMYCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLYDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W          E  C
Sbjct  439   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTW---------PEGKC  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG-------VVVQEITPKRTENMKEI----DT  610
               FARGK+GLCA+H ++VQ +  + G  +G       V V        +N        D+
Sbjct  490   EKFARGKSGLCAAHSSMVQLRENNRGCLIGPGLFHGLVSVASTARSSLDNTHSSSGIGDS  549

Query  609   TEDMDADS----MTVERSVVTSANGSDWKYISFKQATMPILGSP----------------  490
              + ++  +    +   + +V  +  S      F  A  P  G+                 
Sbjct  550   VDSLERPAKRQHLIPPQVLVPLSMKSSSSCSPFVSAEKPEAGTSGYGARFDVGGSSSGAR  609

Query  489   PSIPVTIPEGRVH  451
              S+   IPEGRVH
Sbjct  610   RSLDAMIPEGRVH  622


 Score =   180 bits (456),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 126/213 (59%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  226   KKCKAHGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQHLGCTK  285

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC   GG  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  286   SAEGKTDHCIAHGGGRRCGHPGG--CTKAARGKSGLCIRHGGGKRCKMEGCTRSAEGQAG  343

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  344   LCISHGGGRRCQHPACSKGAQGSTMYCKAHGGGKRCIFAG-----------CTKGAEGST  392

Query  732   GLCASHGA---LVQD------KRVHGGATLGVV  661
              LC  HG     + D      K VHGG    V 
Sbjct  393   PLCKGHGGGKRCLYDGGGICPKSVHGGTNFCVA  425



>gb|EMS68953.1| hypothetical protein TRIUR3_05473 [Triticum urartu]
Length=639

 Score =   313 bits (802),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 196/286 (69%), Gaps = 28/286 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQ+ENCTKSAEG SGLCI+HGGG RCQ+  CTKGAQGST FCK+HGGG+RC
Sbjct  340   CIKHGGGKRCQQENCTKSAEGRSGLCIAHGGGPRCQHAGCTKGAQGSTDFCKSHGGGRRC  399

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  CTKGAEGSTPFCKGHGGGKRC  QG   C K VHGGT +CVAHGGGKRC V  CTK
Sbjct  400   THPDCTKGAEGSTPFCKGHGGGKRCSAQG---CTKCVHGGTQFCVAHGGGKRCVVEGCTK  456

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRC   GC KSAQGSTDFCKAHGGGKRC WG P S+ G G  PC+
Sbjct  457   SARGRTDRCVGHGGGKRCVSVGCDKSAQGSTDFCKAHGGGKRCTWGHPGSDLGVGSPPCD  516

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK G+C  H  L+ D R+HGG TL           T +   +D      A+S T  
Sbjct  517   RLARGKKGMCVHHNPLLDDDRIHGGRTLAAF------SITSSAASLD-RRSHPANSETSR  569

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             RS+                +TM  + +P   P  +PEGRVHGG+++
Sbjct  570   RSI----------------STMLPVEAPGRAP--LPEGRVHGGNIV  597


 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 118/187 (63%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRC+   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  247   KVCSYPGCRKGARGSSGRCIAHGGGRRCRREGCNKGAEGKTIYCKAHGGGRRCGHLGCTK  306

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC GHGGG+RC+  G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  307   SAEGRTDFCIGHGGGRRCIHDG---CRRAARGKSGRCIKHGGGKRCQQENCTKSAEGRSG  363

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG RCQ  GC K AQGSTDFCK+HGGG+RC               C   A G T
Sbjct  364   LCIAHGGGPRCQHAGCTKGAQGSTDFCKSHGGGRRCT-----------HPDCTKGAEGST  412

Query  732   GLCASHG  712
               C  HG
Sbjct  413   PFCKGHG  419



>ref|XP_009404065.1| PREDICTED: uncharacterized protein LOC103987474 [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   313 bits (803),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 172/304 (57%), Positives = 202/304 (66%), Gaps = 32/304 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST +CKAHGGG+R
Sbjct  341   LCIKHGGGKRCIVEGCTRSAEGQPGLCISHGGGRRCQYPDCWKGAQGSTNYCKAHGGGRR  400

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI++GCTKGAEGSTP CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  401   CIFQGCTKGAEGSTPLCKGHGGGKRCLFEGGGVCPKSVHGGTQFCVAHGGGKRCAVAGCT  460

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC FEGC KSAQG TDFCKAHGGGKRC W             C
Sbjct  461   KSARGRTDCCVRHGGGKRCHFEGCNKSAQGKTDFCKAHGGGKRCTWAP----------GC  510

Query  756   NSFARGKTGLCASHGALV-QDKRVHGGATLGVVVQEITPKRTENMKEIDTTED---MDAD  589
             + FARG++GLCA+HG ++   +    G T G++   +      +   + ++ D     A 
Sbjct  511   DKFARGRSGLCAAHGTMMAAQQECEAGKTGGMIGPGLFQGIVASSVTVGSSMDNGYTSAG  570

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPIL--GSPPSIPV----------------TIPE  463
               +V   V + AN    +     Q  +P+     PPS+ +                 +PE
Sbjct  571   FSSVSDCVESQANARQHQLHIPPQVLVPMSMKSPPPSVSIGFGGGVDDSQEKNSGFVVPE  630

Query  462   GRVH  451
             GRVH
Sbjct  631   GRVH  634


 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 130/211 (62%), Gaps = 7/211 (3%)
 Frame = -3

Query  1290  IRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCI  1111
             I H   ++C  E C+K A G SGLCI HGGG+RCQ P C KG + +  FCKAHGGG+RC 
Sbjct  243   IHHRHPRKCMFEGCSKCARGASGLCIGHGGGQRCQKPGCNKGTESTAAFCKAHGGGRRCQ  302

Query  1110  YEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKS  931
               GCTK A+G T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CT+S
Sbjct  303   MLGCTKSADGKTDFCIAHGGGRRCTHLG---CAKAARGKSGLCIKHGGGKRCIVEGCTRS  359

Query  930   ARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CN  754
             A G+   C+ HGGG+RCQ+  C K AQGST++CKAHGGG+RC + Q  ++  +G  P C 
Sbjct  360   AEGQPGLCISHGGGRRCQYPDCWKGAQGSTNYCKAHGGGRRCIF-QGCTKGAEGSTPLCK  418

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVV  661
                 GK   C   G  V  K VHGG    V 
Sbjct  419   GHGGGKR--CLFEGGGVCPKSVHGGTQFCVA  447



>ref|XP_007043029.1| Emb:CAB89363.1 [Theobroma cacao]
 gb|EOX98860.1| Emb:CAB89363.1 [Theobroma cacao]
Length=644

 Score =   313 bits (801),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 175/209 (84%), Gaps = 9/209 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ+ +CTKG+QGSTM+CKAHGGGKR
Sbjct  323   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQFQECTKGSQGSTMYCKAHGGGKR  382

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCT+GAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  383   CIFAGCTRGAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  442

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  443   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  493

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL  670
               FARG++GLCA+H ++VQ++    G  +
Sbjct  494   EKFARGRSGLCAAHSSMVQEREASKGGLI  522


 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 130/218 (60%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   CTK A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC +
Sbjct  225   RTSNSKKCKFAGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQH  284

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  285   LGCTKSAEGKTEFCIAHGGGRRCGFPGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSA  342

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQF+ C K +QGST +CKAHGGGKRC +             C   
Sbjct  343   EGQAGLCISHGGGRRCQFQECTKGSQGSTMYCKAHGGGKRCIFAG-----------CTRG  391

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  +  K VHGG    V 
Sbjct  392   AEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVA  429



>gb|EMT09274.1| hypothetical protein F775_28888 [Aegilops tauschii]
Length=630

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/285 (60%), Positives = 199/285 (70%), Gaps = 17/285 (6%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  328   CIKHGGGKRCAMEGCIRSAEGKAGLCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRC  387

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC++GAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT +CVAHGGGKRCA   CTK
Sbjct  388   VFDGCSRGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVAHGGGKRCAAPGCTK  447

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  448   SARGRTDCCVKHGGGKRCRIDNCGKSAQGSTDFCKAHGGGKRCTWGS----------GCE  497

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARGK+GLCA+HG LV  ++ HG    G  +  I P     +    TT    A SMT E
Sbjct  498   KFARGKSGLCAAHGTLVARQQEHGMVKSGGSM--IGPGLFSGIVASSTTA---ASSMTNE  552

Query  573   RSVVTSANGSDWKYISFKQATMP--ILGSPPSIPVTIPEGRVHGG  445
              S    +  SD       QA +P  +L     +P +  E  VHGG
Sbjct  553   HSSSGISTASDSDGTVRSQAMIPPQLLVPRSMMPSSSSEPTVHGG  597


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 129/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K   G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  235   KKCRFKGCSKGGRGSSGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  294

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +     CPK+  G +  C+ HGGGKRCA+  C +SA G+  
Sbjct  295   SAEGKTDYCIAHGGGRRCEYPD---CPKAARGKSGRCIKHGGGKRCAMEGCIRSAEGKAG  351

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C+  A G T
Sbjct  352   LCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRCVFDG-----------CSRGAEGST  400

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  V  K VHGG    V 
Sbjct  401   PLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVA  433



>ref|XP_002453636.1| hypothetical protein SORBIDRAFT_04g009650 [Sorghum bicolor]
 gb|EES06612.1| hypothetical protein SORBIDRAFT_04g009650 [Sorghum bicolor]
Length=628

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 190/287 (66%), Gaps = 29/287 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQK NCTKSAEG SG+CI+HGGGRRCQY  C KGAQGST FCKAHGGGKR
Sbjct  328   LCIKHGGGKRCQKPNCTKSAEGRSGMCIAHGGGRRCQYAGCGKGAQGSTNFCKAHGGGKR  387

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +  C+KGAEGSTPFCK HGGGKRC   G   C KSVHGGT +CVAHGGGKRCAV  C 
Sbjct  388   CTHPDCSKGAEGSTPFCKAHGGGKRCSADG---CTKSVHGGTQFCVAHGGGKRCAVEGCR  444

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV HGGGKRC   GCGKSAQGSTDFCK+HGGG+RC WG P S+ G G   C
Sbjct  445   KSARGRTDRCVGHGGGKRCHSAGCGKSAQGSTDFCKSHGGGRRCSWGHPGSDLGSGSAAC  504

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             +  ARGK GLC  H  LV D  VHGGA+ G                            ++
Sbjct  505   DRLARGKKGLCDRHNPLVDDNSVHGGASFG--------------------------GFSI  538

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               + ++  +GS     S +   M  + +P  +  +  EGRVHGG+ +
Sbjct  539   VSAALSEGDGSPVTETSMRSFFMHTVEAPRHVAASAHEGRVHGGNFM  585


 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 132/215 (61%), Gaps = 20/215 (9%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+   K C +  C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGGKRC +
Sbjct  231   RNSSTKICSEPGCAKGARGSSGRCIAHGGGRRCQKEGCNKGAEGKTIFCKAHGGGKRCEH  290

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  291   LGCTKSAEGRTDFCIAHGGGRRCSHEG---CKRAARGKSGLCIKHGGGKRCQKPNCTKSA  347

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              GR+  C+ HGGG+RCQ+ GCGK AQGST+FCKAHGGGKRC               C+  
Sbjct  348   EGRSGMCIAHGGGRRCQYAGCGKGAQGSTNFCKAHGGGKRCT-----------HPDCSKG  396

Query  747   ARGKTGLCASHGALVQ------DKRVHGGATLGVV  661
             A G T  C +HG   +       K VHGG    V 
Sbjct  397   AEGSTPFCKAHGGGKRCSADGCTKSVHGGTQFCVA  431



>gb|EMS48571.1| hypothetical protein TRIUR3_18004 [Triticum urartu]
Length=631

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/285 (60%), Positives = 199/285 (70%), Gaps = 17/285 (6%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  329   CIKHGGGKRCAMEGCIRSAEGKAGLCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRC  388

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC++GAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT +CVAHGGGKRCA   CTK
Sbjct  389   VFDGCSRGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVAHGGGKRCAAPGCTK  448

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  449   SARGRTDCCVKHGGGKRCRIDNCGKSAQGSTDFCKAHGGGKRCTWGS----------GCE  498

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARGK+GLCA+HG LV  ++ HG    G  +  I P     +    TT    A SMT E
Sbjct  499   KFARGKSGLCAAHGTLVARQQEHGMVKSGGSM--IGPGLFSGIVASSTTA---ASSMTNE  553

Query  573   RSVVTSANGSDWKYISFKQATMP--ILGSPPSIPVTIPEGRVHGG  445
              S    +  SD       QA +P  +L     +P +  E  VHGG
Sbjct  554   HSSSGISTASDSDGTVRSQAMIPPQLLVPRSMMPSSSSEPTVHGG  598


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 129/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K   G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  236   KKCRFKGCSKGGRGSSGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  295

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +     CPK+  G +  C+ HGGGKRCA+  C +SA G+  
Sbjct  296   SAEGKTDYCIAHGGGRRCEYPD---CPKAARGKSGRCIKHGGGKRCAMEGCIRSAEGKAG  352

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C+  A G T
Sbjct  353   LCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRCVFDG-----------CSRGAEGST  401

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  V  K VHGG    V 
Sbjct  402   PLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVA  434



>ref|XP_002304079.2| hypothetical protein POPTR_0003s01750g [Populus trichocarpa]
 gb|EEE79058.2| hypothetical protein POPTR_0003s01750g [Populus trichocarpa]
Length=642

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 173/314 (55%), Positives = 206/314 (66%), Gaps = 36/314 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E+CT+SAEG +GLCISHGGGRRC++  CTKGAQGST +CKAHGGGKR
Sbjct  324   LCIRHGGGKRCKVEDCTRSAEGQAGLCISHGGGRRCEHQGCTKGAQGSTGYCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCRVDNCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKR------VHGGATLGVVVQEITP-KRTENMKEIDTTEDM  598
               FARGK+GLCA+H ++VQ++       +  G   G+V    T     +N         +
Sbjct  495   EKFARGKSGLCAAHSSMVQEREANRTGLIRPGLFHGLVSAASTAGSSIDNNHSYSGVSAV  554

Query  597   DADSMTVERS-----------VVTSANGSDWKYISFKQATM---------PILGSPPSIP  478
                S ++E+            +V  +  +   + SF  A              G   +  
Sbjct  555   SDCSDSLEKPAKRLHLIPPQVLVPHSMKATSSFTSFMNADNLEEGTNGYGATSGGKKNFD  614

Query  477   VTIPEGRVHGGSLL  436
               +PEGRVHGG L+
Sbjct  615   YLVPEGRVHGGGLM  628


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 121/187 (65%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CK HGGG+RC + GCTK
Sbjct  231   KKCKFLGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKVHGGGRRCQHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V DCT+SA G+  
Sbjct  291   SAEGKTDLCIAHGGGRRCGFPGG--CTKAARGKSGLCIRHGGGKRCKVEDCTRSAEGQAG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC+ +GC K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  349   LCISHGGGRRCEHQGCTKGAQGSTGYCKAHGGGKRCIFAG-----------CTKGAEGST  397

Query  732   GLCASHG  712
              LC  HG
Sbjct  398   PLCKGHG  404



>ref|XP_008811578.1| PREDICTED: uncharacterized protein LOC103722706 [Phoenix dactylifera]
 ref|XP_008811579.1| PREDICTED: uncharacterized protein LOC103722706 [Phoenix dactylifera]
Length=652

 Score =   311 bits (798),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 207/309 (67%), Gaps = 34/309 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E C++SAEG +GLCISHGGGRRCQ+P C KGAQGST +CKAHGGGKR
Sbjct  340   LCIRHGGGKRCAVEGCSRSAEGQAGLCISHGGGRRCQFPSCGKGAQGSTKYCKAHGGGKR  399

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +EGCTKGAEGSTP CKGHGGGKRCLF+ GGVCPKSVHGGT +CVAHGGGKRC +  CT
Sbjct  400   CTFEGCTKGAEGSTPLCKGHGGGKRCLFESGGVCPKSVHGGTNFCVAHGGGKRCTMLGCT  459

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC FE CGKSAQGSTDFCKAHGGGKRC WG          + C
Sbjct  460   KSARGRTDHCVRHGGGKRCHFEECGKSAQGSTDFCKAHGGGKRCTWG----------LGC  509

Query  756   NSFARGKTGLCASHGAL---VQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDAD  589
             + FARG+  LCA+HG++    + + V  G+ +G  + Q I       M    T +D    
Sbjct  510   DKFARGRCRLCAAHGSMKARQESEAVKSGSMIGPGLFQGIV--SLSAMAGSSTDKDYSTS  567

Query  588   SMTVERSVVTSANGS----DWKYISFKQATMPI-------------LGS-PPSIPVTIPE  463
               T   S V+    S      + +   Q  +P+             +GS   S  + IPE
Sbjct  568   YSTSGASSVSDCTESPVDGQQQLLIPPQVLVPVSMKSPSSSSASMTVGSLTKSSRLMIPE  627

Query  462   GRVHGGSLL  436
             GRVHGG+L+
Sbjct  628   GRVHGGNLM  636


 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C  + C+K A G S LCI+HGGG+RCQ P C KGA+  T FCKAHGGG+RC   GCTK
Sbjct  248   KKCMFDGCSKGARGASRLCITHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQMLGCTK  307

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRCAV  C++SA G+  
Sbjct  308   SAEGKTEFCIAHGGGRRCGHLG---CSKAARGKSGLCIRHGGGKRCAVEGCSRSAEGQAG  364

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  CGK AQGST +CKAHGGGKRC +             C   A G T
Sbjct  365   LCISHGGGRRCQFPSCGKGAQGSTKYCKAHGGGKRCTFEG-----------CTKGAEGST  413

Query  732   GLCASHGA----LVQD-----KRVHGGATLGVV  661
              LC  HG     L +      K VHGG    V 
Sbjct  414   PLCKGHGGGKRCLFESGGVCPKSVHGGTNFCVA  446



>gb|EMT10282.1| hypothetical protein F775_27687 [Aegilops tauschii]
Length=638

 Score =   311 bits (797),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 171/286 (60%), Positives = 195/286 (68%), Gaps = 29/286 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQ+ENCTKSAEG SGLCI+HGGG RCQ+  CTKGAQGST FCK+HGGG+RC
Sbjct  340   CIKHGGGKRCQQENCTKSAEGRSGLCIAHGGGPRCQHAGCTKGAQGSTDFCKSHGGGRRC  399

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  CTKGAEGSTPFCKGHGGGKRC  QG   C K VHGGT +CVAHGGGKRC V  CTK
Sbjct  400   THPDCTKGAEGSTPFCKGHGGGKRCSAQG---CTKCVHGGTQFCVAHGGGKRCVVEGCTK  456

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRC   GC KSAQGSTDFCKAHGGGKRC WG P S+ G G  PC+
Sbjct  457   SARGRTDRCVGHGGGKRCISAGCDKSAQGSTDFCKAHGGGKRCTWGHPGSDLGAGSPPCD  516

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK G+C  H  L+ D R+HGG TL           T +   +D      A+S T  
Sbjct  517   RLARGKKGMCVHHNPLLDDDRIHGGRTLAAF------SITSSAASLD-RRSHPANSETSR  569

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             RS+                 +M  + +P   P  +PEGRVHGG+++
Sbjct  570   RSI-----------------SMLPVEAPGRAP--LPEGRVHGGNIV  596


 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 118/187 (63%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRC+   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  247   KVCSYPGCRKGARGSSGRCIAHGGGRRCRKEGCNKGAEGKTIFCKAHGGGRRCGHLGCTK  306

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC+  G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  307   SAEGRTDYCIGHGGGRRCIHDG---CRRAARGKSGRCIKHGGGKRCQQENCTKSAEGRSG  363

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG RCQ  GC K AQGSTDFCK+HGGG+RC               C   A G T
Sbjct  364   LCIAHGGGPRCQHAGCTKGAQGSTDFCKSHGGGRRCT-----------HPDCTKGAEGST  412

Query  732   GLCASHG  712
               C  HG
Sbjct  413   PFCKGHG  419



>ref|XP_007040390.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24891.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=657

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 220/375 (59%), Gaps = 58/375 (15%)
 Frame = -3

Query  1293  CIRHGGGKRCQK------------------------------------------------  1258
             CI HGGG+RCQK                                                
Sbjct  286   CISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRC  345

Query  1257  --ENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAE  1084
               E CT++A G SGLCI HGGG+RCQ   CTK A+G +  C +HGGG+RC + GCTKGA+
Sbjct  346   SHEGCTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQ  405

Query  1083  GSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD---CTKSARGRTD  913
             GST FCK HGGGKRC +     C K   G T +C  HGGGKRCA      CTKS  G T+
Sbjct  406   GSTMFCKAHGGGKRCTYPD---CTKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTN  462

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI-PCNSFARGK  736
             FCV HGGGKRC+FEGCGKSAQGSTDFCKAHGGGKRC WG P SE+G     PCNSFARGK
Sbjct  463   FCVAHGGGKRCKFEGCGKSAQGSTDFCKAHGGGKRCSWGHPGSEYGNQLSGPCNSFARGK  522

Query  735   TGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVERSVVTS  556
             TGLCA H  LVQDKRVHGGATLG +VQ+    ++E MKEI T EDM+ D M +   +  S
Sbjct  523   TGLCALHSGLVQDKRVHGGATLGPIVQDPKVSKSEKMKEIVTAEDMNVDIMKMGSDMEAS  582

Query  555   ANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLLsmlasnsdpslssSRGTE-N  379
             A  +      +      I        V +PEGRVHGGSL++MLA  S P    S G   +
Sbjct  583   AGRTCSSLNQYGVPNAHISVGERGFSVFVPEGRVHGGSLMAMLAGGSGPGSGDSEGLACD  642

Query  378   PSEPRKAYITHQSWM  334
             PSEP K+++  QSWM
Sbjct  643   PSEPSKSFMVTQSWM  657


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITRQQQPQQRSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKPG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390



>ref|XP_004951275.1| PREDICTED: uncharacterized protein LOC101764211 [Setaria italica]
Length=636

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 193/286 (67%), Gaps = 29/286 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQK NCTKSAEG SG+CI+HGGGRRCQ+  C KGAQGST FCKAHGGGKRC
Sbjct  333   CIKHGGGKRCQKLNCTKSAEGRSGMCIAHGGGRRCQHTDCGKGAQGSTNFCKAHGGGKRC  392

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  C+KGAEGSTPFCK HGGGKRC  +G   C KSVHGGT +CVAHGGGKRC V  C K
Sbjct  393   THPDCSKGAEGSTPFCKNHGGGKRCSAEG---CTKSVHGGTQFCVAHGGGKRCIVEGCRK  449

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRCQ  GCGKSAQGSTDFCKAHGGG+RC WGQP S+ G G  PC+
Sbjct  450   SARGRTDRCVGHGGGKRCQSTGCGKSAQGSTDFCKAHGGGRRCLWGQPGSDLGSGGAPCD  509

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK  LC  H ALV D  VHGGA+ GV                     M +D+++  
Sbjct  510   RLARGKRCLCDQHNALVDDNSVHGGASFGVF-------------------SMVSDALSHG  550

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              S  ++         S     M  + +P   P +  EGRVHGG+ +
Sbjct  551   ASPPSAG-------TSMHSFFMHPVEAPRRAPASAHEGRVHGGNFM  589


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 127/210 (60%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  240   KVCSYSGCVKGARGSSGRCIAHGGGRRCQKDGCNKGAEGKTIFCKAHGGGRRCDYLGCTK  299

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  300   SAEGRTDYCIAHGGGRRCSQEG---CKRAARGKSGRCIKHGGGKRCQKLNCTKSAEGRSG  356

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   CGK AQGST+FCKAHGGGKRC               C+  A G T
Sbjct  357   MCIAHGGGRRCQHTDCGKGAQGSTNFCKAHGGGKRCT-----------HPDCSKGAEGST  405

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C +HG   +       K VHGG    V 
Sbjct  406   PFCKNHGGGKRCSAEGCTKSVHGGTQFCVA  435



>gb|ERM94366.1| hypothetical protein AMTR_s00010p00248420 [Amborella trichopoda]
Length=601

 Score =   310 bits (793),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 201/307 (65%), Gaps = 31/307 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CT+SAEG +GLCISHGGGRRCQ P CTKGAQGSTM CKAHGGG+R
Sbjct  280   LCIRHGGGKRCQFEGCTRSAEGQAGLCISHGGGRRCQMPGCTKGAQGSTMHCKAHGGGRR  339

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCT+GAEGSTP CKGHGGG+RC F+GGGVCPKSVHGGT +CVAHGGGKRCA   CT
Sbjct  340   CIFAGCTRGAEGSTPLCKGHGGGRRCAFEGGGVCPKSVHGGTSFCVAHGGGKRCASPGCT  399

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC   GC KSAQGSTDFCKAHGGGKRC +G+  S   +G   C
Sbjct  400   KSARGRTDFCVRHGGGKRCAAPGCTKSAQGSTDFCKAHGGGKRCTYGREGS-VHEGMGSC  458

Query  756   NSFARGKTGLCASHGALVQDKR-----------VHGGATLGVVVQEITPKRTENMKEIDT  610
             + F+RGK+GLCA+HG+L+QD +           +     LG      T   T    E+  
Sbjct  459   DKFSRGKSGLCAAHGSLLQDPKSSKVGVGIGPGLFCDLVLGDNESSSTLSSTHFASEVAV  518

Query  609   TEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPP--------------SIPVT  472
                  +  M V R ++          +        ++GS                +  + 
Sbjct  519   DTCEGSSEMVVRRPLIPP-----QVLVPLSMKASSLVGSEKEREEGSGGSSCNLRTRALV  573

Query  471   IPEGRVH  451
             IPEGRVH
Sbjct  574   IPEGRVH  580


 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ E C K A G SGLCI HGGG+RCQ P CTKGA+  T++CKAHGGG+RC   GCTK
Sbjct  187   KKCKFEGCAKGARGASGLCIGHGGGQRCQKPGCTKGAESRTVYCKAHGGGRRCQTLGCTK  246

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC   GG  C K+  G +  C+ HGGGKRC    CT+SA G+  
Sbjct  247   SAEGRTDYCIGHGGGRRCSHPGG--CTKAARGKSGLCIRHGGGKRCQFEGCTRSAEGQAG  304

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST  CKAHGGG+RC +             C   A G T
Sbjct  305   LCISHGGGRRCQMPGCTKGAQGSTMHCKAHGGGRRCIFAG-----------CTRGAEGST  353

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG +  V 
Sbjct  354   PLCKGHGGGRRCAFEGGGVCPKSVHGGTSFCVA  386



>ref|XP_010916986.1| PREDICTED: uncharacterized protein LOC105041692 [Elaeis guineensis]
Length=649

 Score =   311 bits (796),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 203/314 (65%), Gaps = 48/314 (15%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E CT+SAEG +G CISHGGGRRCQ P C KGAQGST +CKAHGGGKR
Sbjct  340   LCIRHGGGKRCTVEGCTRSAEGQAGRCISHGGGRRCQCPGCGKGAQGSTRYCKAHGGGKR  399

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEGSTP CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRCA+  CT
Sbjct  400   CIFEGCTKGAEGSTPLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVAHGGGKRCAMPGCT  459

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC FEGCGKSAQGSTDFCKAHGGGKRC WG            C
Sbjct  460   KSARGRTDHCVRHGGGKRCHFEGCGKSAQGSTDFCKAHGGGKRCSWGS----------GC  509

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTT--EDMDADSM  583
             + FARG++GLCA+HG++   +    G +  +    I P   + +  +       MD D  
Sbjct  510   DKFARGRSGLCAAHGSMKARQESEAGRSGSM----IGPGLFQGIVSVSAMGGISMDKDCS  565

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPSIP-------------------------  478
             T   S V+    S        Q  + I   PP +                          
Sbjct  566   TSGASAVSDCTESPVN----GQRQLLI---PPQVLVPVSVKSPSSSSASVGVGSLAKTSG  618

Query  477   VTIPEGRVHGGSLL  436
               IPEGRVHGG+L+
Sbjct  619   FMIPEGRVHGGNLM  632


 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 125/213 (59%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C    C+K A G S LCI+HGGG+RCQ P C KGA+  T FCKAHGGG+RC   GCTK
Sbjct  248   KKCMFNGCSKGARGASRLCIAHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQMLGCTK  307

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  308   SAEGKTEFCIAHGGGRRC---GHPWCTKAARGKSGLCIRHGGGKRCTVEGCTRSAEGQAG  364

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GCGK AQGST +CKAHGGGKRC +             C   A G T
Sbjct  365   RCISHGGGRRCQCPGCGKGAQGSTRYCKAHGGGKRCIFEG-----------CTKGAEGST  413

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG    V 
Sbjct  414   PLCKGHGGGKRCLFEGGGVCPKSVHGGTNFCVA  446



>tpg|DAA35760.1| TPA: hypothetical protein ZEAMMB73_993422 [Zea mays]
Length=658

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 205/310 (66%), Gaps = 33/310 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC+ E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST+FCK+HGGGKR
Sbjct  341   FCIKHGGGKRCRIEGCTRSAEGHPGLCISHGGGRRCQYPNCDKGAQGSTIFCKSHGGGKR  400

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C+++GCT+GAEGST FCKGHGGGKRCLF+GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  401   CMFDGCTRGAEGSTSFCKGHGGGKRCLFEGGGMCPKSVHGGTSFCVAHGGGKRCSVPGCT  460

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGR+D CV+HGGGKRC+F+GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  461   KSARGRSDCCVKHGGGKRCRFDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  510

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI--------TPKRTENMKE------  619
             + FARG++GLCA+H  L+  K VH       +V           +     NM        
Sbjct  511   DKFARGRSGLCAAHTTLMASKVVHHPGHARSMVGPCHFSGGVSGSSAADSNMDHAISSSG  570

Query  618   -------IDTTEDM-DADSMTVERSVVTSANGSDWKYISFKQATMPILGS-PPSIPVTIP  466
                    +D++ DM  A  + + R V+   +  D              GS   S  + +P
Sbjct  571   HGAWSDCVDSSRDMQSAGRLLIPRQVLVPGSLKDAPSCGLAGNGQDDGGSRNQSCGLVVP  630

Query  465   EGRVHGGSLL  436
             EGRVHGG L+
Sbjct  631   EGRVHGGGLM  640


 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 127/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A   SGLCISHGGG+RCQ P C KGA+  T FCKAHGGG+RC   GCTK
Sbjct  249   KKCRFNGCSKGARDASGLCISHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQELGCTK  308

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +    CP++  G + +C+ HGGGKRC +  CT+SA G   
Sbjct  309   SAEGKTEFCIAHGGGRRCGIE---ECPRAARGKSGFCIKHGGGKRCRIEGCTRSAEGHPG  365

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCK+HGGGKRC +             C   A G T
Sbjct  366   LCISHGGGRRCQYPNCDKGAQGSTIFCKSHGGGKRCMFDG-----------CTRGAEGST  414

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
               C  HG     L +      K VHGG +  V 
Sbjct  415   SFCKGHGGGKRCLFEGGGMCPKSVHGGTSFCVA  447



>ref|XP_009586702.1| PREDICTED: uncharacterized protein LOC104084522 isoform X2 [Nicotiana 
tomentosiformis]
Length=634

 Score =   310 bits (794),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 178/231 (77%), Gaps = 14/231 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKR
Sbjct  316   LCIKHGGGKRCSVEGCTRSAEGKVGLCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  376   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  436   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRTENMKE  619
               FARG+ GLCA+H +L+  +  + G  +G      +V   +P +T   K 
Sbjct  487   EKFARGRGGLCAAHSSLLHGRNANKGGMIGPGLFHGLVPAASPVKTTFEKN  537


 Score =   189 bits (481),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  223   KRCKFPGCPKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCDHLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F GG  C ++  G +  C+ HGGGKRC+V  CT+SA G+  
Sbjct  283   SAEGKTDYCIAHGGGRRCSFTGG--CTRAARGRSGLCIKHGGGKRCSVEGCTRSAEGKVG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKRCIFAG-----------CTKGAEGST  389

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  390   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  422



>ref|XP_006827129.2| PREDICTED: uncharacterized protein LOC18422393 [Amborella trichopoda]
 ref|XP_011621890.1| PREDICTED: uncharacterized protein LOC18422393 [Amborella trichopoda]
 ref|XP_011621895.1| PREDICTED: uncharacterized protein LOC18422393 [Amborella trichopoda]
Length=625

 Score =   310 bits (794),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 201/307 (65%), Gaps = 31/307 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ E CT+SAEG +GLCISHGGGRRCQ P CTKGAQGSTM CKAHGGG+R
Sbjct  304   LCIRHGGGKRCQFEGCTRSAEGQAGLCISHGGGRRCQMPGCTKGAQGSTMHCKAHGGGRR  363

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCT+GAEGSTP CKGHGGG+RC F+GGGVCPKSVHGGT +CVAHGGGKRCA   CT
Sbjct  364   CIFAGCTRGAEGSTPLCKGHGGGRRCAFEGGGVCPKSVHGGTSFCVAHGGGKRCASPGCT  423

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTDFCVRHGGGKRC   GC KSAQGSTDFCKAHGGGKRC +G+  S   +G   C
Sbjct  424   KSARGRTDFCVRHGGGKRCAAPGCTKSAQGSTDFCKAHGGGKRCTYGREGS-VHEGMGSC  482

Query  756   NSFARGKTGLCASHGALVQDKR-----------VHGGATLGVVVQEITPKRTENMKEIDT  610
             + F+RGK+GLCA+HG+L+QD +           +     LG      T   T    E+  
Sbjct  483   DKFSRGKSGLCAAHGSLLQDPKSSKVGVGIGPGLFCDLVLGDNESSSTLSSTHFASEVAV  542

Query  609   TEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPP--------------SIPVT  472
                  +  M V R ++          +        ++GS                +  + 
Sbjct  543   DTCEGSSEMVVRRPLIPP-----QVLVPLSMKASSLVGSEKEREEGSGGSSCNLRTRALV  597

Query  471   IPEGRVH  451
             IPEGRVH
Sbjct  598   IPEGRVH  604


 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ E C K A G SGLCI HGGG+RCQ P CTKGA+  T++CKAHGGG+RC   GCTK
Sbjct  211   KKCKFEGCAKGARGASGLCIGHGGGQRCQKPGCTKGAESRTVYCKAHGGGRRCQTLGCTK  270

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C GHGGG+RC   GG  C K+  G +  C+ HGGGKRC    CT+SA G+  
Sbjct  271   SAEGRTDYCIGHGGGRRCSHPGG--CTKAARGKSGLCIRHGGGKRCQFEGCTRSAEGQAG  328

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST  CKAHGGG+RC +             C   A G T
Sbjct  329   LCISHGGGRRCQMPGCTKGAQGSTMHCKAHGGGRRCIFAG-----------CTRGAEGST  377

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG +  V 
Sbjct  378   PLCKGHGGGRRCAFEGGGVCPKSVHGGTSFCVA  410



>ref|XP_006351810.1| PREDICTED: uncharacterized protein LOC102590322 [Solanum tuberosum]
Length=639

 Score =   310 bits (794),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 204/312 (65%), Gaps = 46/312 (15%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQ+P C+KGAQGST+FCKAHGGGKR
Sbjct  327   LCIKHGGGKRCNVEGCTRSAEGKVGLCISHGGGRRCQFPSCSKGAQGSTLFCKAHGGGKR  386

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  387   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  446

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE C KSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  447   KSARGRTDCCVRHGGGKRCKFENCEKSAQGSTDFCKAHGGGKRCSW---------GEGKC  497

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRT--ENMKEIDTTEDM  598
               FARG+ GLCA+H +L+  +  + G  +G      +V   +P ++  EN +       +
Sbjct  498   EKFARGRGGLCAAHSSLLHGRNTNKGGMIGPGLFHGLVPAASPVKSTFENNRSSSMVSMV  557

Query  597   DADSMTVERSVVTSANGSDWKYISFKQATMPI------------------LG-----SPP  487
                  ++ +        ++W+ +   Q  +P+                  LG     +  
Sbjct  558   SDSVHSLNKP-------AEWQLLIPPQVLVPLSMKASLTCSEKLDDRSTNLGIGRSNTNN  610

Query  486   SIPVTIPEGRVH  451
             +    +PEGRVH
Sbjct  611   NFEFVVPEGRVH  622


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KG++  T +CKAHGGGKRC + GCTK
Sbjct  234   KRCKFPGCCKGARGATGLCIGHGGGQRCQKPGCNKGSESRTAYCKAHGGGKRCEHLGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C ++  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  294   SAEGKTDYCIAHGGGRRCSFPEG--CTRAARGKSGLCIKHGGGKRCNVEGCTRSAEGKVG  351

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  352   LCISHGGGRRCQFPSCSKGAQGSTLFCKAHGGGKRCIFAG-----------CTKGAEGST  400

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  401   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  433



>ref|XP_009586701.1| PREDICTED: uncharacterized protein LOC104084522 isoform X1 [Nicotiana 
tomentosiformis]
Length=642

 Score =   310 bits (795),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 178/231 (77%), Gaps = 14/231 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKR
Sbjct  324   LCIKHGGGKRCSVEGCTRSAEGKVGLCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRTENMKE  619
               FARG+ GLCA+H +L+  +  + G  +G      +V   +P +T   K 
Sbjct  495   EKFARGRGGLCAAHSSLLHGRNANKGGMIGPGLFHGLVPAASPVKTTFEKN  545


 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  231   KRCKFPGCPKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCDHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F GG  C ++  G +  C+ HGGGKRC+V  CT+SA G+  
Sbjct  291   SAEGKTDYCIAHGGGRRCSFTGG--CTRAARGRSGLCIKHGGGKRCSVEGCTRSAEGKVG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  349   LCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKRCIFAG-----------CTKGAEGST  397

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  398   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  430



>dbj|BAJ94860.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   310 bits (793),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 172/298 (58%), Positives = 200/298 (67%), Gaps = 32/298 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  330   CIKHGGGKRCAMEGCIRSAEGKAGLCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRC  389

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC++GAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT +CVAHGGGKRCA   CTK
Sbjct  390   VFDGCSRGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVAHGGGKRCAAPGCTK  449

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  450   SARGRTDCCVKHGGGKRCRIDNCGKSAQGSTDFCKAHGGGKRCTWGS----------GCE  499

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARGK+GLCA+HG LV  ++ HG    G  +  I P     +    TT    A SMT E
Sbjct  500   KFARGKSGLCAAHGTLVARQQEHGMVKSGGSM--IGPGLFSGIVASSTTA---ASSMTNE  554

Query  573   RSVVTSANGSDWKYISFKQATMP-----------ILGSPPSIP------VTIPEGRVH  451
              S    +  SD       Q+ +P              S P++         +PEGRVH
Sbjct  555   HSSSGISTASDSDGTVRSQSMIPPQLLVPRSMMPSSSSEPTVRGGKEAGCAVPEGRVH  612


 Score =   182 bits (461),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 129/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K   G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  237   KKCRFKGCSKGGRGSSGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC +     CPK+  G +  C+ HGGGKRCA+  C +SA G+  
Sbjct  297   SAEGKTDYCIAHGGGRRCEYPD---CPKAARGKSGRCIKHGGGKRCAMEGCIRSAEGKAG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C+  A G T
Sbjct  354   LCISHGGGRRCQYPDCAKGAQGSTLYCKAHGGGKRCVFDG-----------CSRGAEGST  402

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  V  K VHGG    V 
Sbjct  403   PLCKAHGGGKRCMFEGGGVCPKSVHGGTEFCVA  435



>gb|KHG22844.1| putative WRKY transcription factor 19 -like protein [Gossypium 
arboreum]
Length=645

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 202/319 (63%), Gaps = 53/319 (17%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ+P CTKGAQGSTMFCKAHGGGKR
Sbjct  324   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQFPACTKGAQGSTMFCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTD CKAHGGGKRC WG         E  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDLCKAHGGGKRCSWG---------EGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENM--KEIDTTEDMDADSM  583
               FARG++GLCA+H +++Q+++   G         I P     +      T    + +  
Sbjct  495   EKFARGRSGLCAAHSSMLQERQASKGGL-------IAPGVFHGLVSASSTTGSSSNNNHS  547

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPP----------------------------  487
             +   SV++    S  K +  +Q   P +  PP                            
Sbjct  548   SSGNSVISDCIDSPDKPVKRQQLIPPQVLVPPSMKSSASYSSFLSSEQQDEGINRHGNHN  607

Query  486   -------SIPVTIPEGRVH  451
                    S    IPEGRVH
Sbjct  608   AGGVGNTSFDFLIPEGRVH  626


 Score =   239 bits (610),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 140/285 (49%), Positives = 162/285 (57%), Gaps = 85/285 (30%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI HGGG+RCQK  C K AE  +  C +HGGGRRCQ+  CTK A+G T FC AHGGG+R
Sbjct  248   LCIGHGGGQRCQKAGCNKGAESRTVFCKAHGGGRRCQHLGCTKSAEGKTDFCIAHGGGRR  307

Query  1116  CIYEG---------------------------------------------------CTKG  1090
             C + G                                                   CTKG
Sbjct  308   CGFSGGCTKAARGKSGLCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGRRCQFPACTKG  367

Query  1089  AEGSTPFCK-------------------------GHGGGKRCLFQGGGVCPKSVHGGTLY  985
             A+GST FCK                         GHGGGKRCL+ GGG+CPKSVHGGT +
Sbjct  368   AQGSTMFCKAHGGGKRCIFAGCTKGAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNF  427

Query  984   CVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
             CVAHGGGKRC V  CTKSARGRTD CVRHGGGKRC+FE CGKSAQGSTD CKAHGGGKRC
Sbjct  428   CVAHGGGKRCVVPGCTKSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDLCKAHGGGKRC  487

Query  804   YWGQPSSEFGKGEIPCNSFARGKTGLCASHGALVQDKRVHGGATL  670
              W         GE  C  FARG++GLCA+H +++Q+++   G  +
Sbjct  488   SW---------GEGKCEKFARGRSGLCAAHSSMLQERQASKGGLI  523


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 128/218 (59%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G +GLCI HGGG+RCQ   C KGA+  T+FCKAHGGG+RC +
Sbjct  226   RTSNSKKCKFAGCFKGARGATGLCIGHGGGQRCQKAGCNKGAESRTVFCKAHGGGRRCQH  285

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V  CT+SA
Sbjct  286   LGCTKSAEGKTDFCIAHGGGRRCGFSGG--CTKAARGKSGLCIRHGGGKRCKVEGCTRSA  343

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   
Sbjct  344   EGQAGLCISHGGGRRCQFPACTKGAQGSTMFCKAHGGGKRCIFAG-----------CTKG  392

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  +  K VHGG    V 
Sbjct  393   AEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVA  430



>ref|XP_011004973.1| PREDICTED: uncharacterized protein LOC105111348 [Populus euphratica]
 ref|XP_011004974.1| PREDICTED: uncharacterized protein LOC105111348 [Populus euphratica]
Length=642

 Score =   310 bits (793),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 172/314 (55%), Positives = 208/314 (66%), Gaps = 36/314 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E+CT+SAEG +GLCISHGGGRRC++  CTKGAQGST +CKAHGGGKR
Sbjct  324   LCIRHGGGKRCKVEDCTRSAEGQAGLCISHGGGRRCEHQGCTKGAQGSTGYCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ E CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVRHGGGKRCKVENCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKR------VHGGATLGVVVQEITPKRTENMKE--------  619
               FARGK+GLCA+H ++ Q+++      +  G   G+V    T   T +           
Sbjct  495   EKFARGKSGLCAAHSSMAQERQANRTGLIRPGLFHGLVSAASTAGCTIDSNHSYSGVSAV  554

Query  618   IDTTEDMDADS----MTVERSVVTSANGSDWKYISFKQATM---------PILGSPPSIP  478
              D ++ ++  +    +   + +V  +  +   + SF  A              G   +  
Sbjct  555   SDCSDSLEKPAKRLHLIPPQVLVPHSMKATSSFTSFMIADKLEEGTNGYGATSGGKKNFD  614

Query  477   VTIPEGRVHGGSLL  436
               +PEGRVHGG L+
Sbjct  615   YLVPEGRVHGGGLM  628


 Score =   187 bits (475),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 122/187 (65%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C+KGA+  T +CK HGGG+RC + GCTK
Sbjct  231   KKCKFLGCSKGARGASGLCIGHGGGQRCQKPGCSKGAESRTAYCKVHGGGRRCQHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC F GG  C K+  G +  C+ HGGGKRC V DCT+SA G+  
Sbjct  291   SAEGKTDLCIAHGGGRRCGFPGG--CTKAARGKSGLCIRHGGGKRCKVEDCTRSAEGQAG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC+ +GC K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  349   LCISHGGGRRCEHQGCTKGAQGSTGYCKAHGGGKRCIFAG-----------CTKGAEGST  397

Query  732   GLCASHG  712
              LC  HG
Sbjct  398   PLCKGHG  404



>ref|XP_010687470.1| PREDICTED: uncharacterized protein LOC104901577 [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score =   309 bits (792),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 173/300 (58%), Positives = 198/300 (66%), Gaps = 27/300 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CTKSAEG +GLCISHGGGRRCQ+P C KGAQGSTMFCKAHGGGKR
Sbjct  318   LCIRHGGGKRCKVEGCTKSAEGRAGLCISHGGGRRCQFPDCAKGAQGSTMFCKAHGGGKR  377

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  378   CIFAGCTKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  437

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+   CGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  438   KSARGRTDCCVKHGGGKRCKVVNCGKSAQGSTDFCKAHGGGKRCCWGD-----GK----C  488

Query  756   NSFARGKTGLCASHGALVQDKRVHGG-----------ATLGVVVQEITPKRTEN-MKEID  613
               FARG++GLCA+H ++VQ++    G           +T   V   +  K + + M  I 
Sbjct  489   EKFARGRSGLCAAHSSMVQERENRRGMIGPGLFHGLVSTTSTVASSLENKNSSSGMSVIS  548

Query  612   TTED------MDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVH  451
                D           +  +  V  S   +    +        +     S    IPEGRVH
Sbjct  549   DCGDSLGRPAKRQHLIPPQVLVPLSMKSASSHSVQTTHGEQNVDSGRGSFGFLIPEGRVH  608


 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  225   KKCRFMGCIKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAFCKAHGGGKRCQHLGCTK  284

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC + GG  C K+  G +  C+ HGGGKRC V  CTKSA GR  
Sbjct  285   SAEGKTDYCIAHGGGRRCGYSGG--CSKAARGKSGLCIRHGGGKRCKVEGCTKSAEGRAG  342

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  343   LCISHGGGRRCQFPDCAKGAQGSTMFCKAHGGGKRCIFAG-----------CTKGAEGST  391

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  +  K VHGG    V 
Sbjct  392   PLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVA  424



>ref|XP_006652895.1| PREDICTED: filaggrin-2-like [Oryza brachyantha]
Length=636

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 202/310 (65%), Gaps = 36/310 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC  + CT+SAEG  GLCISHGGGRRCQYP C+KGAQGSTMFCK+HGGGKR
Sbjct  326   FCIKHGGGKRCSVQGCTRSAEGQFGLCISHGGGRRCQYPNCSKGAQGSTMFCKSHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEG+T  CKGHGGGKRCLF+GGG CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  386   CIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGACPKSVHGGTSFCVAHGGGKRCSVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  446   KSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  495

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDAD-SMT  580
               FARG++GLCA+HG L+  K+V        ++++    R   M     T     D +++
Sbjct  496   ERFARGRSGLCAAHGTLMASKQVSESEHSRAMIRDSLFSR---MVSTSATAGSSMDHAIS  552

Query  579   VERSVVTSANGS------DWKYISFKQATMPILGSPPS----------------IPVTIP  466
               R   +S  G       + K +   Q  +P    P S                    +P
Sbjct  553   CSRPGASSGCGELLEDMRNGKLLIPHQVLVPGAMKPSSSRGNGQEDGWSQKQQCFGFVVP  612

Query  465   EGRVHGGSLL  436
             EGRVHGG L+
Sbjct  613   EGRVHGGGLM  622


 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 130/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCISHGGG+RCQ P C KGA+  T +CK+HGGGKRC   GCTK
Sbjct  234   KKCRFNGCSKGARGASGLCISHGGGQRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G + +C+ HGGGKRC+V  CT+SA G+  
Sbjct  294   SAEGKTEFCIAHGGGRRC---GNPGCTKAARGRSGFCIKHGGGKRCSVQGCTRSAEGQFG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST FCK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYPNCSKGAQGSTMFCKSHGGGKRCIF-----------EGCTKGAEGNT  399

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  V 
Sbjct  400   LLCKGHGGGKRCLFEGGGACPKSVHGGTSFCVA  432



>ref|XP_009798583.1| PREDICTED: uncharacterized protein LOC104244787 isoform X1 [Nicotiana 
sylvestris]
Length=642

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 176/226 (78%), Gaps = 14/226 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKR
Sbjct  324   LCIKHGGGKRCNVEGCTRSAEGKVGLCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKR  383

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  384   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  443

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  444   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  494

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRT  634
               FARG+ GLCA+H +L+  +  + G  +       +V   +P +T
Sbjct  495   EKFARGRGGLCAAHSSLLHGRNANKGGMIAPGLFHGLVPAASPVKT  540


 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  231   KRCKFPGCPKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCEHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F GG  C ++  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  291   SAEGKTDYCIAHGGGRRCSFTGG--CTRAARGRSGLCIKHGGGKRCNVEGCTRSAEGKVG  348

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  349   LCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKRCIFAG-----------CTKGAEGST  397

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  398   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  430



>ref|XP_009798584.1| PREDICTED: uncharacterized protein LOC104244787 isoform X2 [Nicotiana 
sylvestris]
Length=634

 Score =   309 bits (791),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 176/226 (78%), Gaps = 14/226 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKR
Sbjct  316   LCIKHGGGKRCNVEGCTRSAEGKVGLCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  376   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  436   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCSW---------GEGKC  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRT  634
               FARG+ GLCA+H +L+  +  + G  +       +V   +P +T
Sbjct  487   EKFARGRGGLCAAHSSLLHGRNANKGGMIAPGLFHGLVPAASPVKT  532


 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGGKRC + GCTK
Sbjct  223   KRCKFPGCPKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGKRCEHLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F GG  C ++  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  283   SAEGKTDYCIAHGGGRRCSFTGG--CTRAARGRSGLCIKHGGGKRCNVEGCTRSAEGKVG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQYPSCAKGAQGSTLYCKAHGGGKRCIFAG-----------CTKGAEGST  389

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  390   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  422



>gb|KJB31994.1| hypothetical protein B456_005G217900 [Gossypium raimondii]
Length=642

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 177/216 (82%), Gaps = 12/216 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT+SAEG +GLCISHGGG RCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  322   LCIRHGGGKRCKVEGCTRSAEGQAGLCISHGGGHRCQFQGCTKGAQGSTMFCKAHGGGKR  381

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  382   CIFAGCTKGAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  441

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ E CGKSAQGSTDFCKAHGGGKRC W          E  C
Sbjct  442   KSARGRTDCCVKHGGGKRCKVENCGKSAQGSTDFCKAHGGGKRCSW---------RESKC  492

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI  649
               FARG++GLCA+H  +VQ+++ + G   G++  E+
Sbjct  493   EKFARGRSGLCAAHSNMVQERQANMG---GLIAPEV  525


 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 122/192 (64%), Gaps = 13/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C+K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC +
Sbjct  224   RASNSKKCRFVGCSKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQH  283

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCT+ A+G T FC  HGGG+RC F  G  C K+  G T  C+ HGGGKRC V  CT+SA
Sbjct  284   LGCTRSADGKTDFCIAHGGGRRCGFPRG--CTKAARGKTGLCIRHGGGKRCKVEGCTRSA  341

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG RCQF+GC K AQGST FCKAHGGGKRC +             C   
Sbjct  342   EGQAGLCISHGGGHRCQFQGCTKGAQGSTMFCKAHGGGKRCIFA-----------GCTKG  390

Query  747   ARGKTGLCASHG  712
             A G T LC  HG
Sbjct  391   AEGSTPLCKGHG  402



>emb|CAH68133.1| B0414F07.3 [Oryza sativa Indica Group]
Length=637

 Score =   308 bits (789),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 204/315 (65%), Gaps = 45/315 (14%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC+ E C++SAEG  GLCISHGGGRRCQYP C+KGAQG TMFCK+HGGGKR
Sbjct  326   FCIKHGGGKRCRVEGCSRSAEGQFGLCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEG+T  CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  386   CIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVAHGGGKRCSVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  446   KSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  495

Query  756   NSFARGKTGLCASHGALVQDKRV------------------------HGGATLGVVVQEI  649
               FARG++GLCA+HG L+  K+V                          GA++   +   
Sbjct  496   ERFARGRSGLCAAHGTLMASKQVPESEHSRGMIRNSLFSKMVSASSMTAGASMDHAISSS  555

Query  648   TP----KRTENMKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSI  481
              P     R E+++E+   + +    + V  S+  S++    +     Q            
Sbjct  556   LPGASSDRGESLEEMRNAKLLIPHQVLVPGSMRPSSSHGKGQEDGGSQEQQ-------CF  608

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  609   GFVVPEGRVHGGGLM  623


 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 127/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G +GLCISHGGG+RCQ P C KGA+  T  CK+HGGGKRC   GCTK
Sbjct  234   KKCRFNGCSKGARGATGLCISHGGGQRCQKPGCNKGAESRTANCKSHGGGKRCQELGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G + +C+ HGGGKRC V  C++SA G+  
Sbjct  294   SAEGKTEFCIAHGGGRRCGTLG---CTKAARGRSGFCIKHGGGKRCRVEGCSRSAEGQFG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKRCIFEG-----------CTKGAEGNT  399

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  V 
Sbjct  400   LLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVA  432



>ref|XP_004230554.1| PREDICTED: uncharacterized protein LOC101246968 [Solanum lycopersicum]
Length=639

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 171/210 (81%), Gaps = 9/210 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQ+P C+KGAQGST+FCKAHGGGKR
Sbjct  327   LCIKHGGGKRCNVEGCTRSAEGKVGLCISHGGGRRCQFPSCSKGAQGSTLFCKAHGGGKR  386

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  387   CIFAGCTKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  446

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE C KSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  447   KSARGRTDCCVRHGGGKRCKFENCEKSAQGSTDFCKAHGGGKRCSW---------GEGKC  497

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
               FARG+ GLCA+H +L+  +  + G  +G
Sbjct  498   EKFARGRGGLCAAHSSLLHGRNTNKGGMIG  527


 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             KRC+   C K A G +GLCI HGGG+RCQ P C KG++  T +CKAHGGGKRC + GCTK
Sbjct  234   KRCKFPGCCKGARGATGLCIGHGGGQRCQKPGCNKGSESRTAYCKAHGGGKRCEHLGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C ++  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  294   SAEGKTDYCIAHGGGRRCGFPQG--CTRAARGKSGLCIKHGGGKRCNVEGCTRSAEGKVG  351

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  352   LCISHGGGRRCQFPSCSKGAQGSTLFCKAHGGGKRCIFAG-----------CTKGAEGST  400

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG    V 
Sbjct  401   PLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  433



>ref|NP_001057751.2| Os06g0523100 [Oryza sativa Japonica Group]
 dbj|BAD45822.1| loricrin-like [Oryza sativa Japonica Group]
 dbj|BAD61685.1| loricrin-like [Oryza sativa Japonica Group]
 dbj|BAF19665.2| Os06g0523100 [Oryza sativa Japonica Group]
Length=463

 Score =   303 bits (775),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 198/286 (69%), Gaps = 24/286 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQK NCTKSAEG SG CI+HGGGRRC++  CTKGAQGST FCKAHGGGKR
Sbjct  174   LCIKHGGGKRCQKLNCTKSAEGQSGFCIAHGGGRRCKHDGCTKGAQGSTNFCKAHGGGKR  233

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +  C+KGAEGST  CK HGGGKRC  +G   CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  234   CTHPNCSKGAEGSTALCKAHGGGKRCSAEG---CPKSVHGGTEFCVAHGGGKRCVVPGCT  290

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRCQF GC KSAQGSTDFCKAHGGGKRC WGQ  S  G G   C
Sbjct  291   KSARGRTDCCVRHGGGKRCQFTGCSKSAQGSTDFCKAHGGGKRCLWGQSGSGLGDGSGTC  350

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARGK GLC +H ALV+D RV GG T+G +    +           T  D D    T+
Sbjct  351   ERFARGKKGLCVAHNALVEDSRVRGGQTVGTIALPGS-----------TGADSDVSHGTL  399

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSL  439
               +   S N  +    + KQA   +  SP      +PEGRVHGG++
Sbjct  400   PGN---SFNFGETFAANTKQALHHVQ-SP------VPEGRVHGGNI  435


 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 132/210 (63%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C +  C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  82    KICSQPGCAKGARGSSGRCIAHGGGRRCQREGCKKGAEGKTIFCKAHGGGRRCEHLGCTK  141

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  142   SAEGRTDFCIAHGGGRRCSRDG---CRKAARGKSGLCIKHGGGKRCQKLNCTKSAEGQSG  198

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RC+ +GC K AQGST+FCKAHGGGKRC    P+         C+  A G T
Sbjct  199   FCIAHGGGRRCKHDGCTKGAQGSTNFCKAHGGGKRCT--HPN---------CSKGAEGST  247

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
              LC +HG   +       K VHGG    V 
Sbjct  248   ALCKAHGGGKRCSAEGCPKSVHGGTEFCVA  277



>ref|NP_001054040.2| Os04g0640900 [Oryza sativa Japonica Group]
 emb|CAE02973.2| OSJNBb0079B02.5 [Oryza sativa Japonica Group]
 dbj|BAF15954.2| Os04g0640900 [Oryza sativa Japonica Group]
Length=637

 Score =   308 bits (788),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 204/315 (65%), Gaps = 45/315 (14%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC+ E C++SAEG  GLCISHGGGRRCQYP C+KGAQG TMFCK+HGGGKR
Sbjct  326   FCIKHGGGKRCRVEGCSRSAEGQFGLCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEG+T  CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  386   CIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVAHGGGKRCSVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  446   KSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  495

Query  756   NSFARGKTGLCASHGALVQDKRV------------------------HGGATLGVVVQEI  649
               FARG++GLCA+HG L+  K+V                          GA++   +   
Sbjct  496   ERFARGRSGLCAAHGTLMASKQVPESEHSRGMIRNSLFSKMVSASSMTAGASMDHAISSS  555

Query  648   TP----KRTENMKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSI  481
              P     R E+++E+   + +    + V  S+  S++    +     Q            
Sbjct  556   LPGASSDRGESLEEMRNAKLLIPHQVLVPGSMRPSSSHGKGQEDGGSQEQQ-------CF  608

Query  480   PVTIPEGRVHGGSLL  436
                +PEGRVHGG L+
Sbjct  609   GFVVPEGRVHGGGLM  623


 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G +GLCISHGGG+RCQ P C KGA+  T +CK+HGGGKRC   GCTK
Sbjct  234   KKCRFNGCSKGARGATGLCISHGGGQRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G + +C+ HGGGKRC V  C++SA G+  
Sbjct  294   SAEGKTEFCIAHGGGRRCGTPG---CTKAARGRSGFCIKHGGGKRCRVEGCSRSAEGQFG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKRCIFEG-----------CTKGAEGNT  399

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  V 
Sbjct  400   LLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVA  432



>ref|XP_009150537.1| PREDICTED: filaggrin-2 [Brassica rapa]
Length=598

 Score =   306 bits (784),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 202/317 (64%), Gaps = 41/317 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ P CTKGAQGST +CKAHGGGKR
Sbjct  281   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSPGCTKGAQGSTNYCKAHGGGKR  340

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  341   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  400

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  401   KSARGRTDCCVKHGGGKRCKSIGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  452

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV------------------------VQEI  649
               FARGK+GLCA+H ++ Q+K   GG+ +G++                         Q  
Sbjct  453   EKFARGKSGLCAAHNSMAQEK---GGSKIGLIGPGLFRGLVSTSSQTTATTTTTDHSQSG  509

Query  648   TPKRTENMKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPS-----  484
                 ++    ID +     +        +        K +SF +A  P   +  +     
Sbjct  510   VSAVSDCTDSIDRSLHHQPEKRQKVMIPMQVLVPPSMKSLSFTEAERPETETNNNSSGRN  569

Query  483   -IPVTIPEGRVHGGSLL  436
                  IPE RVHGG L+
Sbjct  570   IFDFMIPEERVHGGGLM  586


 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   CTK A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  188   KKCKFMGCTKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQHLGCTK  247

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  248   SAEGKTDYCISHGGGRRCGFPEG--CGKAARGKSGLCIKHGGGKRCRIEGCTRSAEGQAG  305

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  306   LCISHGGGRRCQSPGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKGAEGST  354

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  355   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  387



>gb|EAY95752.1| hypothetical protein OsI_17619 [Oryza sativa Indica Group]
Length=637

 Score =   307 bits (787),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 201/309 (65%), Gaps = 33/309 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC+ E C++SAEG  GLCISHGGGRRCQYP C+KGAQG TMFCK+HGGGKR
Sbjct  326   FCIKHGGGKRCRVEGCSRSAEGQFGLCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEG+T  CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  386   CIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVAHGGGKRCSVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  446   KSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  495

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARG++GLCA+HG L+  K+V        +++     +  +   +     MD  +++ 
Sbjct  496   ERFARGRSGLCAAHGTLMASKQVPESEHSRGMIRNSLFSKMVSASSMTAGASMD-HAISS  554

Query  576   ERSVVTSANGSDW------KYISFKQATMPILGSPPS----------------IPVTIPE  463
                  +S  G         K +   Q  +P    P S                    +PE
Sbjct  555   SLPGASSDRGESLEEMRNGKLLIPHQVLVPGSMRPSSSHGKGQEDGGSQEQQCFGFVVPE  614

Query  462   GRVHGGSLL  436
             GRVHGG L+
Sbjct  615   GRVHGGGLM  623


 Score =   179 bits (454),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G +GLCISHGGG+RCQ P C KGA+  T +CK+HGGGKRC   GCTK
Sbjct  234   KKCRFNGCSKGARGATGLCISHGGGQRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G + +C+ HGGGKRC V  C++SA G+  
Sbjct  294   SAEGKTEFCIAHGGGRRCGTLG---CTKAARGRSGFCIKHGGGKRCRVEGCSRSAEGQFG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKRCIFEG-----------CTKGAEGNT  399

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  V 
Sbjct  400   LLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVA  432



>gb|EAZ32159.1| hypothetical protein OsJ_16356 [Oryza sativa Japonica Group]
Length=637

 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 201/309 (65%), Gaps = 33/309 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI+HGGGKRC+ E C++SAEG  GLCISHGGGRRCQYP C+KGAQG TMFCK+HGGGKR
Sbjct  326   FCIKHGGGKRCRVEGCSRSAEGQFGLCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKR  385

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEG+T  CKGHGGGKRCLF+GGGVCPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  386   CIFEGCTKGAEGNTLLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVAHGGGKRCSVPGCT  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  446   KSARGRTDCCVRHGGGKRCKVDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  495

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARG++GLCA+HG L+  K+V        +++     +  +   +     MD  +++ 
Sbjct  496   ERFARGRSGLCAAHGTLMASKQVPESEHSRGMIRNSLFSKMVSASSMTAGASMD-HAISS  554

Query  576   ERSVVTSANGSDW------KYISFKQATMPILGSPPS----------------IPVTIPE  463
                  +S  G         K +   Q  +P    P S                    +PE
Sbjct  555   SLPGASSDRGESLEEMRNGKLLIPHQVLVPGSMRPSSSHGKGQEDGGSQEQQCFGFVVPE  614

Query  462   GRVHGGSLL  436
             GRVHGG L+
Sbjct  615   GRVHGGGLM  623


 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G +GLCISHGGG+RCQ P C KGA+  T +CK+HGGGKRC   GCTK
Sbjct  234   KKCRFNGCSKGARGATGLCISHGGGQRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G + +C+ HGGGKRC V  C++SA G+  
Sbjct  294   SAEGKTEFCIAHGGGRRCGTPG---CTKAARGRSGFCIKHGGGKRCRVEGCSRSAEGQFG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQYPNCSKGAQGGTMFCKSHGGGKRCIFEG-----------CTKGAEGNT  399

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  V 
Sbjct  400   LLCKGHGGGKRCLFEGGGVCPKSVHGGTSFCVA  432



>gb|EPS69501.1| hypothetical protein M569_05264, partial [Genlisea aurea]
Length=515

 Score =   303 bits (777),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 166/194 (86%), Gaps = 11/194 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+KE CTKSAEGLS LCISHGGGRRCQ+P CTKGAQGST FCKAHGGGKR
Sbjct  311   LCIRHGGGKRCRKEKCTKSAEGLSCLCISHGGGRRCQHPDCTKGAQGSTKFCKAHGGGKR  370

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GC KGAEGST  CKGHGGGKRC FQGGG+CPKSVHGGTL+CVAHGGGKRC+  +CT
Sbjct  371   CTFPGCRKGAEGSTSLCKGHGGGKRCSFQGGGICPKSVHGGTLFCVAHGGGKRCSFPECT  430

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRT+ CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC             +PC
Sbjct  431   KSARGRTEHCVRHGGGKRCRFENCGKSAQGSTDFCKAHGGGKRCDV-----------VPC  479

Query  756   NSFARGKTGLCASH  715
              SFARGK+GLCASH
Sbjct  480   RSFARGKSGLCASH  493


 Score =   182 bits (461),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 127/218 (58%), Gaps = 23/218 (11%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R  G K CQ   CTK A G SGLCI+HGGGRRCQ   C KGA+G T FCKAHGGG+RC +
Sbjct  214   RANGTKPCQFSGCTKGARGASGLCIAHGGGRRCQRIGCHKGAEGRTAFCKAHGGGRRCEF  273

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC GHGGG+RC  +G   C  +  G +  C+ HGGGKRC    CTKSA
Sbjct  274   LGCTKSAEGRTDFCIGHGGGRRCSHEG---CSCASRGKSGLCIRHGGGKRCRKEKCTKSA  330

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ   C K AQGST FCKAHGGGKRC +             C   
Sbjct  331   EGLSCLCISHGGGRRCQHPDCTKGAQGSTKFCKAHGGGKRCTF-----------PGCRKG  379

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC  H         G  +  K VHGG    V 
Sbjct  380   AEGSTSLCKGHGGGKRCSFQGGGICPKSVHGGTLFCVA  417



>ref|XP_002513710.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48657.1| conserved hypothetical protein [Ricinus communis]
Length=646

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 204/318 (64%), Gaps = 41/318 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ + C++SAEG +GLCISHGGGRRCQY  CTKGAQGSTM CKAHGGGKR
Sbjct  325   LCIKHGGGKRCKVDGCSRSAEGQAGLCISHGGGRRCQYEGCTKGAQGSTMHCKAHGGGKR  384

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  385   CIFAGCTKGAEGSTPLCKGHGGGKRCLYDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  444

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC W         GE  C
Sbjct  445   KSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCTW---------GEGKC  495

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-VVQEITPKRTENMKEIDTTEDMDADSMT  580
               FARG++GLCA+H ++V ++  + G+ +G  + Q +    +     ID        S  
Sbjct  496   EKFARGRSGLCAAHSSMVLEQGSNKGSLIGPGLFQGLVSAASNAGSSIDNNYSSSGIS-A  554

Query  579   VERSVVTSANGSDWKYISFKQATMP-----------ILGSP-------------------  490
             V     +    +  +++   Q  +P            L +                    
Sbjct  555   VSDCTDSLGKPTKRQHLIPAQVLVPPSMKSSSSYSSFLNAEKQEEGRNEYSAGAGSTSRV  614

Query  489   PSIPVTIPEGRVHGGSLL  436
              S     PEGRVHGG L+
Sbjct  615   TSFDYMAPEGRVHGGGLM  632


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 96/224 (43%), Gaps = 28/224 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              C+ HGGGKRC    CTKSA G +  C+ HGGG+RC++  C K AQGST FCKAHGGGKR
Sbjct  428   FCVAHGGGKRCVVPGCTKSARGRTDCCVKHGGGKRCKFENCGKSAQGSTDFCKAHGGGKR  487

Query  1116  CIY-EG-CTKGAEGSTPFCKGH-------GGGKRCLFQGG---GVCPKSVHGGTLYCVAH  973
             C + EG C K A G +  C  H       G  K  L   G   G+   + + G+     +
Sbjct  488   CTWGEGKCEKFARGRSGLCAAHSSMVLEQGSNKGSLIGPGLFQGLVSAASNAGSSIDNNY  547

Query  972   GGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQ  793
                   AV+DCT S    T         KR         AQ               +   
Sbjct  548   SSSGISAVSDCTDSLGKPT---------KRQHL----IPAQVLVPPSMKSSSSYSSFLNA  594

Query  792   PSSEFGKGEIPCNSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
                E G+ E    S   G T    S   +  + RVHGG  + + 
Sbjct  595   EKQEEGRNEY---SAGAGSTSRVTSFDYMAPEGRVHGGGLMSLF  635



>emb|CDO97480.1| unnamed protein product [Coffea canephora]
Length=645

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 182/242 (75%), Gaps = 10/242 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E C +SAEG  GLCISHGGGRRCQ+  C KGAQGST  CKAHGGGKR
Sbjct  316   LCIRHGGGKRCKVEGCKRSAEGQIGLCISHGGGRRCQFQGCNKGAQGSTSLCKAHGGGKR  375

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCT+GAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC+V  CT
Sbjct  376   CIFAGCTRGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCSVPGCT  435

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE CGKSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  436   KSARGRTDCCVRHGGGKRCKFENCGKSAQGSTDFCKAHGGGKRCNWGG-----GK----C  486

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKE-IDTTEDMDADSMT  580
               FARGK+GLCA+H +LVQ +    G+ +G  +       T  M+  +D T      SM 
Sbjct  487   EKFARGKSGLCAAHSSLVQGQEASKGSMIGPGLFHGLVSATSGMRSTVDRTYSSCGGSMI  546

Query  579   VE  574
              E
Sbjct  547   SE  548


 Score =   187 bits (476),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             +RC+ + C K A G +GLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  223   RRCKFDGCMKGARGATGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLGCTK  282

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC + GG  C K+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  283   SAEGKTDFCIAHGGGRRCGYPGG--CAKAARGKSGLCIRHGGGKRCKVEGCKRSAEGQIG  340

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF+GC K AQGST  CKAHGGGKRC +             C   A G T
Sbjct  341   LCISHGGGRRCQFQGCNKGAQGSTSLCKAHGGGKRCIFAG-----------CTRGAEGST  389

Query  732   GLCASHG  712
              LC  HG
Sbjct  390   PLCKGHG  396



>gb|AFW71977.1| hypothetical protein ZEAMMB73_865146 [Zea mays]
 gb|AFW71978.1| hypothetical protein ZEAMMB73_865146 [Zea mays]
 gb|AFW71979.1| hypothetical protein ZEAMMB73_865146 [Zea mays]
Length=629

 Score =   305 bits (781),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 202/299 (68%), Gaps = 34/299 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQ+P C +GAQGST++CK+HGGGKRC
Sbjct  329   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQFPDCRRGAQGSTLYCKSHGGGKRC  388

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             ++EGC KGAEGSTP CK HGGGKRC+++GGGVCPKSVHGGT +CVAHGGGKRCAV  C+K
Sbjct  389   VFEGCGKGAEGSTPLCKAHGGGKRCVYEGGGVCPKSVHGGTDFCVAHGGGKRCAVPGCSK  448

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ +GCGKSAQGSTD CKAHGGGKRC        FG G+  C 
Sbjct  449   SARGRTDRCVKHGGGKRCRVDGCGKSAQGSTDCCKAHGGGKRC-------NFGDGQ--CE  499

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+H  LV  ++  GG  +G       P     +    +  +M++D  +  
Sbjct  500   KFARGRSGLCAAHDTLVASQQRRGGGMIG-------PGLFHGIVRSASVANMNSDYSSSG  552

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIP------------------VTIPEGRVH  451
              S V+  +GS       ++   P +  P S+                   VT+PEGRVH
Sbjct  553   VSTVSDCDGSPEAATRRQELIPPQVLVPRSMKSLTAATVQPPKRSREGRVVTVPEGRVH  611


 Score =   181 bits (459),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G +GLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  236   KKCRFKGCSKGARGATGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCLQLGCTK  295

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC +     CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  296   SAEGKTDHCIAHGGGQRCGYPD---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  352

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C + AQGST +CK+HGGGKRC +             C   A G T
Sbjct  353   LCISHGGGRRCQFPDCRRGAQGSTLYCKSHGGGKRCVFEG-----------CGKGAEGST  401

Query  732   GLCASHG  712
              LC +HG
Sbjct  402   PLCKAHG  408



>ref|XP_010520484.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520492.1| PREDICTED: uncharacterized protein LOC104799580 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010520500.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520509.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520518.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520526.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520535.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520544.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520548.1| PREDICTED: uncharacterized protein LOC104799580 isoform X1 [Tarenaya 
hassleriana]
Length=617

 Score =   304 bits (779),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 171/201 (85%), Gaps = 8/201 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ+P+CTKGAQGST FCKAHGGGKR
Sbjct  306   LCIKHGGGKRCKIEGCTRSAEGHAGLCISHGGGRRCQFPECTKGAQGSTNFCKAHGGGKR  365

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GC KGAEGSTP CK HGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC +  CT
Sbjct  366   CIFVGCDKGAEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVIPGCT  425

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC W         G++ C
Sbjct  426   KSARGRTDCCVKHGGGKRCRSEGCGKSAQGSTDFCKAHGGGKRCSW--------WGDVKC  477

Query  756   NSFARGKTGLCASHGALVQDK  694
               FARGK+GLCA+H ++ ++K
Sbjct  478   EKFARGKSGLCAAHTSMSREK  498


 Score =   196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 132/218 (61%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   CTK A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGG+RC +
Sbjct  208   RASNSKKCRFFGCTKGARGASGLCIGHGGGQRCQRPGCNKGAESKTTFCKAHGGGRRCQH  267

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F GG  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  268   LGCTKSAEGKTDFCIAHGGGRRCRFPGG--CSKAARGKSGLCIKHGGGKRCKIEGCTRSA  325

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G    C+ HGGG+RCQF  C K AQGST+FCKAHGGGKRC +           + C+  
Sbjct  326   EGHAGLCISHGGGRRCQFPECTKGAQGSTNFCKAHGGGKRCIF-----------VGCDKG  374

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC +H         G  +  K VHGG    V 
Sbjct  375   AEGSTPLCKAHGGGKRCLFDGGGICPKSVHGGTNFCVA  412



>ref|XP_010461962.1| PREDICTED: uncharacterized protein LOC104742642 [Camelina sativa]
Length=642

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 175/212 (83%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  309   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  368

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC VT CT
Sbjct  369   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVTGCT  428

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  429   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  480

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  481   EKFARGKSGLCAAHNSMSQDK---AGSKIGLI  509


 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 129/213 (61%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  216   KKCKFMGCVKGARGASGLCIGHGGGQRCQKPGCNKGAESKTTFCKAHGGGKRCQHLGCTK  275

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  276   SAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIEGCTRSAEGQAG  333

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  334   LCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKGAEGST  382

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  383   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  415



>emb|CAH67071.1| OSIGBa0097P08.1 [Oryza sativa Indica Group]
Length=631

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 196/303 (65%), Gaps = 43/303 (14%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C+KGAQGST++CK HGGGKRC
Sbjct  330   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRC  389

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  390   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVAGCTK  449

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  450   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWG----------TGCE  499

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  500   KFARGRSGLCAAHGTLAAKQQERDAANNGAGM--IPPGLFNGIVTVAATS-----SMTNE  552

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPV----------------------TIPEG  460
              S    +  SD       QA M     PP + V                       +PEG
Sbjct  553   YSSSGISTASDCDGTVRSQAMM----IPPQVLVPRSMMPSSSSEPTVHGGREGGCAVPEG  608

Query  459   RVH  451
             RVH
Sbjct  609   RVH  611


 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  237   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  297   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C+  A G T
Sbjct  354   LCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  402

Query  732   GLCASHG  712
              LC +HG
Sbjct  403   PLCKAHG  409



>gb|EAZ01162.1| hypothetical protein OsI_23190 [Oryza sativa Indica Group]
 gb|EAZ37181.1| hypothetical protein OsJ_21522 [Oryza sativa Japonica Group]
Length=628

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/286 (62%), Positives = 198/286 (69%), Gaps = 24/286 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQK NCTKSAEG SG CI+HGGGRRC++  CTKGAQGST FCKAHGGGKR
Sbjct  339   LCIKHGGGKRCQKLNCTKSAEGQSGFCIAHGGGRRCKHDGCTKGAQGSTNFCKAHGGGKR  398

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +  C+KGAEGST  CK HGGGKRC  +G   CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  399   CTHPNCSKGAEGSTALCKAHGGGKRCSAEG---CPKSVHGGTEFCVAHGGGKRCVVPGCT  455

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRCQF GC KSAQGSTDFCKAHGGGKRC WGQ  S  G G   C
Sbjct  456   KSARGRTDCCVRHGGGKRCQFTGCSKSAQGSTDFCKAHGGGKRCLWGQSGSGLGDGSGTC  515

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARGK GLC +H ALV+D RV GG T+G +    +           T  D D    T+
Sbjct  516   ERFARGKKGLCVAHNALVEDSRVRGGQTVGTIALPGS-----------TGADSDVSHGTL  564

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSL  439
               +   S N  +    + KQA   +  SP      +PEGRVHGG++
Sbjct  565   PGN---SFNFGETFAANTKQALHHVQ-SP------VPEGRVHGGNI  600


 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 132/210 (63%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C +  C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  247   KICSQPGCAKGARGSSGRCIAHGGGRRCQREGCKKGAEGKTIFCKAHGGGRRCEHLGCTK  306

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC   +CTKSA G++ 
Sbjct  307   SAEGRTDFCIAHGGGRRCSRDG---CRKAARGKSGLCIKHGGGKRCQKLNCTKSAEGQSG  363

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RC+ +GC K AQGST+FCKAHGGGKRC    P+         C+  A G T
Sbjct  364   FCIAHGGGRRCKHDGCTKGAQGSTNFCKAHGGGKRCT--HPN---------CSKGAEGST  412

Query  732   GLCASHG------ALVQDKRVHGGATLGVV  661
              LC +HG      A    K VHGG    V 
Sbjct  413   ALCKAHGGGKRCSAEGCPKSVHGGTEFCVA  442



>ref|XP_010484239.1| PREDICTED: uncharacterized protein LOC104762612 [Camelina sativa]
Length=640

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 176/212 (83%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E+CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  309   LCIKHGGGKRCRIESCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  368

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC VT CT
Sbjct  369   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVTGCT  428

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  429   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  480

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  481   EKFARGKSGLCAAHNSMSQDK---AGSKIGLI  509


 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 130/218 (60%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC +
Sbjct  211   RMSNPKKCKFMGCVKGARGASGLCIGHGGGQRCQKPGCNKGAESKTTFCKAHGGGKRCQH  270

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  271   LGCTKSAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIESCTRSA  328

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   
Sbjct  329   EGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKG  377

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC +H         G  +  K VHGG +  V 
Sbjct  378   AEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  415



>ref|NP_001052976.2| Os04g0458200 [Oryza sativa Japonica Group]
 dbj|BAG95046.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77394.1| hypothetical protein OsI_16151 [Oryza sativa Indica Group]
 dbj|BAF14890.2| Os04g0458200 [Oryza sativa Japonica Group]
Length=631

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 196/303 (65%), Gaps = 43/303 (14%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C+KGAQGST++CK HGGGKRC
Sbjct  330   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRC  389

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  390   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVAGCTK  449

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  450   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWG----------TGCE  499

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  500   KFARGRSGLCAAHGTLAAKQQERDAANNGAGM--IPPGLFSGIVTVAATS-----SMTNE  552

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPV----------------------TIPEG  460
              S    +  SD       QA M     PP + V                       +PEG
Sbjct  553   YSSSGISTASDCDGTVRSQAMM----IPPQVLVPRSMMPSSSSEPTVHGGREGGCAVPEG  608

Query  459   RVH  451
             RVH
Sbjct  609   RVH  611


 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  237   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  297   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C+  A G T
Sbjct  354   LCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  402

Query  732   GLCASHG  712
              LC +HG
Sbjct  403   PLCKAHG  409



>ref|XP_010444391.1| PREDICTED: uncharacterized protein LOC104727084 [Camelina sativa]
Length=638

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 175/212 (83%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  309   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  368

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC VT CT
Sbjct  369   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVTGCT  428

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  429   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  480

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  481   EKFARGKSGLCAAHNSMSQDK---AGSKIGLI  509


 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 130/218 (60%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC +
Sbjct  211   RMSNPKKCKFMGCVKGARGASGLCIGHGGGQRCQKPGCNKGAESKTTFCKAHGGGKRCQH  270

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  271   LGCTKSAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIEGCTRSA  328

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   
Sbjct  329   EGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKG  377

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC +H         G  +  K VHGG +  V 
Sbjct  378   AEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  415



>ref|NP_201260.1| loricrin-related protein [Arabidopsis thaliana]
 dbj|BAB11422.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13994.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13211.1| unknown protein [Arabidopsis thaliana]
 gb|AED97918.1| loricrin-related protein [Arabidopsis thaliana]
Length=634

 Score =   303 bits (776),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 175/212 (83%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E+CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  307   LCIKHGGGKRCRIESCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  366

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  367   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  426

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  427   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  478

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  479   EKFARGKSGLCAAHNSMSQDK---AGSKVGLI  507


 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 128/218 (59%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC +
Sbjct  209   RMSNPKKCKFMGCVKGARGASGLCIGHGGGQRCQKLGCNKGAESKTTFCKAHGGGKRCQH  268

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  269   LGCTKSAEGKTDLCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIESCTRSA  326

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   
Sbjct  327   EGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKG  375

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC +H         G  +  K VHGG +  V 
Sbjct  376   AEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  413



>gb|EEE61116.1| hypothetical protein OsJ_15040 [Oryza sativa Japonica Group]
Length=717

 Score =   305 bits (781),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 196/303 (65%), Gaps = 43/303 (14%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C+KGAQGST++CK HGGGKRC
Sbjct  416   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRC  475

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  476   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVAGCTK  535

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  536   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWG----------TGCE  585

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  586   KFARGRSGLCAAHGTLAAKQQERDAANNGAGM--IPPGLFSGIVTVAATS-----SMTNE  638

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPV----------------------TIPEG  460
              S    +  SD       QA M     PP + V                       +PEG
Sbjct  639   YSSSGISTASDCDGTVRSQAMM----IPPQVLVPRSMMPSSSSEPTVHGGREGGCAVPEG  694

Query  459   RVH  451
             RVH
Sbjct  695   RVH  697


 Score =   185 bits (470),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  323   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  382

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  383   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  439

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C+  A G T
Sbjct  440   LCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  488

Query  732   GLCASHG  712
              LC +HG
Sbjct  489   PLCKAHG  495



>gb|EPS58190.1| hypothetical protein M569_16626, partial [Genlisea aurea]
Length=367

 Score =   295 bits (754),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 175/209 (84%), Gaps = 9/209 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ + C++SAEG  GLCISHGGGRRCQ+  C KGAQGST+FCKAHGGGKR
Sbjct  159   LCIRHGGGKRCKMDGCSRSAEGQVGLCISHGGGRRCQFSGCNKGAQGSTVFCKAHGGGKR  218

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C ++GC+KGAEGSTP CKGHGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V+ CT
Sbjct  219   CTFDGCSKGAEGSTPLCKGHGGGKRCMFDGGGICPKSVHGGTNFCVAHGGGKRCVVSGCT  278

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC  EGCGKSAQGST++CKAHGGGKRC W     E G+    C
Sbjct  279   KSARGRTDCCVKHGGGKRCTIEGCGKSAQGSTEYCKAHGGGKRCRW-----ERGE----C  329

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL  670
             + FARGK+GLCA+H +L+Q  +  GGA +
Sbjct  330   DKFARGKSGLCAAHMSLLQPNKGGGGAMI  358


 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 127/205 (62%), Gaps = 6/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   CTK A G +GLCI HGGG+RCQ P C KGA+  T  CKAHGGG+RC + GCTK
Sbjct  66    KKCKFAGCTKGARGATGLCIGHGGGQRCQKPGCKKGAESRTALCKAHGGGRRCDHLGCTK  125

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC    G  C K+  G +  C+ HGGGKRC +  C++SA G+  
Sbjct  126   SAEGKTDHCIAHGGGRRCGHPEG--CSKAARGKSGLCIRHGGGKRCKMDGCSRSAEGQVG  183

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +    S+  +G  P C     GK
Sbjct  184   LCISHGGGRRCQFSGCNKGAQGSTVFCKAHGGGKRCTF-DGCSKGAEGSTPLCKGHGGGK  242

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  +  K VHGG    V 
Sbjct  243   R--CMFDGGGICPKSVHGGTNFCVA  265



>emb|CAE03375.1| OSJNBa0036B21.17 [Oryza sativa Japonica Group]
Length=723

 Score =   305 bits (780),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 196/303 (65%), Gaps = 43/303 (14%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C+KGAQGST++CK HGGGKRC
Sbjct  422   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRC  481

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  482   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVAGCTK  541

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  542   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWG----------TGCE  591

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  592   KFARGRSGLCAAHGTLAAKQQERDAANNGAGM--IPPGLFSGIVTVAATS-----SMTNE  644

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPV----------------------TIPEG  460
              S    +  SD       QA M     PP + V                       +PEG
Sbjct  645   YSSSGISTASDCDGTVRSQAMM----IPPQVLVPRSMMPSSSSEPTVHGGREGGCAVPEG  700

Query  459   RVH  451
             RVH
Sbjct  701   RVH  703


 Score =   185 bits (470),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  329   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  388

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  389   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  445

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C+  A G T
Sbjct  446   LCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  494

Query  732   GLCASHG  712
              LC +HG
Sbjct  495   PLCKAHG  501



>emb|CBW45773.1| ORW1943Ba0077G13.1 [Oryza rufipogon]
Length=723

 Score =   305 bits (780),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 196/303 (65%), Gaps = 43/303 (14%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C+KGAQGST++CK HGGGKRC
Sbjct  422   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRC  481

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  482   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVAGCTK  541

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  542   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWG----------TGCE  591

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  592   KFARGRSGLCAAHGTLAAKQQERDTANNGAGM--IPPGLFSGIVTVAATS-----SMTNE  644

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPV----------------------TIPEG  460
              S    +  SD       QA M     PP + V                       +PEG
Sbjct  645   YSSSGISTASDCDGTVRSQAMM----IPPQVLVPRSMMPSSSSEPTVHGGREGGCAVPEG  700

Query  459   RVH  451
             RVH
Sbjct  701   RVH  703


 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  329   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  388

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  389   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  445

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C+  A G T
Sbjct  446   LCISHGGGRRCQFPDCSKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  494

Query  732   GLCASHG  712
              LC +HG
Sbjct  495   PLCKAHG  501



>ref|XP_009130459.1| PREDICTED: uncharacterized protein LOC103855246 [Brassica rapa]
Length=565

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 201/305 (66%), Gaps = 30/305 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ  +CTKGAQGST +CKAHGGGKR
Sbjct  258   LCIKHGGGKRCRVEGCTRSAEGQAGLCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKR  317

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  318   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  377

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG      G G   C
Sbjct  378   KSARGRTDCCVKHGGGKRCKCVGCEKSAQGSTDFCKAHGGGKRCSWG------GGG---C  428

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV----VQEITPKRTENMKEIDTTEDMDAD  589
               FARGK+GLCA+H ++  +K   GG+ +G++     + +    +       +T D    
Sbjct  429   EKFARGKSGLCAAHNSMCMEK---GGSKIGLIGPGLFRGLVVSTSSQTTTTTSTTDHSLA  485

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPP--------------SIPVTIPEGRVH  451
              ++V      S+     + I  +    P + S                     +PE RVH
Sbjct  486   GVSVVSDCTDSSEQRQKQMIPMQVLVPPSMKSLSFSNTETNNNRSGRNVFDFMVPEERVH  545

Query  450   GGSLL  436
             GG L+
Sbjct  546   GGGLM  550


 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  165   KKCKFMGCSKGARGASGLCIGHGGGQRCQKSGCNKGAESKTTFCKAHGGGKRCQHLGCTK  224

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  225   SAEGKTDYCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRVEGCTRSAEGQAG  282

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  283   LCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKRCIF-----------AGCTKGAEGST  331

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  332   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  364



>emb|CDY46810.1| BnaC02g43180D [Brassica napus]
Length=558

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 198/305 (65%), Gaps = 30/305 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ  +CTKGAQGST +CKAHGGGKR
Sbjct  254   LCIKHGGGKRCRVEGCTRSAEGQAGLCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKR  313

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  314   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  373

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG  +         C
Sbjct  374   KSARGRTDCCVKHGGGKRCKCVGCEKSAQGSTDFCKAHGGGKRCSWGGGT---------C  424

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV----VQEITPKRTENMKEIDTTEDMDAD  589
               FARGK+GLCA+H ++  DK   GG+ +G++     + +    +       +T D    
Sbjct  425   QKFARGKSGLCAAHNSMCMDK---GGSKIGLIGPGLFRGLVVSTSSQTTTTTSTTDHSLA  481

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPP--------------SIPVTIPEGRVH  451
              ++       S      + I  +    P + S                     +PE RVH
Sbjct  482   GVSAVSDCTDSIEQRQKQMIPMQVLVPPSMKSLSFSNTETNNNRSGRNVFDFMVPEERVH  541

Query  450   GGSLL  436
             GG L+
Sbjct  542   GGGLM  546


 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  161   KKCKFMGCSKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQHLGCTK  220

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  221   SAEGKTDYCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRVEGCTRSAEGQAG  278

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  279   LCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKRCIF-----------AGCTKGAEGST  327

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  328   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  360



>ref|XP_006280171.1| hypothetical protein CARUB_v10026073mg [Capsella rubella]
 gb|EOA13069.1| hypothetical protein CARUB_v10026073mg [Capsella rubella]
Length=599

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 174/212 (82%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  271   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSSSCTKGAQGSTNYCKAHGGGKR  330

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  331   CIFSGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  390

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  391   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  442

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ Q+K    G+ +G++
Sbjct  443   EKFARGKSGLCAAHNSMSQEK---AGSKIGLI  471


 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  178   KKCKFMGCVKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQHLGCTK  237

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  238   SAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIEGCTRSAEGQAG  295

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  296   LCISHGGGRRCQSSSCTKGAQGSTNYCKAHGGGKRCIFSG-----------CTKGAEGST  344

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  345   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  377



>ref|XP_008668458.1| PREDICTED: uncharacterized protein LOC100383912 isoform X1 [Zea 
mays]
 ref|XP_008668459.1| PREDICTED: uncharacterized protein LOC100383912 isoform X1 [Zea 
mays]
 tpg|DAA37481.1| TPA: hypothetical protein ZEAMMB73_960855 [Zea mays]
 tpg|DAA37482.1| TPA: hypothetical protein ZEAMMB73_960855 [Zea mays]
 tpg|DAA37483.1| TPA: hypothetical protein ZEAMMB73_960855 [Zea mays]
Length=625

 Score =   301 bits (770),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/297 (57%), Positives = 196/297 (66%), Gaps = 31/297 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CK HGGGKRC
Sbjct  322   CIKHGGGKRCLVKGCIRSAEGKAGLCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRC  381

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC+KGAEGSTP CK HGGGKRC+F+GGGVC KSVHG T YCVAHGGGKRC+V  CTK
Sbjct  382   VFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCAKSVHGATEYCVAHGGGKRCSVPGCTK  441

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ E CGKSAQGSTDFCKAHGGGKRC WG            C 
Sbjct  442   SARGRTDCCVKHGGGKRCKVENCGKSAQGSTDFCKAHGGGKRCTWG----------TGCE  491

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              F+RGK+G CA+HG L+  +R    A    V   I P        I  +    A SMT E
Sbjct  492   KFSRGKSGFCAAHGTLMARQREQEAAK--NVGSMIGPGL---FSGIVVSSATAASSMTNE  546

Query  573   RSVVTSANGSDWKYISFKQATMP--------ILGSPPSIPV--------TIPEGRVH  451
              S    +  SD       Q+ +P        ++ S  + PV         +PEGRVH
Sbjct  547   HSSSGVSTASDCDGTVRSQSMIPPQVLVPRSMMPSWSTEPVDGGREGGHVVPEGRVH  603


 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ S+ +CKAHGGG+RC   GCTK
Sbjct  229   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSSAYCKAHGGGRRCEELGCTK  288

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  289   SAEGKTDYCIAHGGGRRCEHPG---CPKAARGKSGRCIKHGGGKRCLVKGCIRSAEGKAG  345

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  CGK AQGST +CK HGGGKRC +             C+  A G T
Sbjct  346   LCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRCVFDG-----------CSKGAEGST  394

Query  732   GLCASHG  712
              LC +HG
Sbjct  395   PLCKAHG  401



>ref|XP_006280172.1| hypothetical protein CARUB_v10026073mg [Capsella rubella]
 gb|EOA13070.1| hypothetical protein CARUB_v10026073mg [Capsella rubella]
Length=635

 Score =   301 bits (771),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 174/212 (82%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  307   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSSSCTKGAQGSTNYCKAHGGGKR  366

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  367   CIFSGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  426

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  427   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  478

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ Q+K    G+ +G++
Sbjct  479   EKFARGKSGLCAAHNSMSQEK---AGSKIGLI  507


 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 128/218 (59%), Gaps = 22/218 (10%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC +
Sbjct  209   RMSNPKKCKFMGCVKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQH  268

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  269   LGCTKSAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIEGCTRSA  326

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ   C K AQGST++CKAHGGGKRC +             C   
Sbjct  327   EGQAGLCISHGGGRRCQSSSCTKGAQGSTNYCKAHGGGKRCIFSG-----------CTKG  375

Query  747   ARGKTGLCASH---------GALVQDKRVHGGATLGVV  661
             A G T LC +H         G  +  K VHGG +  V 
Sbjct  376   AEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  413



>gb|KDO56524.1| hypothetical protein CISIN_1g006721mg [Citrus sinensis]
 gb|KDO56525.1| hypothetical protein CISIN_1g006721mg [Citrus sinensis]
 gb|KDO56526.1| hypothetical protein CISIN_1g006721mg [Citrus sinensis]
 gb|KDO56527.1| hypothetical protein CISIN_1g006721mg [Citrus sinensis]
 gb|KDO56528.1| hypothetical protein CISIN_1g006721mg [Citrus sinensis]
Length=633

 Score =   300 bits (769),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 209/310 (67%), Gaps = 32/310 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG  GLCISHGGGRRC+Y  C KGAQGSTMFCKAHGGGKR
Sbjct  319   LCIKHGGGKRCKMEGCTRSAEGQVGLCISHGGGRRCRYGGCNKGAQGSTMFCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE C KSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  439   KSARGRTDCCVRHGGGKRCKFENCAKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRTENMKEIDTTEDMDA  592
               FARGK+GLCA+H +LVQ+++   G  +G      +V  ++   + +     +T  + A
Sbjct  490   EKFARGKSGLCAAHSSLVQEQQTSKGGLIGPGLFHGLVSTVSTAASCSFDNTYSTSGVSA  549

Query  591   DSMTVERSVV------------------TSANGSDWKYISFKQATMPILGSPPSIPVTIP  466
              S  +E   +                   S+       IS KQ     + S  ++ + +P
Sbjct  550   VSDCIESLEMPVKQQQLLPPLLLVPLSMKSSTSYSSFLISEKQKEQRKVFSGQNLDLVVP  609

Query  465   EGRVHGGSLL  436
             EGRVHGG  +
Sbjct  610   EGRVHGGGFM  619


 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 120/217 (55%), Gaps = 35/217 (16%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGG+RC  
Sbjct  221   RAGNTKRCEFPGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQQ  280

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  281   LGCTKSAEGKTDLCIAHGGGRRCQFPEG--CAKAARGKSGLCIKHGGGKRCKMEGCTRSA  338

Query  927   RGR-------------------------TDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAH  823
              G+                         T FC  HGGGKRC F GC K A+GST  CK H
Sbjct  339   EGQVGLCISHGGGRRCRYGGCNKGAQGSTMFCKAHGGGKRCIFAGCTKGAEGSTPLCKGH  398

Query  822   GGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GGGKRC        F  G I C     G T  C +HG
Sbjct  399   GGGKRCL-------FDGGGI-CPKSVHGGTNFCVAHG  427



>ref|XP_006394140.1| hypothetical protein EUTSA_v10003819mg [Eutrema salsugineum]
 ref|XP_006394141.1| hypothetical protein EUTSA_v10003819mg [Eutrema salsugineum]
 gb|ESQ31426.1| hypothetical protein EUTSA_v10003819mg [Eutrema salsugineum]
 gb|ESQ31427.1| hypothetical protein EUTSA_v10003819mg [Eutrema salsugineum]
Length=628

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 173/212 (82%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  301   LCIKHGGGKRCRIEGCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  360

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  361   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVEGCT  420

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  421   KSARGRTDCCVKHGGGKRCKSLGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  472

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  473   EKFARGKSGLCAAHNSMSQDK---AGSKIGLI  501


 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  208   KKCKFMGCAKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQHLGCTK  267

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  268   SAEGKTDFCISHGGGRRCGFPEG--CTKAARGKSGLCIKHGGGKRCRIEGCTRSAEGQAG  325

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  326   LCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKGAEGST  374

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  375   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  407



>ref|XP_008784519.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103703444 
[Phoenix dactylifera]
Length=658

 Score =   300 bits (769),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 197/303 (65%), Gaps = 28/303 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC  E C++SAEG +GLCISHGGGRRCQYP C KGAQGST FCKAHGGGKR
Sbjct  337   LCIRHGGGKRCTIEGCSRSAEGQAGLCISHGGGRRCQYPGCGKGAQGSTKFCKAHGGGKR  396

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+EGCTKGAEGSTP CKGHGGGKRCLF+GGG+CPKSVHGGT +CVAHGGGKRCAV  CT
Sbjct  397   CIFEGCTKGAEGSTPLCKGHGGGKRCLFEGGGICPKSVHGGTNFCVAHGGGKRCAVPGCT  456

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC FEGCGKSAQGSTD CKAHGGGKR                 
Sbjct  457   KSARGRTDCCVRHGGGKRCMFEGCGKSAQGSTDLCKAHGGGKRXXXXXXXXXXXXX----  512

Query  756   NSFARGKTGLCASHGA--LVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSM  583
               FARG++ LCA+HG+  L+Q +R  G      + Q I         +ID   +  +  M
Sbjct  513   XKFARGRSSLCAAHGSLMLLQQERESGSMIGRGLFQGIVSTSAAVKSDID---EHSSSGM  569

Query  582   TVERSVVTSANGSDWKYISFKQATMPILGSPPS-------------------IPVTIPEG  460
             +     + S      + +   Q  +P+  + PS                     + +PEG
Sbjct  570   SSISDCIESQESMGRRQLIPPQVLVPLSVNSPSPSSGLMDAGREGVGSHEKGFGLAVPEG  629

Query  459   RVH  451
             RVH
Sbjct  630   RVH  632


 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 129/213 (61%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC   GCTK
Sbjct  245   KKCRFTGCSKGARGASGLCIAHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLGCTK  304

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C K+  G +  C+ HGGGKRC +  C++SA G+  
Sbjct  305   SAEGKTDFCIAHGGGRRCGHPG---CTKAARGKSGLCIRHGGGKRCTIEGCSRSAEGQAG  361

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+ GCGK AQGST FCKAHGGGKRC +             C   A G T
Sbjct  362   LCISHGGGRRCQYPGCGKGAQGSTKFCKAHGGGKRCIFEG-----------CTKGAEGST  410

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG    V 
Sbjct  411   PLCKGHGGGKRCLFEGGGICPKSVHGGTNFCVA  443



>ref|XP_006652378.1| PREDICTED: uncharacterized protein LOC102712799 [Oryza brachyantha]
Length=633

 Score =   300 bits (767),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 167/299 (56%), Positives = 195/299 (65%), Gaps = 34/299 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQ+P C KGAQGST++CK HGGGKRC
Sbjct  331   CIKHGGGKRCTVQGCIRSAEGKAGLCISHGGGRRCQFPDCAKGAQGSTLYCKGHGGGKRC  390

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC KGAEGSTP CK HGGGKRC+F+GGGVCPKSVHGGT YCVAHGGGKRC+V  CTK
Sbjct  391   IFDGCRKGAEGSTPLCKAHGGGKRCMFEGGGVCPKSVHGGTEYCVAHGGGKRCSVVGCTK  450

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + C KSAQGSTDFCKAHGGGKRC WG    +F        
Sbjct  451   SARGRTDCCVKHGGGKRCKVDNCSKSAQGSTDFCKAHGGGKRCTWGTGCEKFS-------  503

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
                RG++GLCA+HG L   ++    A  G  +  I P     +  +  T      SMT E
Sbjct  504   --PRGRSGLCAAHGTLAAKQQECNAAKDGAGM--IPPGLFSGIVTVAATS-----SMTNE  554

Query  573   RSVVTSANGSDWKYISFKQATM---------PILGSPPSIPVT---------IPEGRVH  451
              S    +  SD       QA M          ++ SP S P           +PEGRVH
Sbjct  555   YSSSGISTASDCDGTVRSQAMMIPPQVLVPRSMMPSPSSEPTVQGGREGGCAVPEGRVH  613


 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 120/187 (64%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ ST +CKAHGGG+RC   GCTK
Sbjct  238   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSTAYCKAHGGGRRCEELGCTK  297

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  298   SAEGKTDYCIAHGGGRRCEHDG---CPKAARGKSGRCIKHGGGKRCTVQGCIRSAEGKAG  354

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK HGGGKRC +             C   A G T
Sbjct  355   LCISHGGGRRCQFPDCAKGAQGSTLYCKGHGGGKRCIFDG-----------CRKGAEGST  403

Query  732   GLCASHG  712
              LC +HG
Sbjct  404   PLCKAHG  410



>ref|NP_001169521.1| hypothetical protein [Zea mays]
 ref|XP_008644069.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34004.1| unknown [Zea mays]
 gb|ACR38629.1| unknown [Zea mays]
 gb|AFW71024.1| hypothetical protein ZEAMMB73_290397 [Zea mays]
Length=633

 Score =   300 bits (767),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 187/289 (65%), Gaps = 30/289 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRCQ  NCTKSAEG SG+CI+HGGGRRCQY  C KGAQGST FCKAHGGGKR
Sbjct  329   LCIKHGGGKRCQTLNCTKSAEGRSGMCIAHGGGRRCQYAGCGKGAQGSTNFCKAHGGGKR  388

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C +  C+KGAEGST FCK HGGGKRC   G   C KSVHGGT +CVAHGGGKRC V  C 
Sbjct  389   CTHPDCSKGAEGSTAFCKAHGGGKRCSADG---CTKSVHGGTQFCVAHGGGKRCVVEGCG  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV HGGGKRC   GCGKSAQGSTDFCK+HGGG+RC WG P S+ G G  PC
Sbjct  446   KSARGRTDRCVGHGGGKRCHSAGCGKSAQGSTDFCKSHGGGRRCSWGHPGSDLGSGGAPC  505

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
             +  ARGK GLC  H  LV D  VHGGA+ G                             V
Sbjct  506   DRLARGKKGLCDRHNPLVHDNSVHGGASFGGFS-------------------------VV  540

Query  576   ERSVVTSANGSDWK--YISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               + ++  +GS       S +   M  + +P  +  +  EGRVHGG+ +
Sbjct  541   SAAALSEGDGSPSPGTETSMRSFFMHAVEAPRCVAASAHEGRVHGGNFM  589


 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 131/215 (61%), Gaps = 20/215 (9%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R+G  K C +  C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGGKRC  
Sbjct  232   RNGSTKICSEPGCAKGARGSSGRCIAHGGGRRCQKEGCNKGAEGRTIFCKAHGGGKRCER  291

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  292   LGCTKSAEGRTDFCIAHGGGRRCSHDG---CKRAARGRSGLCIKHGGGKRCQTLNCTKSA  348

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              GR+  C+ HGGG+RCQ+ GCGK AQGST+FCKAHGGGKRC               C+  
Sbjct  349   EGRSGMCIAHGGGRRCQYAGCGKGAQGSTNFCKAHGGGKRCT-----------HPDCSKG  397

Query  747   ARGKTGLCASHGALVQ------DKRVHGGATLGVV  661
             A G T  C +HG   +       K VHGG    V 
Sbjct  398   AEGSTAFCKAHGGGKRCSADGCTKSVHGGTQFCVA  432



>ref|XP_002866619.1| hypothetical protein ARALYDRAFT_358659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42878.1| hypothetical protein ARALYDRAFT_358659 [Arabidopsis lyrata subsp. 
lyrata]
Length=1082

 Score =   308 bits (790),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 175/212 (83%), Gaps = 11/212 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E+CT+SAEG +GLCISHGGGRRCQ   CTKGAQGST +CKAHGGGKR
Sbjct  307   LCIKHGGGKRCRIESCTRSAEGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKR  366

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  367   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  426

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC WG        G+  C
Sbjct  427   KSARGRTDCCVKHGGGKRCKSDGCEKSAQGSTDFCKAHGGGKRCSWG--------GDWKC  478

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               FARGK+GLCA+H ++ QDK    G+ +G++
Sbjct  479   EKFARGKSGLCAAHNSMSQDK---AGSKVGLI  507


 Score =   186 bits (473),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 120/192 (63%), Gaps = 13/192 (7%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K+C+   C K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC +
Sbjct  209   RLSNPKKCKFMGCVKGARGASGLCIGHGGGQRCQKLGCNKGAESKTTFCKAHGGGKRCQH  268

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  269   LGCTKSAEGKTDLCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRIESCTRSA  326

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQ  GC K AQGST++CKAHGGGKRC +             C   
Sbjct  327   EGQAGLCISHGGGRRCQSSGCTKGAQGSTNYCKAHGGGKRCIFAG-----------CTKG  375

Query  747   ARGKTGLCASHG  712
             A G T LC +HG
Sbjct  376   AEGSTPLCKAHG  387



>gb|KHG10350.1| putative WRKY transcription factor 19 -like protein [Gossypium 
arboreum]
Length=641

 Score =   300 bits (767),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 173/216 (80%), Gaps = 12/216 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRC+ E CT SAEG +GLCISHGGGRRCQ+  CTKGAQGSTMF KAHGGGKR
Sbjct  322   LCIRHGGGKRCKVEGCTHSAEGQAGLCISHGGGRRCQFQGCTKGAQGSTMFYKAHGGGKR  381

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTK AEGSTP CKGHGGGKRCL+ GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  382   CIFAGCTKAAEGSTPLCKGHGGGKRCLYNGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  441

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARG TD CV+HGGGKRC+ E CGKSAQGSTDFCKAHGGGK+C W         GE  C
Sbjct  442   KSARGCTDCCVKHGGGKRCKVENCGKSAQGSTDFCKAHGGGKKCSW---------GESKC  492

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEI  649
               FARG+ GLCA+H  +VQ+++ + G   G++  E+
Sbjct  493   EKFARGRNGLCAAHSNMVQERQANMG---GLIAPEV  525


 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 120/187 (64%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ P C KGA+  T +CKAHGGG+RC + GCTK
Sbjct  229   KKCRFVGCSKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQHLGCTK  288

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              A+G T FC  HGGG+RC F  G  C K+  G T  C+ HGGGKRC V  CT SA G+  
Sbjct  289   SADGKTDFCIAHGGGRRCGFPRG--CKKAARGKTGLCIRHGGGKRCKVEGCTHSAEGQAG  346

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF+GC K AQGST F KAHGGGKRC +             C   A G T
Sbjct  347   LCISHGGGRRCQFQGCTKGAQGSTMFYKAHGGGKRCIFAG-----------CTKAAEGST  395

Query  732   GLCASHG  712
              LC  HG
Sbjct  396   PLCKGHG  402



>emb|CDY31315.1| BnaA02g34260D [Brassica napus]
Length=562

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 199/305 (65%), Gaps = 30/305 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG +GLCISHGGGRRCQ  +CTKGAQGST +CKAHGGGKR
Sbjct  258   LCIKHGGGKRCRVEGCTRSAEGQAGLCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKR  317

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  318   CIFAGCTKGAEGSTPLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVAHGGGKRCVVAGCT  377

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG      G G   C
Sbjct  378   KSARGRTDCCVKHGGGKRCKCVGCEKSAQGSTDFCKAHGGGKRCSWG------GGG---C  428

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVV----VQEITPKRTENMKEIDTTEDMDAD  589
               FARGK+GLCA+H ++  +K   GG+ +G++     + +    +       T+ D    
Sbjct  429   EKFARGKSGLCAAHNSMCMEK---GGSKIGLIGPGLFRGLVVSTSSQTTTTTTSTDHSLA  485

Query  588   SMTVERSVVTSANGSDWKYISFKQATMPILGSPP--------------SIPVTIPEGRVH  451
              ++       S      + I  +    P + S                     +PE RVH
Sbjct  486   GVSAVSDCTDSIEQRQKQMIPMQVLVPPSMKSLSFSNTETNNNRSGRNVFDFMVPEERVH  545

Query  450   GGSLL  436
             GG L+
Sbjct  546   GGGLM  550


 Score =   181 bits (460),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 128/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K A G SGLCI HGGG+RCQ   C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  165   KKCKFMGCSKGARGASGLCIGHGGGQRCQKAGCNKGAESKTTFCKAHGGGKRCQHLGCTK  224

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC V  CT+SA G+  
Sbjct  225   SAEGKTDYCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRVEGCTRSAEGQAG  282

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CKAHGGGKRC +             C   A G T
Sbjct  283   LCISHGGGRRCQASECTKGAQGSTNYCKAHGGGKRCIF-----------AGCTKGAEGST  331

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  332   PLCKAHGGGKRCMFDGGGICPKSVHGGTSFCVA  364



>ref|XP_006432464.1| hypothetical protein CICLE_v10000572mg [Citrus clementina]
 gb|ESR45704.1| hypothetical protein CICLE_v10000572mg [Citrus clementina]
Length=633

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 208/310 (67%), Gaps = 32/310 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E CT+SAEG  GLCISHGGGRRC+Y  C KGAQGSTMFCKAHGGGKR
Sbjct  319   LCIKHGGGKRCKMEGCTRSAEGQVGLCISHGGGRRCRYGGCNKGAQGSTMFCKAHGGGKR  378

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CKGHGGGKRCLF GGG+CPKSVHGGT +CVAHGGGKRC V  CT
Sbjct  379   CIFAGCTKGAEGSTPLCKGHGGGKRCLFDGGGICPKSVHGGTNFCVAHGGGKRCVVPGCT  438

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+FE C KSAQGSTDFCKAHGGGKRC WG      GK    C
Sbjct  439   KSARGRTDCCVRHGGGKRCKFENCAKSAQGSTDFCKAHGGGKRCSWGD-----GK----C  489

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGV-----VVQEITPKRTENMKEIDTTEDMDA  592
               FARGK+GLCA+H +LVQ+++   G  +G      +V  ++     +     +T  + A
Sbjct  490   EKFARGKSGLCAAHSSLVQEQQTSKGGLIGPGLFHGLVSTVSTAAGCSFDNTYSTSGVSA  549

Query  591   DSMTVERSVV------------------TSANGSDWKYISFKQATMPILGSPPSIPVTIP  466
              S  +E   +                   S+       IS KQ     + S  ++ + +P
Sbjct  550   VSDCIESLEMPVKQQQLLPPLLLVPLSMKSSTSYSSFVISEKQKEQRKVFSGQNLDLVVP  609

Query  465   EGRVHGGSLL  436
             EGRVHGG  +
Sbjct  610   EGRVHGGGFM  619


 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 120/217 (55%), Gaps = 35/217 (16%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  KRC+   CTK A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGG+RC  
Sbjct  221   RAGNTKRCEFPGCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAFCKAHGGGRRCQQ  280

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  281   LGCTKSAEGKTDLCIAHGGGRRCQFPEG--CAKAARGKSGLCIKHGGGKRCKMEGCTRSA  338

Query  927   RGR-------------------------TDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAH  823
              G+                         T FC  HGGGKRC F GC K A+GST  CK H
Sbjct  339   EGQVGLCISHGGGRRCRYGGCNKGAQGSTMFCKAHGGGKRCIFAGCTKGAEGSTPLCKGH  398

Query  822   GGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GGGKRC        F  G I C     G T  C +HG
Sbjct  399   GGGKRCL-------FDGGGI-CPKSVHGGTNFCVAHG  427



>ref|XP_006647130.1| PREDICTED: uncharacterized protein LOC102713982 [Oryza brachyantha]
Length=633

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 185/286 (65%), Gaps = 33/286 (12%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQ E C KSAEG SGLCI+HGGGRRCQ+  C KGAQGST FCKAHGGGKRC
Sbjct  336   CIKHGGGKRCQYEGCKKSAEGRSGLCIAHGGGRRCQHVDCGKGAQGSTNFCKAHGGGKRC  395

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  CTKGAEGSTPFCKGHGGGKRC   G   C KSVHGGTL CVAHGGGKRC V  CTK
Sbjct  396   THPDCTKGAEGSTPFCKGHGGGKRCSADG---CTKSVHGGTLCCVAHGGGKRCVVEGCTK  452

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRCQ  GC KSAQGST+FCKAHGGGKRC WG   S  G G+ PC 
Sbjct  453   SARGRTDRCVGHGGGKRCQSSGCDKSAQGSTNFCKAHGGGKRCLWGHEGSNHGAGDPPCE  512

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK GLC  H   + + RVHGG    VV  E+            +  D    + T  
Sbjct  513   RLARGKKGLCIYHNPQLDETRVHGG--FSVVSDEL------------SQGDRPLGTETTR  558

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              S+ + +                +   P  +    PEGRVHGG++L
Sbjct  559   HSIFSHS----------------VEAPPRRVAAPAPEGRVHGGNIL  588


 Score =   181 bits (459),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 121/204 (59%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC Y GCTK
Sbjct  243   KNCTYPGCMKGARGSSGHCIAHGGGRRCQKDGCGKGAEGKTIFCKAHGGGRRCDYLGCTK  302

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC   G   C ++  G +  C+ HGGGKRC    C KSA GR+ 
Sbjct  303   SAEGRTDFCIAHGGGRRCSHDG---CKRAARGKSGRCIKHGGGKRCQYEGCKKSAEGRSG  359

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   CGK AQGST+FCKAHGGGKRC               C   A G T
Sbjct  360   LCIAHGGGRRCQHVDCGKGAQGSTNFCKAHGGGKRCT-----------HPDCTKGAEGST  408

Query  732   GLCASHGALVQ------DKRVHGG  679
               C  HG   +       K VHGG
Sbjct  409   PFCKGHGGGKRCSADGCTKSVHGG  432


 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 125/208 (60%), Gaps = 17/208 (8%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK+ C K AEG +  C +HGGGRRC Y  CTK A+G T FC AHGGG+RC
Sbjct  261   CIAHGGGRRCQKDGCGKGAEGKTIFCKAHGGGRRCDYLGCTKSAEGRTDFCIAHGGGRRC  320

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              ++GC + A G +  C  HGGGKRC ++G   C KS  G +  C+AHGGG+RC   DC K
Sbjct  321   SHDGCKRAARGKSGRCIKHGGGKRCQYEG---CKKSAEGRSGLCIAHGGGRRCQHVDCGK  377

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI---  763
              A+G T+FC  HGGGKRC    C K A+GST FCK HGGGKRC     +     G +   
Sbjct  378   GAQGSTNFCKAHGGGKRCTHPDCTKGAEGSTPFCKGHGGGKRCSADGCTKSVHGGTLCCV  437

Query  762   -----------PCNSFARGKTGLCASHG  712
                         C   ARG+T  C  HG
Sbjct  438   AHGGGKRCVVEGCTKSARGRTDRCVGHG  465



>ref|XP_006399449.1| hypothetical protein EUTSA_v10013049mg [Eutrema salsugineum]
 gb|ESQ40902.1| hypothetical protein EUTSA_v10013049mg [Eutrema salsugineum]
Length=453

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 196/303 (65%), Gaps = 30/303 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG  GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  149   LCIKHGGGKRCNIESCTRSAEGQVGLCISHGGGKRCQFFSGCNKGAQGSTNYCKAHGGGK  208

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRCAV +C
Sbjct  209   RCIFSGCSKGAEGSTPLCKAHGGGKRCLSDGGGICSKSVHGGTNFCVAHGGGKRCAVAEC  268

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC  + C KSAQGSTDFCKAHGGGKRC W         G+  
Sbjct  269   TKSARGRTDCCVKHGGGKRCMIDECEKSAQGSTDFCKAHGGGKRCSW---------GDGK  319

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C  FARGK+G CA H +++  ++   G+  G+    I P     +  + +  D     ++
Sbjct  320   CEKFARGKSGFCAKHNSVMSREKEEDGSKSGL----IGPGLFRGL-AVGSASDQSQSGVS  374

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPS---------------IPVTIPEGRVHGG  445
                    S +G  ++    K+  +P+    PS                   IPE RVHGG
Sbjct  375   AVSECTDSVDGVRFEKRQKKEMMIPMQVLVPSSMKSPSNSHEGETNIFDFMIPEERVHGG  434

Query  444   SLL  436
              L+
Sbjct  435   GLV  437


 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCK HGGGKRC + GCTK
Sbjct  56    RKCKFMGCVKVARGASGLCICHGGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTK  115

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  116   SAEGKTDFCISHGGGRRCEFNEG--CDKAARGKSGLCIKHGGGKRCNIESCTRSAEGQVG  173

Query  912   FCVRHGGGKRCQ-FEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQ F GC K AQGST++CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  174   LCISHGGGKRCQFFSGCNKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  232

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C S G  +  K VHGG    V 
Sbjct  233   KR--CLSDGGGICSKSVHGGTNFCVA  256



>ref|XP_002446603.1| hypothetical protein SORBIDRAFT_06g018770 [Sorghum bicolor]
 gb|EES10931.1| hypothetical protein SORBIDRAFT_06g018770 [Sorghum bicolor]
Length=626

 Score =   297 bits (761),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 166/296 (56%), Positives = 193/296 (65%), Gaps = 30/296 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CK HGGGKRC
Sbjct  326   CIKHGGGKRCSVKGCIRSAEGKAGLCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRC  385

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVC KSVHG T YCVAHGGGKRC+V  CTK
Sbjct  386   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCAKSVHGATEYCVAHGGGKRCSVPGCTK  445

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGST+FCKAHGGGKRC W             C 
Sbjct  446   SARGRTDCCVKHGGGKRCKVDNCGKSAQGSTEFCKAHGGGKRCTW----------STGCE  495

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              F+RGK+G CA+HG L+  +R      +  V   I P        I  +    A SMT E
Sbjct  496   KFSRGKSGFCAAHGTLMARQREQ--EVVKNVGSMIGPGL---FSGIVVSSATAASSMTNE  550

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPP-------SIPV--------TIPEGRVH  451
              S    +  SD       Q+ +P     P       S PV         +PEGRVH
Sbjct  551   HSSSGVSTASDCDGTMRSQSMIPPQVLVPRSMMPWSSEPVDGGREGGHVVPEGRVH  606


 Score =   181 bits (459),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC    C KGA+ S+ +CKAHGGG+RC   GCTK
Sbjct  233   KKCRFKGCSKGARGASGLCIAHGGGQRCHKSGCHKGAESSSAYCKAHGGGRRCEELGCTK  292

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC   G   CPK+  G +  C+ HGGGKRC+V  C +SA G+  
Sbjct  293   SAEGKTDYCIAHGGGRRCEHPG---CPKAARGKSGRCIKHGGGKRCSVKGCIRSAEGKAG  349

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  CGK AQGST +CK HGGGKRC +             C+  A G T
Sbjct  350   LCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  398

Query  732   GLCASHG  712
              LC +HG
Sbjct  399   PLCKAHG  405



>ref|XP_002452331.1| hypothetical protein SORBIDRAFT_04g023820 [Sorghum bicolor]
 gb|EES05307.1| hypothetical protein SORBIDRAFT_04g023820 [Sorghum bicolor]
Length=641

 Score =   297 bits (761),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 163/299 (55%), Positives = 202/299 (68%), Gaps = 32/299 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQ+P C KGAQGST++CK+HGGGKRC
Sbjct  337   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQFPDCRKGAQGSTLYCKSHGGGKRC  396

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             ++EGC KGAEGSTP CK HGGGKRC+++GGGVCPKSVHGGT +CVAHGGGKRCAV  C+K
Sbjct  397   VFEGCGKGAEGSTPLCKAHGGGKRCMYEGGGVCPKSVHGGTDFCVAHGGGKRCAVPGCSK  456

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ +GCGKSAQGST++CKAHGGGKRC        FG G   C 
Sbjct  457   SARGRTDRCVKHGGGKRCRVDGCGKSAQGSTEYCKAHGGGKRC-------NFGGG---CE  506

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG LV  ++  GG    ++   +       +    +  +M++D  +  
Sbjct  507   KFARGRSGLCAAHGTLVASQQRRGGGGGSMIGPGL----FHGIVRSASAANMNSDYSSSG  562

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIP------------------VTIPEGRVH  451
              S V+  +GS       ++   P +  P S+                   V +PEGRVH
Sbjct  563   VSTVSDCDGSPVAATRRQELIPPQVLVPHSMKSLTAAAVQPSENSREGGVVAVPEGRVH  621


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  244   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCLQLGCTK  303

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC +     CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  304   SAEGKTDHCIAHGGGRRCGYPD---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  360

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK+HGGGKRC +             C   A G T
Sbjct  361   LCISHGGGRRCQFPDCRKGAQGSTLYCKSHGGGKRCVF-----------EGCGKGAEGST  409

Query  732   GLCASHG  712
              LC +HG
Sbjct  410   PLCKAHG  416


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKEN---CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGG  1126
             LC  HGGGKRC  E    C KS  G +  C++HGGG+RC  P C+K A+G T  C  HGG
Sbjct  411   LCKAHGGGKRCMYEGGGVCPKSVHGGTDFCVAHGGGKRCAVPGCSKSARGRTDRCVKHGG  470

Query  1125  GKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHG  970
             GKRC  +GC K A+GST +CK HGGGKRC F GG  C K   G +  C AHG
Sbjct  471   GKRCRVDGCGKSAQGSTEYCKAHGGGKRCNFGGG--CEKFARGRSGLCAAHG  520



>emb|CDY18707.1| BnaA09g06880D [Brassica napus]
Length=547

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/302 (55%), Positives = 199/302 (66%), Gaps = 32/302 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E C +SAEG +GLCISHGGGRRCQ   CTKGAQG T +CK HGGGKR
Sbjct  250   LCIKHGGGKRCRVEGCKRSAEGQAGLCISHGGGRRCQSLDCTKGAQGGTNYCKGHGGGKR  309

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+C KSVHGGT +CVAHGGGKRC V  CT
Sbjct  310   CIFGGCTKGAEGSTPLCKAHGGGKRCMFDGGGICSKSVHGGTSFCVAHGGGKRCVVVGCT  369

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQG T+ CKAHGGGKRC WG        G + C
Sbjct  370   KSARGRTDCCVKHGGGKRCKCLGCEKSAQGRTELCKAHGGGKRCSWG--------GGLVC  421

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARGK+GLCA+H ++ QDK    G+ +G+    I P     +  + TT D     ++ 
Sbjct  422   EKFARGKSGLCAAHNSMAQDK---AGSKIGL----IGPGLFSGL--VSTTTDYSLSGVSA  472

Query  576   ERSVVTSANGSDWKYISFKQATM-PI-LGSPPS-------------IPVTIPEGRVHGGS  442
                   S +    +++  +Q  M P+ +  PPS             +   I E RVHGG 
Sbjct  473   VSDCTDSIDRYPQQHLEKRQKVMIPMQVLVPPSMKSLSSNSNGRNMLDFMIHEDRVHGGG  532

Query  441   LL  436
             L+
Sbjct  533   LM  534


 Score =   180 bits (456),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 126/213 (59%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  157   KKCRFMGCGKGARGASGLCIGHGGGQRCQKPGCNKGAESKTTFCKAHGGGKRCQHLGCTK  216

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  217   SAEGKTDFCISHGGGRRCGFPEG--CAKAARGKSGLCIKHGGGKRCRVEGCKRSAEGQAG  274

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQG T++CK HGGGKRC +G            C   A G T
Sbjct  275   LCISHGGGRRCQSLDCTKGAQGGTNYCKGHGGGKRCIFG-----------GCTKGAEGST  323

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  324   PLCKAHGGGKRCMFDGGGICSKSVHGGTSFCVA  356



>ref|XP_006399450.1| hypothetical protein EUTSA_v10013049mg [Eutrema salsugineum]
 gb|ESQ40903.1| hypothetical protein EUTSA_v10013049mg [Eutrema salsugineum]
Length=590

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 197/303 (65%), Gaps = 30/303 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG  GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  286   LCIKHGGGKRCNIESCTRSAEGQVGLCISHGGGKRCQFFSGCNKGAQGSTNYCKAHGGGK  345

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRCAV +C
Sbjct  346   RCIFSGCSKGAEGSTPLCKAHGGGKRCLSDGGGICSKSVHGGTNFCVAHGGGKRCAVAEC  405

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC  + C KSAQGSTDFCKAHGGGKRC WG      GK    
Sbjct  406   TKSARGRTDCCVKHGGGKRCMIDECEKSAQGSTDFCKAHGGGKRCSWGD-----GK----  456

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMT  580
             C  FARGK+G CA H +++  ++   G+  G+    I P     +  + +  D     ++
Sbjct  457   CEKFARGKSGFCAKHNSVMSREKEEDGSKSGL----IGPGLFRGL-AVGSASDQSQSGVS  511

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPS---------------IPVTIPEGRVHGG  445
                    S +G  ++    K+  +P+    PS                   IPE RVHGG
Sbjct  512   AVSECTDSVDGVRFEKRQKKEMMIPMQVLVPSSMKSPSNSHEGETNIFDFMIPEERVHGG  571

Query  444   SLL  436
              L+
Sbjct  572   GLV  574


 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCK HGGGKRC + GCTK
Sbjct  193   RKCKFMGCVKVARGASGLCICHGGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTK  252

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  253   SAEGKTDFCISHGGGRRCEFNEG--CDKAARGKSGLCIKHGGGKRCNIESCTRSAEGQVG  310

Query  912   FCVRHGGGKRCQ-FEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQ F GC K AQGST++CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  311   LCISHGGGKRCQFFSGCNKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  369

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C S G  +  K VHGG    V 
Sbjct  370   KR--CLSDGGGICSKSVHGGTNFCVA  393



>ref|XP_004975837.1| PREDICTED: loricrin-like [Setaria italica]
Length=622

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 166/297 (56%), Positives = 194/297 (65%), Gaps = 31/297 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CK HGGGKRC
Sbjct  321   CIKHGGGKRCSVKGCIRSAEGKAGLCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRC  380

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVC KSVHG T YCVAHGGGKRC+V  CTK
Sbjct  381   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCAKSVHGATEYCVAHGGGKRCSVPGCTK  440

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGSTDFCKAHGGGKRC W             C 
Sbjct  441   SARGRTDCCVKHGGGKRCKVDNCGKSAQGSTDFCKAHGGGKRCTW----------STGCE  490

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              F+RGK+G CA+HG ++  +R      +  V   I P        I  +      SMT E
Sbjct  491   KFSRGKSGFCAAHGTMMARQREQ--DAVKNVGSMIGPGL---FSGIVMSSATVGSSMTNE  545

Query  573   RSVVTSANGSD------WKYISFKQATMPILGSPP--SIPV--------TIPEGRVH  451
              S    +  SD       + +   Q  +P    PP  S PV         +PEGRVH
Sbjct  546   HSSSGISTASDCDGTVRSQSMIPPQVLVPRSMMPPWSSEPVDGGREGGHVVPEGRVH  602


 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ S+ +CKAHGGG+RC   GCTK
Sbjct  228   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSSAYCKAHGGGRRCEELGCTK  287

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG RC   G   CPK+  G +  C+ HGGGKRC+V  C +SA G+  
Sbjct  288   SAEGKTDYCIAHGGGHRCEHPG---CPKAARGKSGRCIKHGGGKRCSVKGCIRSAEGKAG  344

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  CGK AQGST +CK HGGGKRC +             C+  A G T
Sbjct  345   LCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  393

Query  732   GLCASHG  712
              LC +HG
Sbjct  394   PLCKAHG  400



>ref|XP_003572181.1| PREDICTED: uncharacterized protein LOC100845094 [Brachypodium 
distachyon]
 ref|XP_010234112.1| PREDICTED: uncharacterized protein LOC100845094 [Brachypodium 
distachyon]
 ref|XP_010234113.1| PREDICTED: uncharacterized protein LOC100845094 [Brachypodium 
distachyon]
Length=631

 Score =   293 bits (751),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 165/211 (78%), Gaps = 5/211 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CIRHGGGKRCQ+ NCTKSAEG SGLCI+HGGGRRC    C+KGAQGST FCKAHGGGKRC
Sbjct  339   CIRHGGGKRCQQVNCTKSAEGRSGLCIAHGGGRRCMQAGCSKGAQGSTDFCKAHGGGKRC  398

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
                 CTKGAEGSTPFCK HGGGKRC  QG   C KSVHGGT +CVAHGGGKRCAV  CTK
Sbjct  399   TNPTCTKGAEGSTPFCKAHGGGKRCATQG---CTKSVHGGTQFCVAHGGGKRCAVEGCTK  455

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARG TD CV HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG   SE G    PC+
Sbjct  456   SARGSTDRCVAHGGGKRCKSSGCDKSAQGSTDFCKAHGGGKRCSWGHQGSELGG--PPCD  513

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVV  661
               ARGK G+CA H  L++D R+HGG +LG  
Sbjct  514   RLARGKMGMCALHNPLLEDDRIHGGRSLGAF  544


 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 127/210 (60%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C KGA+G T++CKAHGGG+RC   GCTK
Sbjct  246   KVCSFPGCRKGARGSSGRCIAHGGGRRCQRDGCNKGAEGKTIYCKAHGGGRRCEELGCTK  305

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG+RC+ +G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  306   SAEGRTDYCIAHGGGRRCINEG---CRRAARGKSGRCIRHGGGKRCQQVNCTKSAEGRSG  362

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RC   GC K AQGSTDFCKAHGGGKRC    P+         C   A G T
Sbjct  363   LCIAHGGGRRCMQAGCSKGAQGSTDFCKAHGGGKRCT--NPT---------CTKGAEGST  411

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C +HG   +       K VHGG    V 
Sbjct  412   PFCKAHGGGKRCATQGCTKSVHGGTQFCVA  441



>ref|XP_008678723.1| PREDICTED: uncharacterized protein LOC103653668 [Zea mays]
 ref|XP_008678724.1| PREDICTED: uncharacterized protein LOC103653668 [Zea mays]
 ref|XP_008678725.1| PREDICTED: uncharacterized protein LOC103653668 [Zea mays]
 ref|XP_008678726.1| PREDICTED: uncharacterized protein LOC103653668 [Zea mays]
 gb|AFW62726.1| hypothetical protein ZEAMMB73_358108 [Zea mays]
 gb|AFW62727.1| hypothetical protein ZEAMMB73_358108 [Zea mays]
 gb|AFW62728.1| hypothetical protein ZEAMMB73_358108 [Zea mays]
Length=630

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/299 (53%), Positives = 197/299 (66%), Gaps = 33/299 (11%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQ+P C KGAQGST++CK+HGGGKRC
Sbjct  327   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQFPDCRKGAQGSTLYCKSHGGGKRC  386

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             ++EGC KGAEGSTP CK HGGGKRC+++GGGVCPKSVHGGT +CVAHGGGKRCAV +C+K
Sbjct  387   VFEGCGKGAEGSTPLCKAHGGGKRCMYEGGGVCPKSVHGGTDFCVAHGGGKRCAVPECSK  446

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ +GCGKSAQGST++CKAHGGGKRC +G            C 
Sbjct  447   SARGRTDCCVKHGGGKRCRVDGCGKSAQGSTEYCKAHGGGKRCNFGGV----------CE  496

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              FARG++GLCA+HG LV  ++   G    +            +    +  +M ++  +  
Sbjct  497   KFARGRSGLCAAHGTLVASRQRRSGGGGMIGPGLF-----RGIVRSASAANMYSEYSSSG  551

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIP------------------VTIPEGRVH  451
              S V+  +GS        +   P +  P S+                   V +PEGRVH
Sbjct  552   VSTVSDCDGSPEAATGRHELIPPQVLVPHSMKSLTAAAVQPPARSREGGVVAVPEGRVH  610


 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  234   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCYKGAESRTAYCKAHGGGRRCLQLGCTK  293

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC +     CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  294   SAEGKTDHCIAHGGGRRCGYLD---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  350

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CK+HGGGKRC +             C   A G T
Sbjct  351   LCISHGGGRRCQFPDCRKGAQGSTLYCKSHGGGKRCVFEG-----------CGKGAEGST  399

Query  732   GLCASHG  712
              LC +HG
Sbjct  400   PLCKAHG  406



>ref|XP_010240508.1| PREDICTED: loricrin-like isoform X2 [Brachypodium distachyon]
Length=641

 Score =   293 bits (750),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQG TMFCK+HGGGKR
Sbjct  328   LCIKHGGGKRCMIEGCTRSAEGYPGLCISHGGGRRCQYPDCCKGAQGGTMFCKSHGGGKR  387

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI EGC KGAEGST  CKGHGGGKRCLF+GG VCPKSVHGGT +CV HGGGKRCA   CT
Sbjct  388   CISEGCNKGAEGSTLLCKGHGGGKRCLFEGGAVCPKSVHGGTSFCVVHGGGKRCAAEGCT  447

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  448   KSARGRTDCCVRHGGGKRCKSDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  497

Query  756   NSFARGKTGLCASHGALVQDKR  691
               FARG++GLC++H  L+  K+
Sbjct  498   EKFARGRSGLCSAHATLMTSKQ  519


 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 126/213 (59%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K   G SGLCISHGGG+RCQ P C KGA+  T +CKAHGGG RC   GCTK
Sbjct  236   KKCRFNGCSKGGRGASGLCISHGGGQRCQKPGCNKGAESRTAYCKAHGGGNRCQELGCTK  295

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  Q    C K+  G +  C+ HGGGKRC +  CT+SA G   
Sbjct  296   SAEGKTEFCIAHGGGRRCGVQ---ECLKAARGRSGLCIKHGGGKRCMIEGCTRSAEGYPG  352

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC      SE       CN  A G T
Sbjct  353   LCISHGGGRRCQYPDCCKGAQGGTMFCKSHGGGKRCI-----SE------GCNKGAEGST  401

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG +  VV
Sbjct  402   LLCKGHGGGKRCLFEGGAVCPKSVHGGTSFCVV  434



>gb|EAY85267.1| hypothetical protein OsI_06638 [Oryza sativa Indica Group]
Length=631

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 184/286 (64%), Gaps = 34/286 (12%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQ   CTKSAEG SGLCI+HGGGRRCQ   C KGAQGST FCKAHGGGKRC
Sbjct  335   CIKHGGGKRCQHAGCTKSAEGRSGLCIAHGGGRRCQQDGCGKGAQGSTNFCKAHGGGKRC  394

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  C KGAEGST FCKGHGGGKRC  +G   C KSVHGGTL CVAHGGGKRC V  CTK
Sbjct  395   THPDCKKGAEGSTAFCKGHGGGKRCSAEG---CTKSVHGGTLCCVAHGGGKRCVVEGCTK  451

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRCQ  GC KSAQGST+FCKAHGGGKRC WG   S+ G G  PC 
Sbjct  452   SARGRTDRCVGHGGGKRCQSSGCDKSAQGSTNFCKAHGGGKRCLWGHEGSDHGAGNTPCE  511

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
               ARGK GLC  H   V + RVHGG    VV   +            +  D  +++ T  
Sbjct  512   RLARGKNGLCVYHNPQVDENRVHGG--FSVVSDAL------------SQGDRPSNTETSR  557

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
             RS+ +                   + +P  +     EGRVHGG++L
Sbjct  558   RSIFSHP-----------------MEAPRRVAALADEGRVHGGNIL  586


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  242   KNCTYPGCMKGARGSSGRCIAHGGGRRCQKDGCDKGAEGKTIFCKAHGGGRRCEHLGCTK  301

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC    CTKSA GR+ 
Sbjct  302   SAEGRTDFCIAHGGGRRCSHEG---CKRAARGKSGRCIKHGGGKRCQHAGCTKSAEGRSG  358

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ +GCGK AQGST+FCKAHGGGKRC               C   A G T
Sbjct  359   LCIAHGGGRRCQQDGCGKGAQGSTNFCKAHGGGKRCT-----------HPDCKKGAEGST  407

Query  732   GLCASHGALVQ------DKRVHGG  679
               C  HG   +       K VHGG
Sbjct  408   AFCKGHGGGKRCSAEGCTKSVHGG  431



>ref|XP_003580653.1| PREDICTED: loricrin-like isoform X1 [Brachypodium distachyon]
Length=656

 Score =   293 bits (751),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 161/202 (80%), Gaps = 10/202 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  GLCISHGGGRRCQYP C KGAQG TMFCK+HGGGKR
Sbjct  343   LCIKHGGGKRCMIEGCTRSAEGYPGLCISHGGGRRCQYPDCCKGAQGGTMFCKSHGGGKR  402

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI EGC KGAEGST  CKGHGGGKRCLF+GG VCPKSVHGGT +CV HGGGKRCA   CT
Sbjct  403   CISEGCNKGAEGSTLLCKGHGGGKRCLFEGGAVCPKSVHGGTSFCVVHGGGKRCAAEGCT  462

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  463   KSARGRTDCCVRHGGGKRCKSDGCDKSAQGSTDFCKAHGGGKRCAW----------STGC  512

Query  756   NSFARGKTGLCASHGALVQDKR  691
               FARG++GLC++H  L+  K+
Sbjct  513   EKFARGRSGLCSAHATLMTSKQ  534


 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 126/213 (59%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K   G SGLCISHGGG+RCQ P C KGA+  T +CKAHGGG RC   GCTK
Sbjct  251   KKCRFNGCSKGGRGASGLCISHGGGQRCQKPGCNKGAESRTAYCKAHGGGNRCQELGCTK  310

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  Q    C K+  G +  C+ HGGGKRC +  CT+SA G   
Sbjct  311   SAEGKTEFCIAHGGGRRCGVQ---ECLKAARGRSGLCIKHGGGKRCMIEGCTRSAEGYPG  367

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC      SE       CN  A G T
Sbjct  368   LCISHGGGRRCQYPDCCKGAQGGTMFCKSHGGGKRCI-----SE------GCNKGAEGST  416

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC  H         G  V  K VHGG +  VV
Sbjct  417   LLCKGHGGGKRCLFEGGAVCPKSVHGGTSFCVV  449



>ref|XP_002873415.1| hypothetical protein ARALYDRAFT_908918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49674.1| hypothetical protein ARALYDRAFT_908918 [Arabidopsis lyrata subsp. 
lyrata]
Length=546

 Score =   290 bits (741),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 195/300 (65%), Gaps = 24/300 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  ENCT+SAEG +GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  247   LCIKHGGGKRCNIENCTRSAEGQAGLCISHGGGKRCQFSSGCEKGAQGSTNYCKAHGGGK  306

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRC V  C
Sbjct  307   RCIFSGCSKGAEGSTPLCKAHGGGKRCLADGGGICSKSVHGGTNFCVAHGGGKRCVVAGC  366

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   C KSAQGSTDFCKAHGGGKRC WG         E  
Sbjct  367   TKSARGRTDCCVKHGGGKRCKIVDCEKSAQGSTDFCKAHGGGKRCSWG---------EGK  417

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVV----VQEITPKRTENMKEIDTTEDMDA  592
             C  FARGK+GLCA+H  ++  +   GG+  G++       +    T +  +   +   D 
Sbjct  418   CEKFARGKSGLCAAHNTIM-SRENEGGSKSGLIGPGLFSGLVFGSTSDHSQSGVSAVSDC  476

Query  591   DSMTVERSVVTSANGSDWKYISFKQATMPILGSPPS--------IPVTIPEGRVHGGSLL  436
                +V+R    +   +    I  +      + SP +            +PE RVHGG L+
Sbjct  477   TD-SVDRIQFENRQKNKKMMIPMQVLVPSSMKSPSTSHEGETNIYDFMVPEERVHGGGLI  535


 Score =   190 bits (482),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 133/206 (65%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCISHGGG+RCQ P C KGA+  T FCK HGGGKRC + GCTK
Sbjct  154   RKCKFMGCLKGARGSSGLCISHGGGQRCQKPGCNKGAESRTTFCKTHGGGKRCEHLGCTK  213

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC + +CT+SA G+  
Sbjct  214   SAEGKTDFCISHGGGRRCEFLEG--CDKAARGKSGLCIKHGGGKRCNIENCTRSAEGQAG  271

Query  912   FCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQF  GC K AQGST++CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  272   LCISHGGGKRCQFSSGCEKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  330

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C + G  +  K VHGG    V 
Sbjct  331   KR--CLADGGGICSKSVHGGTNFCVA  354



>ref|XP_009112138.1| PREDICTED: uncharacterized protein LOC103837532 [Brassica rapa]
Length=560

 Score =   290 bits (741),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 166/315 (53%), Positives = 200/315 (63%), Gaps = 45/315 (14%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E C +SAEG +GLCISHGGGRRCQ   CTKGAQGST +CK HGGGKR
Sbjct  250   LCIKHGGGKRCRVEGCKRSAEGQAGLCISHGGGRRCQSLDCTKGAQGSTNYCKGHGGGKR  309

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GC KGAEGSTP CK HGGGKRC+F GGG+C KSVHGGT +CVAHGGGKRC V  CT
Sbjct  310   CIFGGCAKGAEGSTPLCKAHGGGKRCMFDGGGICSKSVHGGTSFCVAHGGGKRCVVVGCT  369

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+  GC KSAQG T+ CKAHGGGKRC WG        G + C
Sbjct  370   KSARGRTDCCVKHGGGKRCKCLGCEKSAQGRTELCKAHGGGKRCSWG--------GGLVC  421

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
               FARGK+GLCA+H ++ QDK    G+ +G+    I P     +  + TT D     ++ 
Sbjct  422   EKFARGKSGLCAAHNSMAQDK---AGSKIGL----IGPGLFSGL--VSTTTDYSLSGVSA  472

Query  576   ERSVVTSANGSDWKYISFKQATM-PI-LGSPPS--------------------------I  481
                   S +    +++  +Q  M P+ +  PPS                          +
Sbjct  473   VSDCTDSIDRYPQQHLEKRQKVMIPMQVLVPPSMKSLRFSNTERPETDNKSSNSNGRNML  532

Query  480   PVTIPEGRVHGGSLL  436
              + I E RVHGG L+
Sbjct  533   DLMIHEERVHGGGLM  547


 Score =   182 bits (461),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 127/213 (60%), Gaps = 22/213 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RCQ P C KGA+  T FCKAHGGGKRC + GCTK
Sbjct  157   KKCRFMGCAKGARGASGLCIGHGGGQRCQKPGCNKGAESKTTFCKAHGGGKRCQHLGCTK  216

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC V  C +SA G+  
Sbjct  217   SAEGKTDFCISHGGGRRCGFPEG--CGKAARGKSGLCIKHGGGKRCRVEGCKRSAEGQAG  274

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CK HGGGKRC +G            C   A G T
Sbjct  275   LCISHGGGRRCQSLDCTKGAQGSTNYCKGHGGGKRCIFG-----------GCAKGAEGST  323

Query  732   GLCASH---------GALVQDKRVHGGATLGVV  661
              LC +H         G  +  K VHGG +  V 
Sbjct  324   PLCKAHGGGKRCMFDGGGICSKSVHGGTSFCVA  356



>ref|NP_196529.1| loricrin-related protein [Arabidopsis thaliana]
 ref|NP_850801.1| loricrin-related protein [Arabidopsis thaliana]
 emb|CAB89363.1| putative protein [Arabidopsis thaliana]
 dbj|BAB09522.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM97003.1| putative protein [Arabidopsis thaliana]
 gb|AAQ56830.1| At5g09670 [Arabidopsis thaliana]
 dbj|BAE98550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91427.1| loricrin-related protein [Arabidopsis thaliana]
 gb|AED91428.1| loricrin-related protein [Arabidopsis thaliana]
Length=546

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 164/304 (54%), Positives = 192/304 (63%), Gaps = 32/304 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG +GLCISHGGG+RCQY   C KGAQGST +CKAHGGGK
Sbjct  247   LCIKHGGGKRCNIEDCTRSAEGQAGLCISHGGGKRCQYFSGCEKGAQGSTNYCKAHGGGK  306

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRC V  C
Sbjct  307   RCIFSGCSKGAEGSTPLCKAHGGGKRCLADGGGICSKSVHGGTNFCVAHGGGKRCVVVGC  366

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   C KSAQGSTDFCKAHGGGKRC WG      GK    
Sbjct  367   TKSARGRTDSCVKHGGGKRCKIIDCEKSAQGSTDFCKAHGGGKRCSWGD-----GK----  417

Query  759   CNSFARGKTGLCASHGALVQDKRVHG--------GATLGVVVQEITPKRTENMKEIDTTE  604
             C  FARGK+GLCA+H  ++  +   G        G   G+V    +         +    
Sbjct  418   CEKFARGKSGLCAAHNTIMSRENKDGSKSGLIGPGLFSGLVFGSTSDHSQSGASAVSDCT  477

Query  603   DMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPS--------IPVTIPEGRVHG  448
             D      +VER    +   +    I  +      + SP +            +PE RVHG
Sbjct  478   D------SVERIQFENRQKNKKMMIPMQVLVPSSMKSPSNSHEGETNIYDFMVPEERVHG  531

Query  447   GSLL  436
             G L+
Sbjct  532   GGLV  535


 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 133/206 (65%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCISHGGG+RCQ P C KGA+  T FCK HGGGKRC + GCTK
Sbjct  154   RKCKFMGCVKGARGASGLCISHGGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTK  213

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC + DCT+SA G+  
Sbjct  214   SAEGKTDFCISHGGGRRCEFLEG--CDKAARGRSGLCIKHGGGKRCNIEDCTRSAEGQAG  271

Query  912   FCVRHGGGKRCQ-FEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQ F GC K AQGST++CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  272   LCISHGGGKRCQYFSGCEKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  330

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C + G  +  K VHGG    V 
Sbjct  331   KR--CLADGGGICSKSVHGGTNFCVA  354



>ref|NP_001159223.1| hypothetical protein [Zea mays]
 ref|XP_008662086.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008662087.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008662088.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008662089.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25487.1| unknown [Zea mays]
 gb|AFW58460.1| hypothetical protein ZEAMMB73_470687 [Zea mays]
Length=624

 Score =   290 bits (742),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 192/297 (65%), Gaps = 31/297 (10%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  + C +SAEG +GLCISHGGGRRCQYP C KGAQGST++CK HGGGKRC
Sbjct  323   CIKHGGGKRCSVKGCIRSAEGKAGLCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRC  382

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             I++GC+KGAEGSTP CK HGGGKRC+F+GGGVC KSVHG T YCV HGGGKRC+V  CTK
Sbjct  383   IFDGCSKGAEGSTPLCKAHGGGKRCMFEGGGVCAKSVHGATEYCVVHGGGKRCSVPGCTK  442

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ + CGKSAQGST FCKAHGGGKRC W             C 
Sbjct  443   SARGRTDCCVKHGGGKRCKVDSCGKSAQGSTHFCKAHGGGKRCTW----------STGCE  492

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTVE  574
              F+RGK+G CA+HG L+  +R      +  V   I P        I  +    A SMT E
Sbjct  493   KFSRGKSGFCAAHGTLMARQREE--EVVKNVGSMIGPGL---FSGIVASSATAASSMTNE  547

Query  573   RSVVTSANGSDWKYISFKQATMPILGSPP--------SIPV--------TIPEGRVH  451
              S    +  SD       Q+ +P L   P        + PV         +PEGRVH
Sbjct  548   HSASGVSTASDCDGTVRSQSMIPPLVLVPRSMMPSWSTEPVDGGREGGHVVPEGRVH  604


 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 122/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RC  P C KGA+ S+ +CKAHGGG+RC   GCTK
Sbjct  230   KKCRFKGCSKGARGASGLCIAHGGGQRCHKPGCHKGAESSSAYCKAHGGGRRCEELGCTK  289

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T +C  HGGG RC   G   CPK+  G +  C+ HGGGKRC+V  C +SA G+  
Sbjct  290   SAEGKTDYCIAHGGGCRCQHPG---CPKAARGKSGRCIKHGGGKRCSVKGCIRSAEGKAG  346

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  CGK AQGST +CK HGGGKRC +             C+  A G T
Sbjct  347   LCISHGGGRRCQYPDCGKGAQGSTLYCKGHGGGKRCIFDG-----------CSKGAEGST  395

Query  732   GLCASHG  712
              LC +HG
Sbjct  396   PLCKAHG  402



>dbj|BAD20066.1| loricrin-like [Oryza sativa Japonica Group]
 dbj|BAD20112.1| loricrin-like [Oryza sativa Japonica Group]
Length=631

 Score =   290 bits (742),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 182/288 (63%), Gaps = 38/288 (13%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRCQ   CTKSAEG SGLCI+HGGGRRCQ   C KGAQGST FCKAHGGGKRC
Sbjct  335   CIKHGGGKRCQHAGCTKSAEGRSGLCIAHGGGRRCQQDGCGKGAQGSTNFCKAHGGGKRC  394

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +  C KGAEGST FCKGHGGGKRC  +G   C KSVHGGTL CVAHGGGKRC V  CTK
Sbjct  395   THPDCKKGAEGSTAFCKGHGGGKRCSAEG---CTKSVHGGTLCCVAHGGGKRCVVEGCTK  451

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV HGGGKRCQ  GC KSAQGST+FCKAHGGGKRC WG   S+ G G+ PC 
Sbjct  452   SARGRTDRCVGHGGGKRCQSSGCDKSAQGSTNFCKAHGGGKRCLWGHEGSDHGAGDTPCE  511

Query  753   SFARGKTGLCASHGALVQDKRVHGGATL--GVVVQEITPKRTENMKEIDTTEDMDADSMT  580
               ARGK GLC  H   V + RVHGG ++    + Q   P  TE  +    +  M+A    
Sbjct  512   RLARGKNGLCVYHNPQVDENRVHGGFSVVSDALSQGDRPSNTETSRCSIFSHPMEA----  567

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                                          P  +     EGRVHGG++L
Sbjct  568   -----------------------------PRRVAAPADEGRVHGGNIL  586


 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 125/204 (61%), Gaps = 20/204 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C KGA+G T+FCKAHGGG+RC + GCTK
Sbjct  242   KNCTYPGCMKGARGSSGRCIAHGGGRRCQKDGCDKGAEGKTIFCKAHGGGRRCEHLGCTK  301

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC    CTKSA GR+ 
Sbjct  302   SAEGRTDFCIAHGGGRRCSHEG---CKRAARGKSGRCIKHGGGKRCQHAGCTKSAEGRSG  358

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ +GCGK AQGST+FCKAHGGGKRC               C   A G T
Sbjct  359   LCIAHGGGRRCQQDGCGKGAQGSTNFCKAHGGGKRCT-----------HPDCKKGAEGST  407

Query  732   GLCASHGALVQ------DKRVHGG  679
               C  HG   +       K VHGG
Sbjct  408   AFCKGHGGGKRCSAEGCTKSVHGG  431



>ref|XP_010452964.1| PREDICTED: uncharacterized protein LOC104734965 [Camelina sativa]
 ref|XP_010452965.1| PREDICTED: uncharacterized protein LOC104734965 [Camelina sativa]
Length=579

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 195/306 (64%), Gaps = 36/306 (12%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG +GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  280   LCIKHGGGKRCNIESCTRSAEGQAGLCISHGGGKRCQFISGCEKGAQGSTNYCKAHGGGK  339

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRCAV  C
Sbjct  340   RCIFSGCSKGAEGSTPLCKAHGGGKRCLADGGGICSKSVHGGTNFCVAHGGGKRCAVAGC  399

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   C KSAQGSTDFCKAHGGGKRC W     E GK    
Sbjct  400   TKSARGRTDCCVKHGGGKRCKIVDCEKSAQGSTDFCKAHGGGKRCSW-----EDGK----  450

Query  759   CNSFARGKTGLCASHGALVQDKRVHG--------GATLGVVVQEITPKR----------T  634
             C  FARGK+GLCA+H  ++  ++  G        G   G+VV   +             T
Sbjct  451   CEKFARGKSGLCAAHNTVMSREKGDGIKSGLIGPGLFSGLVVGSASHHSQSGASAVSDCT  510

Query  633   ENMKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRV  454
             E++  I          M +   V+  +        S K  +    G        +PE RV
Sbjct  511   ESVDRIQFENRQKKKKMMIPMQVLVPS--------SMKSPSNSNGGETNIFDFMVPEERV  562

Query  453   HGGSLL  436
             HGG L+
Sbjct  563   HGGGLV  568


 Score =   189 bits (479),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 132/211 (63%), Gaps = 7/211 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    ++C+   C K A G SGLCISHGGG+RCQ P C KGA+  T FCK HGGG RC +
Sbjct  182   RSSNPRKCKFMGCVKGARGASGLCISHGGGQRCQKPGCNKGAESKTTFCKTHGGGNRCEH  241

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA
Sbjct  242   LGCTKSAEGKTDFCISHGGGRRCEFPEG--CDKAARGRSGLCIKHGGGKRCNIESCTRSA  299

Query  927   RGRTDFCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CN  754
              G+   C+ HGGGKRCQF  GC K AQGST++CKAHGGGKRC +    S+  +G  P C 
Sbjct  300   EGQAGLCISHGGGKRCQFISGCEKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCK  358

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVV  661
             +   GK   C + G  +  K VHGG    V 
Sbjct  359   AHGGGKR--CLADGGGICSKSVHGGTNFCVA  387



>ref|NP_001047213.1| Os02g0575700 [Oryza sativa Japonica Group]
 dbj|BAD34244.1| loricrin-like protein [Oryza sativa Japonica Group]
 dbj|BAD33357.1| loricrin-like protein [Oryza sativa Japonica Group]
 dbj|BAF09127.1| Os02g0575700 [Oryza sativa Japonica Group]
 gb|EAZ23542.1| hypothetical protein OsJ_07240 [Oryza sativa Japonica Group]
 dbj|BAG97353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=655

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 163/201 (81%), Gaps = 10/201 (5%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  355   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQYPDCRKGAQGSTLYCKAHGGGKRC  414

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC KGAEGSTP CK HGGGKRC+F+GGG+CPKSVHGGT +CVAHGGGKRC V  C K
Sbjct  415   VFDGCLKGAEGSTPLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVAHGGGKRCTVPGCGK  474

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ +GC KSAQGST+FCKAHGGGKRC W             C 
Sbjct  475   SARGRTDCCVKHGGGKRCRVDGCAKSAQGSTEFCKAHGGGKRCTWA----------TGCE  524

Query  753   SFARGKTGLCASHGALVQDKR  691
              FARG++GLCA+HG L+  ++
Sbjct  525   KFARGRSGLCAAHGTLMASQQ  545


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 131/213 (62%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  262   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCMQLGCTK  321

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  QG   CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  322   SAEGKTDHCIAHGGGRRCGHQG---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  378

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  379   LCISHGGGRRCQYPDCRKGAQGSTLYCKAHGGGKRCVFDG-----------CLKGAEGST  427

Query  732   GLCASHGALVQ---------DKRVHGGATLGVV  661
              LC +HG   +          K VHGG +  V 
Sbjct  428   PLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVA  460



>gb|EEC73463.1| hypothetical protein OsI_07775 [Oryza sativa Indica Group]
Length=660

 Score =   289 bits (740),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 163/201 (81%), Gaps = 10/201 (5%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQYP C KGAQGST++CKAHGGGKRC
Sbjct  355   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQYPDCRKGAQGSTLYCKAHGGGKRC  414

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC KGAEGSTP CK HGGGKRC+F+GGG+CPKSVHGGT +CVAHGGGKRC V  C K
Sbjct  415   VFDGCLKGAEGSTPLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVAHGGGKRCTVPGCGK  474

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRTD CV+HGGGKRC+ +GC KSAQGST+FCKAHGGGKRC W             C 
Sbjct  475   SARGRTDCCVKHGGGKRCRVDGCAKSAQGSTEFCKAHGGGKRCTWA----------TGCE  524

Query  753   SFARGKTGLCASHGALVQDKR  691
              FARG++GLCA+HG L+  ++
Sbjct  525   KFARGRSGLCAAHGTLMASQQ  545


 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 131/213 (62%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  262   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCMQLGCTK  321

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC  QG   CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  322   SAEGKTDHCIAHGGGRRCGHQG---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  378

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  379   LCISHGGGRRCQYPDCRKGAQGSTLYCKAHGGGKRCVFDG-----------CLKGAEGST  427

Query  732   GLCASHGALVQ---------DKRVHGGATLGVV  661
              LC +HG   +          K VHGG +  V 
Sbjct  428   PLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVA  460



>ref|XP_003575219.1| PREDICTED: hornerin-like [Brachypodium distachyon]
 ref|XP_010235588.1| PREDICTED: hornerin-like [Brachypodium distachyon]
 ref|XP_010235590.1| PREDICTED: hornerin-like [Brachypodium distachyon]
Length=654

 Score =   288 bits (737),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 166/197 (84%), Gaps = 5/197 (3%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQ+P C KGAQGST++CK+HGGGKRC
Sbjct  336   CIKHGGGKRCAVEGCIRSAEGKVGLCISHGGGRRCQHPDCRKGAQGSTLYCKSHGGGKRC  395

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             ++EGC+KGAEGSTP CK HGGGKRC+++GGGVCPKSVHGGT YCVAHGGGKRC+V  C K
Sbjct  396   VFEGCSKGAEGSTPLCKAHGGGKRCMYEGGGVCPKSVHGGTSYCVAHGGGKRCSVAACGK  455

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRT+FCV+HGGGKRC+ E CGKSAQGST+FCKAHGGGKRC +G  +   G     C 
Sbjct  456   SARGRTEFCVKHGGGKRCKVESCGKSAQGSTEFCKAHGGGKRCTFGGLTGTGG-----CE  510

Query  753   SFARGKTGLCASHGALV  703
              FARG++GLCA+H  LV
Sbjct  511   KFARGRSGLCAAHATLV  527


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 134/205 (65%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P+C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  243   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPRCHKGAESRTAYCKAHGGGRRCMQLGCTK  302

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC + G   CPK+  G +  C+ HGGGKRCAV  C +SA G+  
Sbjct  303   SAEGKTDHCIAHGGGRRCGYNG---CPKAARGKSGRCIKHGGGKRCAVEGCIRSAEGKVG  359

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ   C K AQGST +CK+HGGGKRC + +  S+  +G  P C +   GK
Sbjct  360   LCISHGGGRRCQHPDCRKGAQGSTLYCKSHGGGKRCVF-EGCSKGAEGSTPLCKAHGGGK  418

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  V  K VHGG +  V 
Sbjct  419   R--CMYEGGGVCPKSVHGGTSYCVA  441



>dbj|BAK03259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   288 bits (736),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 10/197 (5%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  G CISHGGGRRCQYP C KGAQGST++CK+HGGGKRC
Sbjct  333   CIKHGGGKRCAVEGCIRSAEGKVGFCISHGGGRRCQYPDCRKGAQGSTLYCKSHGGGKRC  392

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             ++EGC KGAEGSTP CK HGGGKRC+++GGGVCPKSVHGGT YCVAHGGGKRC+V  C K
Sbjct  393   VFEGCAKGAEGSTPLCKAHGGGKRCMYEGGGVCPKSVHGGTGYCVAHGGGKRCSVPGCGK  452

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
             SARGRT+FCV+HGGGKRC  + CGKSAQGST+FCKAHGGGKRC        FG G   C+
Sbjct  453   SARGRTEFCVKHGGGKRCMVDSCGKSAQGSTEFCKAHGGGKRC-------TFGTG---CD  502

Query  753   SFARGKTGLCASHGALV  703
              FARG++GLCA+H  LV
Sbjct  503   KFARGRSGLCAAHATLV  519


 Score =   184 bits (467),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 123/187 (66%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  240   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCYKGAESRTAYCKAHGGGRRCMQLGCTK  299

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T  C  HGGG+RC +     CPK+  G +  C+ HGGGKRCAV  C +SA G+  
Sbjct  300   SAEGKTDHCIAHGGGRRCGYNS---CPKAARGKSGRCIKHGGGKRCAVEGCIRSAEGKVG  356

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
             FC+ HGGG+RCQ+  C K AQGST +CK+HGGGKRC +             C   A G T
Sbjct  357   FCISHGGGRRCQYPDCRKGAQGSTLYCKSHGGGKRCVFEG-----------CAKGAEGST  405

Query  732   GLCASHG  712
              LC +HG
Sbjct  406   PLCKAHG  412



>ref|XP_009380175.1| PREDICTED: loricrin-like [Musa acuminata subsp. malaccensis]
Length=649

 Score =   287 bits (735),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 163/202 (81%), Gaps = 10/202 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI HGGGKRC  E C ++AEG  GLCISHGGGRRCQYP C KGAQGST +CKAHGGG+R
Sbjct  337   LCIGHGGGKRCTVEGCIRNAEGQPGLCISHGGGRRCQYPDCRKGAQGSTKYCKAHGGGRR  396

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C+++GCTKGAEGSTP CKGHGGGKRC F+GGGVCPKSVHGGT +CVAHGGGKRC+   CT
Sbjct  397   CMFQGCTKGAEGSTPLCKGHGGGKRCHFKGGGVCPKSVHGGTRFCVAHGGGKRCSFAGCT  456

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV HGGGKRC F+GC KSAQG T+FCKAHGGGKRC W             C
Sbjct  457   KSARGRTDCCVLHGGGKRCHFQGCNKSAQGRTNFCKAHGGGKRCAWAS----------GC  506

Query  756   NSFARGKTGLCASHGALVQDKR  691
             + FARG++GLCA+HG ++  ++
Sbjct  507   DKFARGRSGLCAAHGTMMAAQQ  528


 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 124/205 (60%), Gaps = 7/205 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C  + C+K A G SGLCI HGGG+RCQ P C K A+  T FCKAHGGG+RC   GCTK
Sbjct  245   KKCMFKGCSKGARGASGLCIGHGGGQRCQRPGCNKSAESRTAFCKAHGGGRRCQMLGCTK  304

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
               EG T FC  HGGG RC   G   C K+  G +  C+ HGGGKRC V  C ++A G+  
Sbjct  305   SVEGKTDFCIAHGGGCRCTHPG---CTKAARGKSNLCIGHGGGKRCTVEGCIRNAEGQPG  361

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARGK  736
              C+ HGGG+RCQ+  C K AQGST +CKAHGGG+RC + Q  ++  +G  P C     GK
Sbjct  362   LCISHGGGRRCQYPDCRKGAQGSTKYCKAHGGGRRCMF-QGCTKGAEGSTPLCKGHGGGK  420

Query  735   TGLCASHGALVQDKRVHGGATLGVV  661
                C   G  V  K VHGG    V 
Sbjct  421   R--CHFKGGGVCPKSVHGGTRFCVA  443



>ref|XP_010431733.1| PREDICTED: probable WRKY transcription factor 19 [Camelina sativa]
Length=252

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 173/242 (71%), Gaps = 17/242 (7%)
 Frame = -3

Query  1149  MFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHG  970
             MFCKAHGGGKRC + GCTKGAEGSTPFCKGHGGGKRC FQGG  C KSVHGGT +CVAHG
Sbjct  1     MFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHG  60

Query  969   GGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQP  790
             GGKRCAV +CTKSARGRTDFCVRHGGGKRC+ EGCGKSAQGSTDFCKAHGGGKRC WGQP
Sbjct  61    GGKRCAVPECTKSARGRTDFCVRHGGGKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGQP  120

Query  789   SSEFG--KGEIPCNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMK  622
              +E+       PC SFARGKTGLCA H +LVQD RVHGG T+    QE  ++   TEN +
Sbjct  121   ETEYAGQSSSGPCTSFARGKTGLCALHNSLVQDNRVHGGMTVTSESQEPRVSSSETENEE  180

Query  621   EIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGS  442
             E   ++DM+ D+M        SA GS    +   +    +           PE RVHGGS
Sbjct  181   EFSGSQDMNIDTMKAR-----SATGSPETDVDLNEYEAGL--------GLAPEERVHGGS  227

Query  441   LL  436
             L+
Sbjct  228   LM  229


 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 79/136 (58%), Gaps = 18/136 (13%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKEN---CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGG  1126
              C  HGGGKRC  +    C+KS  G +  C++HGGG+RC  P+CTK A+G T FC  HGG
Sbjct  27    FCKGHGGGKRCAFQGGDPCSKSVHGGTNFCVAHGGGKRCAVPECTKSARGRTDFCVRHGG  86

Query  1125  GKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVT  946
             GKRC  EGC K A+GST FCK HGGGKRC +      P++ + G           + +  
Sbjct  87    GKRCKSEGCGKSAQGSTDFCKAHGGGKRCAWGQ----PETEYAG-----------QSSSG  131

Query  945   DCTKSARGRTDFCVRH  898
              CT  ARG+T  C  H
Sbjct  132   PCTSFARGKTGLCALH  147



>ref|XP_010422955.1| PREDICTED: probable WRKY transcription factor 19 [Camelina sativa]
 ref|XP_010422956.1| PREDICTED: probable WRKY transcription factor 19 [Camelina sativa]
Length=582

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 196/305 (64%), Gaps = 35/305 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG +GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  284   LCIKHGGGKRCNIESCTRSAEGQAGLCISHGGGKRCQFISGCEKGAQGSTNYCKAHGGGK  343

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRCAV  C
Sbjct  344   RCIFSGCSKGAEGSTPLCKAHGGGKRCLADGGGICSKSVHGGTNFCVAHGGGKRCAVAGC  403

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   C KSAQGSTDFCKAHGGGKRC W     E GK    
Sbjct  404   TKSARGRTDCCVKHGGGKRCKIVDCEKSAQGSTDFCKAHGGGKRCSW-----EDGK----  454

Query  759   CNSFARGKTGLCASHGALVQDKRVHG--------GATLGVVVQEITPKRTENMKEI-DTT  607
             C  FARG++GLCA+H  ++  ++  G        G   G+VV   +         + D T
Sbjct  455   CEKFARGRSGLCAAHNTVMSREKGDGSKSGLIGPGLFSGLVVGSASDHSQSGASAVSDCT  514

Query  606   EDMD--------ADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVH  451
             E +D           M +   V+  ++       +  +  +            +PE RVH
Sbjct  515   ESVDRIQFENRQKKKMMIPMQVLVPSSMKSPSSSNGGETNI--------FDFMVPEERVH  566

Query  450   GGSLL  436
             GG L+
Sbjct  567   GGGLI  571


 Score =   188 bits (477),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCISHGGG+RCQ P C KGA+  T FCK HGGG RC + GCTK
Sbjct  191   RKCKFMGCVKGARGASGLCISHGGGQRCQKPGCNKGAESKTTFCKTHGGGNRCEHLGCTK  250

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  251   SAEGKTDFCISHGGGRRCEFPEG--CDKAARGRSGLCIKHGGGKRCNIESCTRSAEGQAG  308

Query  912   FCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQF  GC K AQGST++CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  309   LCISHGGGKRCQFISGCEKGAQGSTNYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  367

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C + G  +  K VHGG    V 
Sbjct  368   KR--CLADGGGICSKSVHGGTNFCVA  391



>ref|XP_010491606.1| PREDICTED: uncharacterized protein LOC104769157 [Camelina sativa]
Length=577

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 163/304 (54%), Positives = 195/304 (64%), Gaps = 34/304 (11%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+CT+SAEG +GLCISHGGG+RCQ+   C KGAQGST +CKAHGGGK
Sbjct  280   LCIKHGGGKRCNIESCTRSAEGQAGLCISHGGGKRCQFVSGCEKGAQGSTSYCKAHGGGK  339

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC+KGAEGSTP CK HGGGKRCL  GGG+C KSVHGGT +CVAHGGGKRCAV  C
Sbjct  340   RCIFSGCSKGAEGSTPLCKAHGGGKRCLADGGGICSKSVHGGTNFCVAHGGGKRCAVAGC  399

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   C KSAQGSTDFCKAHGGGKRC W     E GK    
Sbjct  400   TKSARGRTDCCVKHGGGKRCKIVDCEKSAQGSTDFCKAHGGGKRCSW-----EDGK----  450

Query  759   CNSFARGKTGLCASHGALVQDKRVHG--------GATLGVVVQEITPKRTENMKEI-DTT  607
             C  FARGK+GLCA+H  ++  ++  G        G   G+VV   +         + D  
Sbjct  451   CEKFARGKSGLCAAHNTVMSREKGDGSKSGLIGPGLFRGLVVGSASDHSQSGASAVSDCI  510

Query  606   EDMD-------ADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHG  448
             E +D          M +   V+  ++       +  +  +            +PE RVHG
Sbjct  511   ESVDRIQFENRQKKMMIPMQVLVPSSMKSPSSSNGGETNV--------FDFMVPEERVHG  562

Query  447   GSLL  436
             G L+
Sbjct  563   GGLV  566


 Score =   187 bits (475),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 130/206 (63%), Gaps = 7/206 (3%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             ++C+   C K A G SGLCISHGGG+RCQ P C KGA+  T FCK HGGG RC + GCTK
Sbjct  187   RKCKFMGCVKGARGASGLCISHGGGQRCQKPGCNKGAESKTTFCKTHGGGSRCEHLGCTK  246

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  CT+SA G+  
Sbjct  247   SAEGKTDFCISHGGGRRCEFPEG--CDKAARGRSGLCIKHGGGKRCNIESCTRSAEGQAG  304

Query  912   FCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFARG  739
              C+ HGGGKRCQF  GC K AQGST +CKAHGGGKRC +    S+  +G  P C +   G
Sbjct  305   LCISHGGGKRCQFVSGCEKGAQGSTSYCKAHGGGKRCIF-SGCSKGAEGSTPLCKAHGGG  363

Query  738   KTGLCASHGALVQDKRVHGGATLGVV  661
             K   C + G  +  K VHGG    V 
Sbjct  364   KR--CLADGGGICSKSVHGGTNFCVA  387



>dbj|BAK04205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 180/278 (65%), Gaps = 28/278 (10%)
 Frame = -3

Query  1251  CTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTP  1072
             CT+SAEG  G+CI+HGGGRRCQYP C+KGAQG T+FCK+HGGGKRCI EGCTKGAEGST 
Sbjct  3     CTRSAEGYPGVCIAHGGGRRCQYPDCSKGAQGGTLFCKSHGGGKRCISEGCTKGAEGSTL  62

Query  1071  FCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGG  892
              CKGHGGGKRCLF+G   CPKSVHGGT +CV HGGGKRC    CTKSARGRTD CVRHGG
Sbjct  63    LCKGHGGGKRCLFEGAAACPKSVHGGTSFCVVHGGGKRCVAPGCTKSARGRTDCCVRHGG  122

Query  891   GKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC+ +GCGKSAQGSTDFCKAHGGGKRC W             C  FARG++GLC++HG
Sbjct  123   GKRCKSDGCGKSAQGSTDFCKAHGGGKRCAW----------SAGCEKFARGRSGLCSAHG  172

Query  711   ALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMD----ADSMTVERSVVTSANG-  547
              L   K            QE+   +  +M        +D        ++E  + +S  G 
Sbjct  173   NLTASK------------QELECGQGRSMIGHGLFSGIDSSSSTVGSSMEHVISSSLPGA  220

Query  546   -SDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              SD+   S +           S    +PEGRVHGG L+
Sbjct  221   LSDFCGESSEHGQEGGGSRNQSFGFVVPEGRVHGGGLM  258


 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 109/163 (67%), Gaps = 7/163 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             +CI HGGG+RCQ  +C+K A+G +  C SHGGG+RC    CTKGA+GST+ CK HGGGKR
Sbjct  13    VCIAHGGGRRCQYPDCSKGAQGGTLFCKSHGGGKRCISEGCTKGAEGSTLLCKGHGGGKR  72

Query  1116  CIYEG---CTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVT  946
             C++EG   C K   G T FC  HGGGKRC+  G   C KS  G T  CV HGGGKRC   
Sbjct  73    CLFEGAAACPKSVHGGTSFCVVHGGGKRCVAPG---CTKSARGRTDCCVRHGGGKRCKSD  129

Query  945   DCTKSARGRTDFCVRHGGGKRCQFE-GCGKSAQGSTDFCKAHG  820
              C KSA+G TDFC  HGGGKRC +  GC K A+G +  C AHG
Sbjct  130   GCGKSAQGSTDFCKAHGGGKRCAWSAGCEKFARGRSGLCSAHG  172



>gb|EMS58002.1| hypothetical protein TRIUR3_23027 [Triticum urartu]
Length=1033

 Score =   291 bits (744),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 168/222 (76%), Gaps = 14/222 (6%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  G+CI+HGGGRRCQYP C+KGAQG T+FCK+HGGGKR
Sbjct  318   LCIKHGGGKRCMTEGCTRSAEGYPGVCIAHGGGRRCQYPDCSKGAQGGTLFCKSHGGGKR  377

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C+ EGCTKGAEGST  CKGHGGGKRCLF+G   CPKSVHGGT +CV HGGGKRC    CT
Sbjct  378   CVSEGCTKGAEGSTLLCKGHGGGKRCLFEGDAACPKSVHGGTSFCVVHGGGKRCVAPGCT  437

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W             C
Sbjct  438   KSARGRTDCCVRHGGGKRCKSDGCDKSAQGSTDFCKAHGGGKRCAW----------SAGC  487

Query  756   NSFARGKTGLCASHGALVQDKR----VHGGATLGVVVQEITP  643
             + FARG++GLC++HG L   K+    +  G   G+V    TP
Sbjct  488   DKFARGRSGLCSAHGNLTASKQTGSMIGHGLFSGIVSSSSTP  529


 Score =   172 bits (437),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 123/213 (58%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K   G SGLCISHGGG RCQ P C KGA+    +CK+HGGGKRC   GCTK
Sbjct  226   KKCRFNGCSKGGRGASGLCISHGGGHRCQKPGCNKGAESRMAYCKSHGGGKRCQELGCTK  285

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG RC   G   C K+  G +  C+ HGGGKRC    CT+SA G   
Sbjct  286   SAEGKTEFCIAHGGGHRC---GVPECSKAARGRSGLCIKHGGGKRCMTEGCTRSAEGYPG  342

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+  C K AQG T FCK+HGGGKRC          +G   C   A G T
Sbjct  343   VCIAHGGGRRCQYPDCSKGAQGGTLFCKSHGGGKRC--------VSEG---CTKGAEGST  391

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  VV
Sbjct  392   LLCKGHGGGKRCLFEGDAACPKSVHGGTSFCVV  424



>ref|XP_008676922.1| PREDICTED: uncharacterized protein LOC100275699 isoform X1 [Zea 
mays]
 ref|XP_008676923.1| PREDICTED: uncharacterized protein LOC100275699 isoform X1 [Zea 
mays]
 gb|ACN25597.1| unknown [Zea mays]
 gb|ACN28043.1| unknown [Zea mays]
 gb|AFW65862.1| hypothetical protein ZEAMMB73_246691 [Zea mays]
Length=608

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+K NCTKSAEG SG+CI+HGGGRRCQY  C KGAQGST FCKAHGGGKR
Sbjct  323   LCIKHGGGKRCEKPNCTKSAEGRSGMCIAHGGGRRCQYAGCGKGAQGSTSFCKAHGGGKR  382

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C    C+KGAEGST FCK HGGGKRC   G   C KSVHGGT +CVAHGGGKRC V  C 
Sbjct  383   CTRPDCSKGAEGSTAFCKAHGGGKRCSADG---CTKSVHGGTQFCVAHGGGKRCVVEGCR  439

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGR+D CV HGGGKRC   GCGKSAQGSTDFCK+HGGG+RC+WG      G G  PC
Sbjct  440   KSARGRSDRCVGHGGGKRCHSAGCGKSAQGSTDFCKSHGGGRRCWWGH----LGSGGAPC  495

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
             +  ARG+ GLC  H  LV D  VHGG + G
Sbjct  496   DRLARGRKGLCDRHNPLVDDNSVHGGVSFG  525


 Score =   190 bits (482),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 129/210 (61%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C+KGA+G T+FCKAHGGGKRC + GCTK
Sbjct  231   KICSHPGCAKGARGSSGRCIAHGGGRRCQKGGCSKGAEGKTIFCKAHGGGKRCEHLGCTK  290

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  291   SAEGRTDFCIAHGGGRRCSHEG---CKRAARGKSGLCIKHGGGKRCEKPNCTKSAEGRSG  347

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+ GCGK AQGST FCKAHGGGKRC               C+  A G T
Sbjct  348   MCIAHGGGRRCQYAGCGKGAQGSTSFCKAHGGGKRCT-----------RPDCSKGAEGST  396

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C +HG   +       K VHGG    V 
Sbjct  397   AFCKAHGGGKRCSADGCTKSVHGGTQFCVA  426



>ref|NP_001143197.1| uncharacterized protein LOC100275699 [Zea mays]
 gb|ACG29655.1| hypothetical protein [Zea mays]
Length=614

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+K NCTKSAEG SG+CI+HGGGRRCQY  C KGAQGST FCKAHGGGKR
Sbjct  329   LCIKHGGGKRCEKPNCTKSAEGRSGMCIAHGGGRRCQYAGCGKGAQGSTSFCKAHGGGKR  388

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C    C+KGAEGST FCK HGGGKRC   G   C KSVHGGT +CVAHGGGKRC V  C 
Sbjct  389   CTRPDCSKGAEGSTAFCKAHGGGKRCSADG---CTKSVHGGTQFCVAHGGGKRCVVEGCR  445

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGR+D CV HGGGKRC   GCGKSAQGSTDFCK+HGGG+RC+WG      G G  PC
Sbjct  446   KSARGRSDRCVGHGGGKRCHSAGCGKSAQGSTDFCKSHGGGRRCWWGH----VGSGGAPC  501

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLG  667
             +  ARG+ GLC  H  LV D  VHGG + G
Sbjct  502   DRLARGRKGLCDRHNPLVDDNSVHGGVSFG  531


 Score =   190 bits (482),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 129/210 (61%), Gaps = 20/210 (10%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K C    C K A G SG CI+HGGGRRCQ   C+KGA+G T+FCKAHGGGKRC + GCTK
Sbjct  237   KICSHPGCAKGARGSSGRCIAHGGGRRCQKGGCSKGAEGKTIFCKAHGGGKRCEHLGCTK  296

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA GR+ 
Sbjct  297   SAEGRTDFCIAHGGGRRCSHEG---CKRAARGKSGLCIKHGGGKRCEKPNCTKSAEGRSG  353

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ+ GCGK AQGST FCKAHGGGKRC               C+  A G T
Sbjct  354   MCIAHGGGRRCQYAGCGKGAQGSTSFCKAHGGGKRCT-----------RPDCSKGAEGST  402

Query  732   GLCASHGALVQ------DKRVHGGATLGVV  661
               C +HG   +       K VHGG    V 
Sbjct  403   AFCKAHGGGKRCSADGCTKSVHGGTQFCVA  432



>ref|XP_009125354.1| PREDICTED: probable WRKY transcription factor 19 [Brassica rapa]
Length=537

 Score =   278 bits (712),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 191/294 (65%), Gaps = 25/294 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+C +SAEG +GLCISHGGGRRCQ+   C KGAQG T +CKAHGGGK
Sbjct  246   LCIKHGGGKRCVIESCARSAEGQAGLCISHGGGRRCQFSSGCDKGAQGITNYCKAHGGGK  305

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC KGAEGSTP CK HGGGKRC  +GGG+C KSVHGGT +CVAHGGGKRC V+ C
Sbjct  306   RCIFSGCGKGAEGSTPLCKAHGGGKRCQSEGGGICSKSVHGGTNFCVAHGGGKRCVVSGC  365

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   CGKSAQGS + CKAHGGGKRC W       G GE  
Sbjct  366   TKSARGRTDCCVKHGGGKRCRVGECGKSAQGSGELCKAHGGGKRCCW-------GGGE--  416

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVV------VQEITPKRTENMKEIDTTEDM  598
             C  FARGK+GLCA H + V++KR  GG+  G++         +      +  E+   +  
Sbjct  417   CEKFARGKSGLCAKHNS-VKEKREDGGSKSGLIGPGLFSGLVVGSSSDHSQSEVSAIQLE  475

Query  597   DADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 M +   V+  +        S +  +    G        IPE RVHGG ++
Sbjct  476   KRQKMMIPMQVLVPS--------SMRSLSGSHEGETNMFDFMIPEERVHGGGMM  521


 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 126/208 (61%), Gaps = 9/208 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISH-GGGRRCQYPQCTKGAQGS-TMFCKAHGGGKRCIYEGC  1099
             K+C    C K A G SGLCISH GGG RCQ P C KG + S T FCK HGGGKRC + GC
Sbjct  151   KKCNFLGCMKGARGSSGLCISHGGGGERCQKPGCNKGTESSKTTFCKTHGGGKRCEHLGC  210

Query  1098  TKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGR  919
             TK AE  T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  C +SA G+
Sbjct  211   TKSAERKTDYCISHGGGRRCGFIKG--CDKAARGKSGLCIKHGGGKRCVIESCARSAEGQ  268

Query  918   TDFCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFA  745
                C+ HGGG+RCQF  GC K AQG T++CKAHGGGKRC +     +  +G  P C +  
Sbjct  269   AGLCISHGGGRRCQFSSGCDKGAQGITNYCKAHGGGKRCIF-SGCGKGAEGSTPLCKAHG  327

Query  744   RGKTGLCASHGALVQDKRVHGGATLGVV  661
              GK   C S G  +  K VHGG    V 
Sbjct  328   GGKR--CQSEGGGICSKSVHGGTNFCVA  353



>emb|CDY64841.1| BnaCnng45290D [Brassica napus]
Length=437

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 187/296 (63%), Gaps = 28/296 (9%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+C +SAEG +GLCISHGGGRRCQ+   C KGAQGST +CKAHGGGK
Sbjct  145   LCIKHGGGKRCVIESCARSAEGQAGLCISHGGGRRCQFSSGCDKGAQGSTNYCKAHGGGK  204

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI+ GC KGAEGSTP CK HGGGKRC+  GGGVC KSVHGGT +CVAHGGGKRC V+ C
Sbjct  205   RCIFSGCGKGAEGSTPLCKAHGGGKRCMADGGGVCSKSVHGGTNFCVAHGGGKRCVVSGC  264

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC    CGKSAQGS + CKAHGGGKRC WG      G G   
Sbjct  265   TKSARGRTDCCVKHGGGKRCVVGECGKSAQGSGELCKAHGGGKRCSWG------GGG---  315

Query  759   CNSFARGKTGLCASHGALVQDKR--------VHGGATLGVVVQEITPKRTENMKEIDTTE  604
             C  FARGK+GLCA H ++ +           +  G   G+V+   +      +  I   +
Sbjct  316   CEKFARGKSGLCAKHNSVKEKGGDGGSKSGLIGPGLFSGLVIGSSSDHSQSEVSAIQLEK  375

Query  603   DMDADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                   M +   V+  +        S +  +    G        IPE RVHGG ++
Sbjct  376   RQKM--MMIPMQVLVPS--------SMRSMSDSHEGETNVFDFMIPEERVHGGGMM  421


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 11/85 (13%)
 Frame = -3

Query  963  KRCA-VTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPS  787
            +RC  +  C K+ARG++  C++HGGGKRC  E C +SA+G    C +HGGG+RC      
Sbjct  127  RRCGFIKGCDKAARGKSGLCIKHGGGKRCVIESCARSAEGQAGLCISHGGGRRC------  180

Query  786  SEFGKGEIPCNSFARGKTGLCASHG  712
             +F  G   C+  A+G T  C +HG
Sbjct  181  -QFSSG---CDKGAQGSTNYCKAHG  201



>emb|CDX85802.1| BnaA02g00110D [Brassica napus]
Length=513

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 188/294 (64%), Gaps = 24/294 (8%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
             LCI+HGGGKRC  E+C +SAEG +GLCISHGGG+RCQ+   C KGAQG T +CKAHGGGK
Sbjct  221   LCIKHGGGKRCVIESCARSAEGQAGLCISHGGGKRCQFSSGCDKGAQGITNYCKAHGGGK  280

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             RCI  GC KGAEGSTP CK HGGGKRC  +GGG+C KSVHGGT +CVAHGGGKRC V+ C
Sbjct  281   RCILSGCGKGAEGSTPLCKAHGGGKRCQSEGGGICSKSVHGGTNFCVAHGGGKRCVVSGC  340

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP  760
             TKSARGRTD CV+HGGGKRC+   CGKSAQGS + CKAHGGGKRC WG        G   
Sbjct  341   TKSARGRTDCCVKHGGGKRCRVGECGKSAQGSGELCKAHGGGKRCCWG--------GGEC  392

Query  759   CNSFARGKTGLCASHGALVQDKRVHGGATLGVVVQ------EITPKRTENMKEIDTTEDM  598
             C  FARGK+GLCA H + V++K   GG+  G++         +      +  E+   +  
Sbjct  393   CEKFARGKSGLCAKHNS-VKEKGEDGGSKSGLIGPGLFSGLVVGSASDHSQSEVSAIQLE  451

Query  597   DADSMTVERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
                 M +   V+  +        S +  +    G        IPE RVHGG L+
Sbjct  452   KRQKMMIPMQVLVPS--------SMRSLSDSHEGETNMSDFMIPEERVHGGGLM  497


 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 125/208 (60%), Gaps = 9/208 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISH-GGGRRCQYPQCTKGAQGS-TMFCKAHGGGKRCIYEGC  1099
             K+C    C K A G SGLCISH GGG RCQ P C KG + S T FCK HGGGKRC + GC
Sbjct  126   KKCNFLGCMKGARGSSGLCISHGGGGERCQKPGCNKGTESSKTTFCKTHGGGKRCEHLGC  185

Query  1098  TKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGR  919
             TK AE  T +C  HGGG+RC F  G  C K+  G +  C+ HGGGKRC +  C +SA G+
Sbjct  186   TKSAERKTDYCISHGGGRRCGFVKG--CDKAARGKSGLCIKHGGGKRCVIESCARSAEGQ  243

Query  918   TDFCVRHGGGKRCQF-EGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIP-CNSFA  745
                C+ HGGGKRCQF  GC K AQG T++CKAHGGGKRC       +  +G  P C +  
Sbjct  244   AGLCISHGGGKRCQFSSGCDKGAQGITNYCKAHGGGKRCIL-SGCGKGAEGSTPLCKAHG  302

Query  744   RGKTGLCASHGALVQDKRVHGGATLGVV  661
              GK   C S G  +  K VHGG    V 
Sbjct  303   GGKR--CQSEGGGICSKSVHGGTNFCVA  328



>gb|EMT32954.1| hypothetical protein F775_16695 [Aegilops tauschii]
Length=696

 Score =   276 bits (707),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 164/236 (69%), Gaps = 34/236 (14%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC  E CT+SAEG  G+CI+HGGGRRCQ+P C+KGAQG T+FCK+HGGGKR
Sbjct  339   LCIKHGGGKRCMTEGCTRSAEGYPGVCIAHGGGRRCQFPDCSKGAQGGTLFCKSHGGGKR  398

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C+ EGCTKGAEGST  CKGHGGGKRCLF+G   CPKSVHGGT +CV HGGGKRCA   CT
Sbjct  399   CVSEGCTKGAEGSTLLCKGHGGGKRCLFEGDAACPKSVHGGTSFCVVHGGGKRCAAPGCT  458

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKG----  769
             KSARGRTD CVRHGGGKRC+ +GC KSAQGSTDFCKAHGGGKRC W     + G+     
Sbjct  459   KSARGRTDCCVRHGGGKRCKSDGCDKSAQGSTDFCKAHGGGKRCAWSAGWPKHGRAWPLQ  518

Query  768   ------------------------------EIPCNSFARGKTGLCASHGALVQDKR  691
                                              C  FARG++GLC++HG L   K+
Sbjct  519   RDRRLFFLDGGQRHGPCDLFFYGGGKRCAWSAGCEKFARGRSGLCSAHGNLTASKQ  574


 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 122/213 (57%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C+K   G SGLCISHGGG RCQ P C KGA+  T +CK+HGGGKRC   GCTK
Sbjct  247   KKCRFNGCSKGGRGASGLCISHGGGHRCQKPGCNKGAESRTAYCKSHGGGKRCQELGCTK  306

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG RC  Q    C K+  G +  C+ HGGGKRC    CT+SA G   
Sbjct  307   SAEGKTEFCIAHGGGHRCGVQ---ECSKAARGRSGLCIKHGGGKRCMTEGCTRSAEGYPG  363

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQG T FCK+HGGGKRC               C   A G T
Sbjct  364   VCIAHGGGRRCQFPDCSKGAQGGTLFCKSHGGGKRCV-----------SEGCTKGAEGST  412

Query  732   GLCASHGA----LVQ-----DKRVHGGATLGVV  661
              LC  HG     L +      K VHGG +  VV
Sbjct  413   LLCKGHGGGKRCLFEGDAACPKSVHGGTSFCVV  445



>gb|EYU18510.1| hypothetical protein MIMGU_mgv1a003824mg [Erythranthe guttata]
Length=561

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 185/302 (61%), Gaps = 54/302 (18%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E C +SAEG  GLCISHGGGRRCQ+  C KGAQGSTMFCKAHGGGKR
Sbjct  275   LCIKHGGGKRCKVEGCARSAEGQIGLCISHGGGRRCQFLGCVKGAQGSTMFCKAHGGGKR  334

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ G                    CLF GGG+CPKSVHGGT +CVAHGGGKRC+V DCT
Sbjct  335   CIFTG--------------------CLFDGGGICPKSVHGGTSFCVAHGGGKRCSVPDCT  374

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
             KSARGRTD CV+HGGGKRC+ E CGKSAQGSTDFCKAHGGGKRC WG        GE  C
Sbjct  375   KSARGRTDCCVKHGGGKRCRSENCGKSAQGSTDFCKAHGGGKRCNWG--------GEGKC  426

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATL------GVVVQEITPKRTENMKEIDTTEDMD  595
               FARGK+GLCA+H  +V  + V     +      G+V   +     EN     ++  + 
Sbjct  427   EKFARGKSGLCAAHSTMVSGREVKRSGMIGPGLFHGLVPAGVCSSSYENNTCSSSSVTVI  486

Query  594   ADSM-TVERSVVTSANGSDWKYISFKQATMPI-------------LGSPPSIPVTIPEGR  457
             +DS+ +VER           + +   Q  +P+             LGS   +   +PEGR
Sbjct  487   SDSIGSVER------QAKRQRLMIPPQVLVPLSMKGSSSSSYSKQLGSEKGVEFVVPEGR  540

Query  456   VH  451
             VH
Sbjct  541   VH  542


 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 124/192 (65%), Gaps = 5/192 (3%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R G  K+C+ + C K A G +GLCI HGGG+RCQ P C+KGA+  T +CKAHGGG+RC  
Sbjct  177   RGGTTKKCKFDGCVKGARGATGLCIGHGGGQRCQKPGCSKGAESRTAYCKAHGGGRRCEE  236

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T  C  HGGGKRC + GG  C K+  G +  C+ HGGGKRC V  C +SA
Sbjct  237   LGCTKSAEGKTDHCIAHGGGKRCGYAGG--CTKAARGRSGLCIKHGGGKRCKVEGCARSA  294

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G+   C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +      F  G I C   
Sbjct  295   EGQIGLCISHGGGRRCQFLGCVKGAQGSTMFCKAHGGGKRCIF--TGCLFDGGGI-CPKS  351

Query  747   ARGKTGLCASHG  712
               G T  C +HG
Sbjct  352   VHGGTSFCVAHG  363



>ref|XP_006648777.1| PREDICTED: uncharacterized protein LOC102711408 [Oryza brachyantha]
Length=608

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI+HGGGKRC  E C +SAEG  GLCISHGGGRRCQ+P C KGAQGST++CKAHGGGKRC
Sbjct  337   CIKHGGGKRCSVEGCIRSAEGRVGLCISHGGGRRCQFPDCRKGAQGSTLYCKAHGGGKRC  396

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
             +++GC KGAEGSTP CK HGGGKRC+F+GGG+CPKSVHGGT +CVAHGGGKRC V  CTK
Sbjct  397   VFDGCMKGAEGSTPLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVAHGGGKRCTVAGCTK  456

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKR  808
             SARGRT+ CV+HGGGKRC+ +GC KSAQGST+FCKAHGGGKR
Sbjct  457   SARGRTNCCVKHGGGKRCKVDGCAKSAQGSTEFCKAHGGGKR  498


 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 128/213 (60%), Gaps = 23/213 (11%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+ + C+K A G SGLCI+HGGG+RCQ P C KGA+  T +CKAHGGG+RC+  GCTK
Sbjct  244   KKCRFKGCSKGARGASGLCIAHGGGQRCQKPGCHKGAESRTAYCKAHGGGRRCMQLGCTK  303

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              A GS       GGG+RC  QG   CPK+  G +  C+ HGGGKRC+V  C +SA GR  
Sbjct  304   SAGGSASPPPARGGGRRCGHQG---CPKAARGKSGRCIKHGGGKRCSVEGCIRSAEGRVG  360

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF  C K AQGST +CKAHGGGKRC +             C   A G T
Sbjct  361   LCISHGGGRRCQFPDCRKGAQGSTLYCKAHGGGKRCVFDG-----------CMKGAEGST  409

Query  732   GLCASHGALVQ---------DKRVHGGATLGVV  661
              LC +HG   +          K VHGG +  V 
Sbjct  410   PLCKAHGGGKRCMFEGGGLCPKSVHGGTSFCVA  442



>emb|CDX81227.1| BnaC09g06380D [Brassica napus]
Length=535

 Score =   254 bits (650),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI+HGGGKRC+ E C +SAEG +GLCISHGGGRRCQ   CTKGAQGST +CK HGGGKR
Sbjct  280   LCIKHGGGKRCRVEGCKRSAEGQAGLCISHGGGRRCQSLDCTKGAQGSTNYCKGHGGGKR  339

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             CI+ GCTKGAEGSTP CK HGGGKRC+F GGG+C KSVHG T +CVAHGGGKRC    CT
Sbjct  340   CIFGGCTKGAEGSTPLCKAHGGGKRCMFDGGGICSKSVHGATSFCVAHGGGKRCVAVGCT  399

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWG  796
             KSARG+TD CV+HGGGKRC+  GC KS QGST+ CKAHGGGKRC WG
Sbjct  400   KSARGKTDCCVKHGGGKRCKCLGCEKSVQGSTELCKAHGGGKRCSWG  446


 Score =   177 bits (448),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 119/187 (64%), Gaps = 13/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K+C+   C K A G SGLCI HGGG+RC+ P C KGA+ +T FCKAHGGGKRC + GCTK
Sbjct  187   KKCRFIGCAKGARGASGLCIGHGGGQRCKKPGCNKGAESTTTFCKAHGGGKRCQHLGCTK  246

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC F  G  C K+    +  C+ HGGGKRC V  C +SA G+  
Sbjct  247   SAEGKTDFCISHGGGRRCGFPEG--CGKAARDKSGLCIKHGGGKRCRVEGCKRSAEGQAG  304

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQ   C K AQGST++CK HGGGKRC +G            C   A G T
Sbjct  305   LCISHGGGRRCQSLDCTKGAQGSTNYCKGHGGGKRCIFGG-----------CTKGAEGST  353

Query  732   GLCASHG  712
              LC +HG
Sbjct  354   PLCKAHG  360



>ref|XP_006385779.1| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
 gb|ERP63576.1| hypothetical protein POPTR_0003s13400g [Populus trichocarpa]
Length=502

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  356   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  415

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GC+KGAEGSTPFCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCA  +CT
Sbjct  416   CTAPGCSKGAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAAPECT  475

Query  936   KSARGRTDFCVRHGGGKRCQ  877
             KSARGRT FCVRHGGGKRC 
Sbjct  476   KSARGRTQFCVRHGGGKRCN  495


 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 131/206 (64%), Gaps = 9/206 (4%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRC+   C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  264   KLCQVEGCGKGARGASGRCISHGGGRRCRKAGCLKGAEGRTVYCKAHGGGRRCEFLGCTK  323

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  324   SAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  380

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC      S+  +G  P   F +G  
Sbjct  381   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCT-APGCSKGAEGSTP---FCKGHG  436

Query  732   G--LCASHGALVQDKRVHGGATLGVV  661
             G   CA  G  V  K VHGG    V 
Sbjct  437   GGKRCAFQGGGVCTKSVHGGTNFCVA  462


 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 116/172 (67%), Gaps = 8/172 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI HGGG+RC  E CT++A G SGLCI HGGG+RCQ   CTK A+G +  C +HGGG+R
Sbjct  331   FCIAHGGGRRCSHEGCTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRR  390

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD--  943
             C + GCTKGA+GST FCK HGGGKRC   G   C K   G T +C  HGGGKRCA     
Sbjct  391   CQFLGCTKGAQGSTMFCKAHGGGKRCTAPG---CSKGAEGSTPFCKGHGGGKRCAFQGGG  447

Query  942   -CTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC--YWG  796
              CTKS  G T+FCV HGGGKRC    C KSA+G T FC  HGGGKRC   WG
Sbjct  448   VCTKSVHGGTNFCVAHGGGKRCAAPECTKSARGRTQFCVRHGGGKRCNQVWG  499


 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 120/197 (61%), Gaps = 17/197 (9%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             C  HGGG+RC+   CTKSAEG +  CI+HGGGRRC +  CT+ A+G +  C  HGGGKRC
Sbjct  307   CKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHEGCTRAARGKSGLCIRHGGGKRC  366

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
               E CTK AEG +  C  HGGG+RC F G   C K   G T++C AHGGGKRC    C+K
Sbjct  367   QKENCTKSAEGLSGLCISHGGGRRCQFLG---CTKGAQGSTMFCKAHGGGKRCTAPGCSK  423

Query  933   SARGRTDFCVRHGGGKRCQFEG---CGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI  763
              A G T FC  HGGGKRC F+G   C KS  G T+FC AHGGGKRC   +          
Sbjct  424   GAEGSTPFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAAPE----------  473

Query  762   PCNSFARGKTGLCASHG  712
              C   ARG+T  C  HG
Sbjct  474   -CTKSARGRTQFCVRHG  489


 Score =   179 bits (455),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 122/194 (63%), Gaps = 11/194 (6%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RC+K  C K AEG +  C +HGGGRRC++  CTK A+G T FC AHGGG+RC
Sbjct  282   CISHGGGRRCRKAGCLKGAEGRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRC  341

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +EGCT+ A G +  C  HGGGKRC  +    C KS  G +  C++HGGG+RC    CTK
Sbjct  342   SHEGCTRAARGKSGLCIRHGGGKRCQKEN---CTKSAEGLSGLCISHGGGRRCQFLGCTK  398

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
              A+G T FC  HGGGKRC   GC K A+GST FCK HGGGKRC +        +G   C 
Sbjct  399   GAQGSTMFCKAHGGGKRCTAPGCSKGAEGSTPFCKGHGGGKRCAF--------QGGGVCT  450

Query  753   SFARGKTGLCASHG  712
                 G T  C +HG
Sbjct  451   KSVHGGTNFCVAHG  464



>ref|XP_010239444.1| PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 
19 [Brachypodium distachyon]
Length=477

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 161/243 (66%), Gaps = 12/243 (5%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             +CI+HGGGK CQ+++C+K AEG S LCI+HGGG RCQ+  C KG++GST FCK HGGGKR
Sbjct  242   VCIKHGGGKSCQQKDCSKIAEGRSCLCIAHGGGCRCQHDGCGKGSRGSTAFCKVHGGGKR  301

Query  1116  CIY-EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             C +   C KG  GSTPFCKGHGGGKRC   G   C K VHGGT +C+A GGG+R  V  C
Sbjct  302   CRHPNDCXKGCRGSTPFCKGHGGGKRCTGHG---CTKCVHGGTQFCLALGGGQRFVVEGC  358

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGK---SAQGSTDFCKAHGGGKRCYWGQPSSEFGKG  769
             TK+ RGRTD CV HGGGKRC+  GC K   + + + DFCKAHGGGKRC WG P S+   G
Sbjct  359   TKNTRGRTDRCVGHGGGKRCRHSGCDKIIRAHREANDFCKAHGGGKRCLWGHPGSDLAVG  418

Query  768   EIPCNSFARGKTGLCASHGA-LVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDA  592
                 +  ARGK G+CA H   L+ D R+HGG  LG     I   R   + +  +  ++  
Sbjct  419   GX--DLLARGKNGMCARHNPLLLDDDRIHGGQKLGDFRVTINAAR--ELGDCPSNAEISK  474

Query  591   DSM  583
             D++
Sbjct  475   DNI  477


 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 122/212 (58%), Gaps = 16/212 (8%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGKRCIYEGCT  1096
             K C    C K A G S  CI+HGGG RC + + C+KGA+G T+FCKAHG G+RC   GCT
Sbjct  145   KVCSHPGCIKGARGSSRRCIAHGGGGRCHHKEGCSKGAEGKTIFCKAHGRGRRCENLGCT  204

Query  1095  KGAEGSTPFCKGHGGG--KRCLFQGGGVCPKSVHG--GTLYCVAHGGGKRCAVTDCTKSA  928
             K  EG T FC  HGGG    C+ +    C ++  G  GT  C+ HGGGK C   DC+K A
Sbjct  205   KNGEGRTDFCIVHGGGPVSTCINE---RCRRASRGKSGTCVCIKHGGGKSCQQKDCSKIA  261

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              GR+  C+ HGGG RCQ +GCGK ++GST FCK HGGGKRC       +  +G  P   F
Sbjct  262   EGRSCLCIAHGGGCRCQHDGCGKGSRGSTAFCKVHGGGKRCRHPNDCXKGCRGSTP---F  318

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVVV  658
              +G  G   C  HG     K VHGG    + +
Sbjct  319   CKGHGGGKRCTGHGCT---KCVHGGTQFCLAL  347



>emb|CDY51293.1| BnaA06g23530D [Brassica napus]
Length=549

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 146/214 (68%), Gaps = 16/214 (7%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQ-CTKGAQGSTMFCKAHGGGK  1120
              C  HGGGKRCQ   CTKSAEG +  CISHGGGRRC +P+ C K A+G +  C  HGGGK
Sbjct  230   FCKAHGGGKRCQHLGCTKSAEGKTDFCISHGGGRRCGFPEGCGKAARGKSGLCIKHGGGK  289

Query  1119  RCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD-  943
             RC  EGCT+ AEG    C  HGGG+RC   G   C K   G T YC AHGGGKRC     
Sbjct  290   RCRIEGCTRSAEGQAGLCISHGGGRRCQSPG---CTKGAQGSTNYCKAHGGGKRCIFAGW  346

Query  942   CTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEI  763
             CTKSARGRTD CV+HGGGKRC+  GC KSAQGSTDFCKAHGGGKRC WG        G+ 
Sbjct  347   CTKSARGRTDCCVKHGGGKRCKSIGCEKSAQGSTDFCKAHGGGKRCSWG--------GDW  398

Query  762   PCNSFARGKTGLCASHGALVQDKRVHGGATLGVV  661
              C  FARGK+GLCA+H ++ Q+K   GG+ +G++
Sbjct  399   KCEKFARGKSGLCAAHNSMAQEK---GGSKIGLI  429



>gb|KDO76383.1| hypothetical protein CISIN_1g011430mg [Citrus sinensis]
 gb|KDO76384.1| hypothetical protein CISIN_1g011430mg [Citrus sinensis]
Length=486

 Score =   223 bits (567),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C   GCTKGAEGST FCKGHGGGKRC FQGGGVC KSVHGGT +CVAHGGGKRCAV +CT
Sbjct  420   CTAPGCTKGAEGSTSFCKGHGGGKRCAFQGGGVCTKSVHGGTNFCVAHGGGKRCAVPECT  479

Query  936   KSARGRT  916
             KSARGR 
Sbjct  480   KSARGRN  486


 Score =   187 bits (474),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 130/211 (62%), Gaps = 9/211 (4%)
 Frame = -3

Query  1287  RHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIY  1108
             R    K CQ E C K A G SG CISHGGGRRCQ   C KGA+G T++CKAHGGG+RC Y
Sbjct  263   RSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLGCHKGAEGRTVYCKAHGGGRRCEY  322

Query  1107  EGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSA  928
              GCTK AEG T +C  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA
Sbjct  323   LGCTKSAEGRTDYCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSA  379

Query  927   RGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSF  748
              G +  C+ HGGG+RCQ  GC K AQGST FCKAHGGGKRC     +    KG     SF
Sbjct  380   EGLSGLCISHGGGRRCQASGCTKGAQGSTMFCKAHGGGKRCT----APGCTKGAEGSTSF  435

Query  747   ARGKTG--LCASHGALVQDKRVHGGATLGVV  661
              +G  G   CA  G  V  K VHGG    V 
Sbjct  436   CKGHGGGKRCAFQGGGVCTKSVHGGTNFCVA  466


 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 123/194 (63%), Gaps = 11/194 (6%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK  C K AEG +  C +HGGGRRC+Y  CTK A+G T +C AHGGG+RC
Sbjct  286   CISHGGGRRCQKLGCHKGAEGRTVYCKAHGGGRRCEYLGCTKSAEGRTDYCIAHGGGRRC  345

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +EGCT+ A G +  C  HGGGKRC  +    C KS  G +  C++HGGG+RC  + CTK
Sbjct  346   SHEGCTRAARGKSGLCIRHGGGKRCQKEN---CTKSAEGLSGLCISHGGGRRCQASGCTK  402

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
              A+G T FC  HGGGKRC   GC K A+GST FCK HGGGKRC +        +G   C 
Sbjct  403   GAQGSTMFCKAHGGGKRCTAPGCTKGAEGSTSFCKGHGGGKRCAF--------QGGGVCT  454

Query  753   SFARGKTGLCASHG  712
                 G T  C +HG
Sbjct  455   KSVHGGTNFCVAHG  468


 Score =   165 bits (418),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 103/152 (68%), Gaps = 6/152 (4%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RC  E CT++A G SGLCI HGGG+RCQ   CTK A+G +  C +HGGG+RC
Sbjct  336   CIAHGGGRRCSHEGCTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRC  395

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD---  943
                GCTKGA+GST FCK HGGGKRC   G   C K   G T +C  HGGGKRCA      
Sbjct  396   QASGCTKGAQGSTMFCKAHGGGKRCTAPG---CTKGAEGSTSFCKGHGGGKRCAFQGGGV  452

Query  942   CTKSARGRTDFCVRHGGGKRCQFEGCGKSAQG  847
             CTKS  G T+FCV HGGGKRC    C KSA+G
Sbjct  453   CTKSVHGGTNFCVAHGGGKRCAVPECTKSARG  484


 Score =   118 bits (296),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITQQHQRLQRSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKLG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTD+C+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEYLGCTKSAEGRTDYCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390



>emb|CDY08361.1| BnaC09g12350D [Brassica napus]
Length=597

 Score =   216 bits (551),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/287 (48%), Positives = 159/287 (55%), Gaps = 58/287 (20%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  348   LCIRHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSSGCTKGAQGSTMFCKAHGGGKR  407

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCT  937
             C + GCTKGAEGSTPFCKGHGGGKRC FQ G  C KSVHGGT +CVAHGGGKRC V    
Sbjct  408   CTHPGCTKGAEGSTPFCKGHGGGKRCAFQEGHPCSKSVHGGTNFCVAHGGGKRCTVE---  464

Query  936   KSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPC  757
                            G+    +  GK+ +    F +    G              G IP 
Sbjct  465   ---------------GRDASLKDVGKARKAVLTFARRMEEGSVVL----------GVIPR  499

Query  756   NSFARGKTGLCASHGALVQDKRVHGGATLGVVVQEITPKRTENMKEIDTTEDMDADSMTV  577
              S               ++D RVHGG T  V  +   P+ + + +E   ++DM+ D M  
Sbjct  500   LS---------------MRDNRVHGGMT--VTSESQDPRVSSSEEEFSGSQDMNMDRMKA  542

Query  576   ERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
               +V +     D             L    +     PEGRVHGGSL+
Sbjct  543   RSAVGSPETDID-------------LNENETGSGLAPEGRVHGGSLI  576


 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 82/143 (57%), Gaps = 14/143 (10%)
 Frame = -3

Query  1140  KAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGK  961
             K+    K C  EGC KGA G++  C  HGGG+RC   G   C K   G T+YC AHGGG+
Sbjct  250   KSSSSSKLCQVEGCQKGARGASGRCISHGGGRRCQRHG---CHKGAEGRTVYCKAHGGGR  306

Query  960   RCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSE  781
             RC    CTKSA GRTDFC+ HGGG+RC  E C ++A+G +  C  HGGGKRC        
Sbjct  307   RCEFLGCTKSAEGRTDFCIAHGGGRRCSHEDCTRAARGRSGLCIRHGGGKRCQREN----  362

Query  780   FGKGEIPCNSFARGKTGLCASHG  712
                    C   A G +GLC SHG
Sbjct  363   -------CTKSAEGLSGLCISHG  378


 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 67/121 (55%), Gaps = 14/121 (12%)
 Frame = -3

Query  1074  PFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHG  895
             P  K     K C  +G   C K   G +  C++HGGG+RC    C K A GRT +C  HG
Sbjct  247   PQHKSSSSSKLCQVEG---CQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHG  303

Query  894   GGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASH  715
             GG+RC+F GC KSA+G TDFC AHGGG+RC               C   ARG++GLC  H
Sbjct  304   GGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHED-----------CTRAARGRSGLCIRH  352

Query  714   G  712
             G
Sbjct  353   G  353



>emb|CBI32953.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 156/267 (58%), Gaps = 30/267 (11%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             ++C++  CTKGA+G++  C  HGGG+RC   GC KGAE  T +CK HGGG+RC   G   
Sbjct  189   KKCKFMDCTKGARGASGLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLG---  245

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C KS  G T +C+AHGGG+RC+V  CTKSARGRTD CV+HGGGKRC+FE CGKSAQGSTD
Sbjct  246   CTKSAEGKTNFCIAHGGGRRCSVPGCTKSARGRTDCCVKHGGGKRCKFENCGKSAQGSTD  305

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHGALVQDKRVHGGATLGV-V  661
             FCKAHGGGKRC WG+     GK    C  FARGK+GLCA+H +LVQ++    G  +G  +
Sbjct  306   FCKAHGGGKRCSWGE-----GK----CEKFARGKSGLCAAHSSLVQERETKKGGMIGPGL  356

Query  660   VQEITPKRTEN-MKEIDTTEDMDADSMTVERSVVTSANGSDWKYISFKQATMPILG----  496
                + P  T       D         ++   + +  A+    + +   Q  +P+      
Sbjct  357   FHGLVPTATSTGGSSFDNNSSSGVSVISDCINSLEKASKRRQQQLIPPQVLVPLSMKSSS  416

Query  495   ------------SPPSIPVTIPEGRVH  451
                         S   + + IPEGRVH
Sbjct  417   SYSSSNNTAGGKSFNMMMMMIPEGRVH  443


 Score =   136 bits (342),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 87/135 (64%), Gaps = 5/135 (4%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCI HGGG+RCQK  C K AE  +  C +HGGGRRCQ   CTK A+G T FC AHGGG+R
Sbjct  206   LCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQQLGCTKSAEGKTNFCIAHGGGRR  265

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD--  943
             C   GCTK A G T  C  HGGGKRC F+    C KS  G T +C AHGGGKRC+  +  
Sbjct  266   CSVPGCTKSARGRTDCCVKHGGGKRCKFEN---CGKSAQGSTDFCKAHGGGKRCSWGEGK  322

Query  942   CTKSARGRTDFCVRH  898
             C K ARG++  C  H
Sbjct  323   CEKFARGKSGLCAAH  337



>emb|CDY25558.1| BnaC09g11830D [Brassica napus]
Length=386

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 135/288 (47%), Positives = 171/288 (59%), Gaps = 27/288 (9%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQ+  C K AEG +  C +HGGGRRC++  CTK A+G T FC AHGGG+RC
Sbjct  103   CISHGGGRRCQRHGCHKGAEGRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRC  162

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +E CT+ A G +  C  HGGGKRC  +    C KS  G +  C++HGGG+RC  + CTK
Sbjct  163   SHEDCTRAARGRSGLCIRHGGGKRCQRED---CTKSAEGLSGLCISHGGGRRCQSSGCTK  219

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCN  754
              A+G T FC  HGGGKRC   GC K A+GST FCK HGGGKRC        F +G+ PC 
Sbjct  220   GAQGSTMFCKAHGGGKRCTHPGCTKGAEGSTPFCKGHGGGKRCA-------FQEGD-PC-  270

Query  753   SFARGKTGLCASHGALVQDKRVHGGATLGVVVQE--ITPKRTENMKEIDTTEDMDADSMT  580
             S + G   L       ++D RVHGG T+    QE  ++   TEN +E   ++DM+ D+M 
Sbjct  271   SKSVGSVVLGVIPRLSMRDNRVHGGMTVTSESQEPRVSSSETENEEEFSGSQDMNMDTMK  330

Query  579   VERSVVTSANGSDWKYISFKQATMPILGSPPSIPVTIPEGRVHGGSLL  436
              ERS V S   +D     ++      LG         PEGRVHGGSL+
Sbjct  331   -ERSAVGSPE-TDIDLNEYEAG----LG-------LAPEGRVHGGSLI  365


 Score =   169 bits (427),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQ+E+CTKSAEGLSGLCISHGGGRRCQ   CTKGAQGSTMFCKAHGGGKR
Sbjct  177   LCIRHGGGKRCQREDCTKSAEGLSGLCISHGGGRRCQSSGCTKGAQGSTMFCKAHGGGKR  236

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSV  1003
             C + GCTKGAEGSTPFCKGHGGGKRC FQ G  C KSV
Sbjct  237   CTHPGCTKGAEGSTPFCKGHGGGKRCAFQEGDPCSKSV  274


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 65/112 (58%), Gaps = 14/112 (13%)
 Frame = -3

Query  1047  KRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEG  868
             K C  +G   C K   G +  C++HGGG+RC    C K A GRT +C  HGGG+RC+F G
Sbjct  85    KLCQVEG---CQKGARGASGRCISHGGGRRCQRHGCHKGAEGRTVYCKAHGGGRRCEFLG  141

Query  867   CGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             C KSA+G TDFC AHGGG+RC               C   ARG++GLC  HG
Sbjct  142   CTKSAEGRTDFCIAHGGGRRCS-----------HEDCTRAARGRSGLCIRHG  182



>ref|XP_007040391.1| F22C12.10, putative isoform 2 [Theobroma cacao]
 ref|XP_007040392.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY24892.1| F22C12.10, putative isoform 2 [Theobroma cacao]
 gb|EOY24893.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=539

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -3

Query  1272  KRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTK  1093
             K CQ E C K A G SG CISHGGGRRCQ P C KGA+G T++CKAHGGG+RC + GCTK
Sbjct  268   KTCQVEGCGKGARGASGRCISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTK  327

Query  1092  GAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTD  913
              AEG T FC  HGGG+RC  +G   C ++  G +  C+ HGGGKRC   +CTKSA G + 
Sbjct  328   SAEGRTDFCIAHGGGRRCSHEG---CTRAARGKSGLCIRHGGGKRCQKENCTKSAEGLSG  384

Query  912   FCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKT  733
              C+ HGGG+RCQF GC K AQGST FCKAHGGGKRC +             C   A G T
Sbjct  385   LCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKRCTYPD-----------CTKGAEGST  433

Query  732   GLCASHG  712
               C  HG
Sbjct  434   PFCKGHG  440


 Score =   180 bits (456),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 113/165 (68%), Gaps = 3/165 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK  C K AEG +  C +HGGGRRC++  CTK A+G T FC AHGGG+RC
Sbjct  286   CISHGGGRRCQKPGCHKGAEGRTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRC  345

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +EGCT+ A G +  C  HGGGKRC  +    C KS  G +  C++HGGG+RC    CTK
Sbjct  346   SHEGCTRAARGKSGLCIRHGGGKRCQKEN---CTKSAEGLSGLCISHGGGRRCQFLGCTK  402

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW  799
              A+G T FC  HGGGKRC +  C K A+GST FCK HGGGKRC +
Sbjct  403   GAQGSTMFCKAHGGGKRCTYPDCTKGAEGSTPFCKGHGGGKRCAF  447


 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
             LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQ+  CTKGAQGSTMFCKAHGGGKR
Sbjct  360   LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQFLGCTKGAQGSTMFCKAHGGGKR  419

Query  1116  CIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             C Y  CTKGAEGSTPFCKGHGGGKRC FQGGGV
Sbjct  420   CTYPDCTKGAEGSTPFCKGHGGGKRCAFQGGGV  452


 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 97/147 (66%), Gaps = 3/147 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             C  HGGG+RC+   CTKSAEG +  CI+HGGGRRC +  CT+ A+G +  C  HGGGKRC
Sbjct  311   CKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHEGCTRAARGKSGLCIRHGGGKRC  370

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
               E CTK AEG +  C  HGGG+RC F G   C K   G T++C AHGGGKRC   DCTK
Sbjct  371   QKENCTKSAEGLSGLCISHGGGRRCQFLG---CTKGAQGSTMFCKAHGGGKRCTYPDCTK  427

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSA  853
              A G T FC  HGGGKRC F+G G  A
Sbjct  428   GAEGSTPFCKGHGGGKRCAFQGGGVYA  454


 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = -3

Query  1176  CTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHG  997
             CT G        +     K C  EGC KGA G++  C  HGGG+RC   G   C K   G
Sbjct  250   CTSGITRQQQPQQRSSSSKTCQVEGCGKGARGASGRCISHGGGRRCQKPG---CHKGAEG  306

Query  996   GTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGG  817
              T+YC AHGGG+RC    CTKSA GRTDFC+ HGGG+RC  EGC ++A+G +  C  HGG
Sbjct  307   RTVYCKAHGGGRRCEFLGCTKSAEGRTDFCIAHGGGRRCSHEGCTRAARGKSGLCIRHGG  366

Query  816   GKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             GKRC            +  C   A G +GLC SHG
Sbjct  367   GKRCQ-----------KENCTKSAEGLSGLCISHG  390


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 67/147 (46%), Gaps = 32/147 (22%)
 Frame = -1

Query  1103  GVQRVQKGAHHFARAMVEGKDVYSKEVGFAQKVCTEGL-----FTV*HMGAVRDVL*PIA  939
             G  +  +G+  F +A   GK     +       CT+G      F   H G  R       
Sbjct  399   GCTKGAQGSTMFCKAHGGGKRCTYPD-------CTKGAEGSTPFCKGHGGGKRCAF----  447

Query  938   QRVQGAGLIFVCVMVGARDASLKVVEKVLREALIFARHMVEGKDAIGASLVLNLAKVKFL  759
                QG G+           ASLK V KV + A I ARHMVEG+DA G  L  N+A + FL
Sbjct  448   ---QGGGVY----------ASLKGVAKVHKVARISARHMVEGRDAPGVILDQNMA-INFL  493

Query  758   VIHLP--GERQGFVHLMVLWFRINGFM  684
             V+  P  G RQ  VH  V WFRI GFM
Sbjct  494   VLVTPLQGARQDSVHSTVAWFRIRGFM  520



>ref|NP_001154222.1| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
 gb|AEE83086.1| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
Length=1879

 Score =   188 bits (477),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK +C K AEG +  C +HGGGRRC+Y  CTKGA+GST FC AHGGG+RC
Sbjct  109   CISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGSTDFCIAHGGGRRC  168

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +E CT+ A G T FC  HGGG RC   G   C KS  G   +C AHGGGK+C+  DCT 
Sbjct  169   NHEDCTRSAWGRTEFCVKHGGGARCKTYG---CGKSASGPLPFCRAHGGGKKCSHEDCTG  225

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
              ARGR+  C+ HGGGKRCQ E C KSA+G +  C +HGGG+RC
Sbjct  226   FARGRSGLCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRC  268


 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+ ++  C +HGGG+RC    C KGAEG T +CK HGGG+RC + G   
Sbjct  91    KLCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLG---  147

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C K   G T +C+AHGGG+RC   DCT+SA GRT+FCV+HGGG RC+  GCGKSA G   
Sbjct  148   CTKGAEGSTDFCIAHGGGRRCNHEDCTRSAWGRTEFCVKHGGGARCKTYGCGKSASGPLP  207

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             FC+AHGGGK+C     S E       C  FARG++GLC  HG
Sbjct  208   FCRAHGGGKKC-----SHE------DCTGFARGRSGLCLMHG  238


 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKA  1135
             LC+ HGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGA+GS MFCKA
Sbjct  233   LCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSIGCTKGAKGSKMFCKA  286



>ref|NP_001118968.1| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
 sp|Q9SZ67.1|WRK19_ARATH RecName: Full=Probable WRKY transcription factor 19; AltName: 
Full=WRKY DNA-binding protein 19 [Arabidopsis thaliana]
 emb|CAB40943.1| putative disease resistance protein [Arabidopsis thaliana]
 emb|CAB78245.1| putative disease resistance protein [Arabidopsis thaliana]
 gb|AEE83085.1| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
Length=1895

 Score =   188 bits (477),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK +C K AEG +  C +HGGGRRC+Y  CTKGA+GST FC AHGGG+RC
Sbjct  109   CISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGSTDFCIAHGGGRRC  168

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +E CT+ A G T FC  HGGG RC   G   C KS  G   +C AHGGGK+C+  DCT 
Sbjct  169   NHEDCTRSAWGRTEFCVKHGGGARCKTYG---CGKSASGPLPFCRAHGGGKKCSHEDCTG  225

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
              ARGR+  C+ HGGGKRCQ E C KSA+G +  C +HGGG+RC
Sbjct  226   FARGRSGLCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRC  268


 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+ ++  C +HGGG+RC    C KGAEG T +CK HGGG+RC + G   
Sbjct  91    KLCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLG---  147

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C K   G T +C+AHGGG+RC   DCT+SA GRT+FCV+HGGG RC+  GCGKSA G   
Sbjct  148   CTKGAEGSTDFCIAHGGGRRCNHEDCTRSAWGRTEFCVKHGGGARCKTYGCGKSASGPLP  207

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             FC+AHGGGK+C     S E       C  FARG++GLC  HG
Sbjct  208   FCRAHGGGKKC-----SHE------DCTGFARGRSGLCLMHG  238


 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKA  1135
             LC+ HGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGA+GS MFCKA
Sbjct  233   LCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSIGCTKGAKGSKMFCKA  286



>ref|NP_192939.2| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
 gb|AEE83084.1| mitogen-activated protein kinase kinase kinase 11 [Arabidopsis 
thaliana]
Length=1798

 Score =   188 bits (477),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = -3

Query  1293  CIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKRC  1114
             CI HGGG+RCQK +C K AEG +  C +HGGGRRC+Y  CTKGA+GST FC AHGGG+RC
Sbjct  109   CISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGSTDFCIAHGGGRRC  168

Query  1113  IYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDCTK  934
              +E CT+ A G T FC  HGGG RC   G   C KS  G   +C AHGGGK+C+  DCT 
Sbjct  169   NHEDCTRSAWGRTEFCVKHGGGARCKTYG---CGKSASGPLPFCRAHGGGKKCSHEDCTG  225

Query  933   SARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRC  805
              ARGR+  C+ HGGGKRCQ E C KSA+G +  C +HGGG+RC
Sbjct  226   FARGRSGLCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRC  268


 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = -3

Query  1197  RRCQYPQCTKGAQGSTMFCKAHGGGKRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGV  1018
             + CQ   C KGA+ ++  C +HGGG+RC    C KGAEG T +CK HGGG+RC + G   
Sbjct  91    KLCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLG---  147

Query  1017  CPKSVHGGTLYCVAHGGGKRCAVTDCTKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTD  838
             C K   G T +C+AHGGG+RC   DCT+SA GRT+FCV+HGGG RC+  GCGKSA G   
Sbjct  148   CTKGAEGSTDFCIAHGGGRRCNHEDCTRSAWGRTEFCVKHGGGARCKTYGCGKSASGPLP  207

Query  837   FCKAHGGGKRCYWGQPSSEFGKGEIPCNSFARGKTGLCASHG  712
             FC+AHGGGK+C     S E       C  FARG++GLC  HG
Sbjct  208   FCRAHGGGKKC-----SHE------DCTGFARGRSGLCLMHG  238


 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKA  1135
             LC+ HGGGKRCQ+ENCTKSAEGLSGLCISHGGGRRCQ   CTKGA+GS MFCKA
Sbjct  233   LCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSIGCTKGAKGSKMFCKA  286



>ref|XP_002775503.1| hypothetical protein Pmar_PMAR020482 [Perkinsus marinus ATCC 
50983]
 gb|EER07319.1| hypothetical protein Pmar_PMAR020482 [Perkinsus marinus ATCC 
50983]
Length=354

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 118/210 (56%), Gaps = 20/210 (10%)
 Frame = -3

Query  1296  LCIRHGGGKRCQKENCTKSAEGLSGLCISHGGGRRCQYPQCTKGAQGSTMFCKAHGGGKR  1117
              CI HGGG  C+  +C  SA   S  CI+HGGGRRCQ P C K A GST FCKAHGGG+R
Sbjct  46    YCITHGGGNTCEYPDCKTSARHGSTFCIAHGGGRRCQKPGCAKSAVGSTNFCKAHGGGRR  105

Query  1116  CIYEGCTKGAEGSTP-FCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTDC  940
             C Y  C + A    P  C  HGGGKRC     G     V     YC+ HGGG  C   DC
Sbjct  106   CTYPNCFRAARPGQPQACMKHGGGKRCALPTVG----QVRAAARYCITHGGGNTCEYPDC  161

Query  939   TKSARGRTDFCVRHGGGKRCQFEGCGKSAQGSTDFCKAHGGGKRCYW---------GQPS  787
               SAR  + FC+ HGGG+RCQ  GC KSA GST+FCKAHGGG+RC +         GQP 
Sbjct  162   KTSARHGSTFCIAHGGGRRCQKPGCAKSAVGSTNFCKAHGGGRRCTYPSCFRAARPGQPQ  221

Query  786   SEFGKG-----EIP-CNSFARGKTGLCASH  715
             +    G      +P C+  A  ++  CA H
Sbjct  222   ACMKHGGGKRCALPTCDRSAAARSNFCAEH  251


 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 62/107 (58%), Gaps = 4/107 (4%)
 Frame = -3

Query  1122  KRCIYEGCTKGAEGSTPFCKGHGGGKRCLFQGGGVCPKSVHGGTLYCVAHGGGKRCAVTD  943
             K C  EGC++    +  +C  HGGG  C +     C  S   G+ +C+AHGGG+RC    
Sbjct  29    KICKAEGCSRQVRAAARYCITHGGGNTCEYPD---CKTSARHGSTFCIAHGGGRRCQKPG  85

Query  942   CTKSARGRTDFCVRHGGGKRCQFEGCGKSAQ-GSTDFCKAHGGGKRC  805
             C KSA G T+FC  HGGG+RC +  C ++A+ G    C  HGGGKRC
Sbjct  86    CAKSAVGSTNFCKAHGGGRRCTYPNCFRAARPGQPQACMKHGGGKRC  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3740005093662