BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6070

Length=1239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804503.1|  PREDICTED: exosome complex exonuclease RRP46...    399   7e-135   Nicotiana sylvestris
ref|XP_008220073.1|  PREDICTED: exosome complex exonuclease RRP46...    394   4e-133   Prunus mume [ume]
ref|XP_009620114.1|  PREDICTED: exosome complex exonuclease RRP46...    393   1e-132   Nicotiana tomentosiformis
ref|XP_007223780.1|  hypothetical protein PRUPE_ppa010603mg             393   2e-132   Prunus persica
ref|XP_004245172.1|  PREDICTED: exosome complex exonuclease RRP46...    392   3e-132   Solanum lycopersicum
emb|CDP08145.1|  unnamed protein product                                392   4e-132   Coffea canephora [robusta coffee]
ref|XP_006359768.1|  PREDICTED: exosome complex exonuclease RRP46...    391   8e-132   Solanum tuberosum [potatoes]
gb|KJB82884.1|  hypothetical protein B456_013G218900                    390   1e-131   Gossypium raimondii
gb|KHG08508.1|  Exosome complex component RRP41                         389   8e-131   Gossypium arboreum [tree cotton]
gb|KJB82886.1|  hypothetical protein B456_013G218900                    386   8e-130   Gossypium raimondii
ref|XP_010049104.1|  PREDICTED: exosome complex exonuclease RRP46...    385   1e-129   Eucalyptus grandis [rose gum]
ref|XP_004291185.1|  PREDICTED: exosome complex exonuclease RRP46...    385   2e-129   Fragaria vesca subsp. vesca
ref|XP_007012122.1|  Ribosomal protein S5 domain 2-like superfami...    384   3e-129   
ref|XP_008385663.1|  PREDICTED: exosome complex exonuclease RRP46...    384   3e-129   Malus domestica [apple tree]
gb|KJB82885.1|  hypothetical protein B456_013G218900                    384   6e-129   Gossypium raimondii
ref|XP_009364817.1|  PREDICTED: exosome complex exonuclease RRP46...    382   2e-128   Pyrus x bretschneideri [bai li]
ref|XP_009364244.1|  PREDICTED: exosome complex exonuclease RRP46...    380   8e-128   Pyrus x bretschneideri [bai li]
ref|XP_006450678.1|  hypothetical protein CICLE_v10009310mg             377   3e-126   
ref|XP_007012123.1|  Ribosomal protein S5 domain 2-like superfami...    376   5e-126   
ref|XP_004150286.1|  PREDICTED: exosome complex exonuclease RRP46...    376   5e-126   Cucumis sativus [cucumbers]
ref|XP_002324223.2|  hypothetical protein POPTR_0018s00300g             376   6e-126   Populus trichocarpa [western balsam poplar]
ref|XP_008445020.1|  PREDICTED: exosome complex exonuclease RRP46...    376   7e-126   Cucumis melo [Oriental melon]
ref|XP_006476041.1|  PREDICTED: exosome complex exonuclease RRP46...    375   9e-126   Citrus sinensis [apfelsine]
gb|KDO79811.1|  hypothetical protein CISIN_1g024064mg                   375   1e-125   Citrus sinensis [apfelsine]
ref|XP_010514947.1|  PREDICTED: exosome complex exonuclease RRP46...    375   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010244439.1|  PREDICTED: exosome complex exonuclease RRP46...    375   1e-125   
ref|XP_010503239.1|  PREDICTED: exosome complex exonuclease RRP46...    373   7e-125   Camelina sativa [gold-of-pleasure]
ref|XP_012089928.1|  PREDICTED: exosome complex exonuclease RRP46...    372   2e-124   Jatropha curcas
ref|XP_002877464.1|  hypothetical protein ARALYDRAFT_485002             372   3e-124   
ref|XP_008352563.1|  PREDICTED: exosome complex exonuclease RRP46...    371   6e-124   
ref|NP_190207.1|  ribosomal protein S5 domain 2-like superfamily ...    370   8e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223779.1|  hypothetical protein PRUPE_ppa010603mg             370   2e-123   Prunus persica
ref|XP_006291764.1|  hypothetical protein CARUB_v10017935mg             369   2e-123   Capsella rubella
emb|CDX86067.1|  BnaC03g55820D                                          367   3e-122   
ref|XP_006418935.1|  hypothetical protein EUTSA_v10002814mg             366   6e-122   Eutrema salsugineum [saltwater cress]
ref|XP_009149983.1|  PREDICTED: exosome complex exonuclease RRP46...    362   2e-120   Brassica rapa
ref|XP_010648497.1|  PREDICTED: exosome complex exonuclease RRP46...    361   6e-120   Vitis vinifera
emb|CBI20856.3|  unnamed protein product                                360   1e-119   Vitis vinifera
emb|CDX99121.1|  BnaA06g18120D                                          360   1e-119   
gb|KDO79813.1|  hypothetical protein CISIN_1g024064mg                   360   3e-119   Citrus sinensis [apfelsine]
gb|KHM99392.1|  Exosome complex exonuclease RRP46 like                  357   1e-118   Glycine soja [wild soybean]
gb|AFK43786.1|  unknown                                                 357   2e-118   Lotus japonicus
ref|XP_010426057.1|  PREDICTED: exosome complex exonuclease RRP46...    357   2e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010541255.1|  PREDICTED: exosome complex exonuclease RRP46...    356   4e-118   Tarenaya hassleriana [spider flower]
ref|XP_003552384.1|  PREDICTED: exosome complex exonuclease RRP46...    355   6e-118   Glycine max [soybeans]
ref|XP_003534569.1|  PREDICTED: exosome complex exonuclease RRP46...    354   2e-117   Glycine max [soybeans]
ref|XP_003623909.1|  Exosome complex exonuclease RRP46                  354   2e-117   Medicago truncatula
ref|XP_010668302.1|  PREDICTED: exosome complex exonuclease RRP46...    353   3e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011007654.1|  PREDICTED: exosome complex exonuclease RRP46...    352   1e-116   Populus euphratica
ref|XP_004492714.1|  PREDICTED: exosome complex exonuclease RRP46...    352   1e-116   Cicer arietinum [garbanzo]
ref|XP_002516498.1|  Exosome complex exonuclease RRP46, putative        350   4e-116   
ref|XP_009396849.1|  PREDICTED: exosome complex exonuclease RRP46...    347   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010090354.1|  Exosome complex exonuclease RRP46-like protein     349   3e-114   
gb|KFK33969.1|  exosome complex component rrp46                         346   3e-114   Arabis alpina [alpine rockcress]
ref|XP_008786334.1|  PREDICTED: exosome complex exonuclease RRP46...    345   5e-114   Phoenix dactylifera
gb|ABD33427.2|  Peptidase S8 and S53, subtilisin, kexin, sedolisi...    345   6e-114   Medicago truncatula
gb|EYU20440.1|  hypothetical protein MIMGU_mgv1a012696mg                341   3e-112   Erythranthe guttata [common monkey flower]
ref|XP_010933463.1|  PREDICTED: exosome complex exonuclease RRP46...    340   9e-112   Elaeis guineensis
ref|XP_011081797.1|  PREDICTED: exosome complex exonuclease RRP46...    338   3e-111   Sesamum indicum [beniseed]
ref|XP_006450682.1|  hypothetical protein CICLE_v10009310mg             337   3e-111   
ref|XP_006853610.2|  PREDICTED: exosome complex exonuclease RRP46...    338   6e-111   
ref|XP_011007656.1|  PREDICTED: exosome complex exonuclease RRP46...    331   2e-108   Populus euphratica
ref|XP_008786335.1|  PREDICTED: exosome complex exonuclease RRP46...    327   7e-107   
ref|XP_010096367.1|  hypothetical protein L484_021115                   319   4e-104   
ref|XP_007139880.1|  hypothetical protein PHAVU_008G066200g             312   2e-101   Phaseolus vulgaris [French bean]
ref|XP_006650920.1|  PREDICTED: exosome complex exonuclease RRP46...    313   3e-101   Oryza brachyantha
gb|EPS64194.1|  hypothetical protein M569_10586                         307   4e-99    Genlisea aurea
ref|NP_001051936.1|  Os03g0854200                                       307   5e-99    
pdb|3HKM|A  Chain A, Crystal Structure Of Rice(Oryza Sativa) Rrp46      307   7e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EEC76561.1|  hypothetical protein OsI_14380                          306   1e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_004981002.1|  PREDICTED: exosome complex exonuclease RRP46...    306   1e-98    Setaria italica
ref|XP_003560307.1|  PREDICTED: exosome complex exonuclease RRP46...    306   2e-98    Brachypodium distachyon [annual false brome]
ref|XP_002463494.1|  hypothetical protein SORBIDRAFT_01g000760          299   7e-96    Sorghum bicolor [broomcorn]
ref|XP_006418943.1|  hypothetical protein EUTSA_v10002689mg             293   1e-94    
ref|NP_001146469.1|  exosome complex exonuclease RRP46                  295   3e-94    Zea mays [maize]
ref|XP_002308603.2|  hypothetical protein POPTR_0006s25550g             292   9e-94    
gb|ACG36561.1|  exosome complex exonuclease RRP46                       292   4e-93    Zea mays [maize]
gb|ACV40374.1|  ribosomal RNA-processing protein 46                     291   1e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003545427.1|  PREDICTED: exosome complex exonuclease RRP46...    289   5e-92    Glycine max [soybeans]
gb|ERN15077.1|  hypothetical protein AMTR_s00056p00044410               288   9e-92    Amborella trichopoda
ref|XP_006450683.1|  hypothetical protein CICLE_v10009310mg             281   5e-90    
gb|EEE60325.1|  hypothetical protein OsJ_13416                          280   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006450679.1|  hypothetical protein CICLE_v10009310mg             246   2e-76    
gb|KCW81566.1|  hypothetical protein EUGRSUZ_C02924                     244   3e-75    Eucalyptus grandis [rose gum]
ref|XP_001775388.1|  predicted protein                                  243   7e-74    
gb|KHN27081.1|  Exosome complex exonuclease RRP46 like                  228   4e-69    Glycine soja [wild soybean]
gb|KJB65534.1|  hypothetical protein B456_010G107600                    214   7e-63    Gossypium raimondii
gb|KHN07227.1|  Exosome complex exonuclease RRP46 like                  189   8e-54    Glycine soja [wild soybean]
gb|AFW66941.1|  hypothetical protein ZEAMMB73_899121                    181   1e-51    
gb|ACN34857.1|  unknown                                                 169   1e-46    Zea mays [maize]
gb|KDO79816.1|  hypothetical protein CISIN_1g047153mg                   161   1e-44    Citrus sinensis [apfelsine]
ref|XP_006439144.1|  hypothetical protein CICLE_v10010872mg             161   1e-44    
dbj|GAM24985.1|  hypothetical protein SAMD00019534_081600               159   8e-42    Acytostelium subglobosum LB1
ref|XP_002880804.1|  predicted protein                                  148   4e-39    
ref|XP_011270851.1|  hypothetical protein CAOG_09141                    150   8e-39    Capsaspora owczarzaki ATCC 30864
ref|XP_001635076.1|  predicted protein                                  148   4e-38    Nematostella vectensis
ref|XP_003283749.1|  hypothetical protein DICPUDRAFT_85962              147   1e-37    Dictyostelium purpureum
ref|XP_009045277.1|  hypothetical protein LOTGIDRAFT_110121             146   1e-37    Lottia gigantea
gb|KJB65531.1|  hypothetical protein B456_010G107600                    145   1e-37    Gossypium raimondii
ref|XP_002590540.1|  hypothetical protein BRAFLDRAFT_124523             146   2e-37    Branchiostoma floridae
ref|XP_638714.1|  hypothetical protein DDB_G0284053                     147   2e-37    Dictyostelium discoideum AX4
ref|XP_005529520.1|  PREDICTED: exosome complex component RRP46-like    143   2e-36    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004362002.1|  hypothetical protein DFA_06297                     146   3e-36    Cavenderia fasciculata
ref|XP_003643513.1|  PREDICTED: exosome complex component RRP46-like    140   7e-36    
gb|KDO30684.1|  hypothetical protein SPRG_04585                         142   8e-36    Saprolegnia parasitica CBS 223.65
ref|XP_008892901.1|  hypothetical protein PPTG_01379                    142   8e-36    Phytophthora parasitica INRA-310
ref|XP_001372178.1|  PREDICTED: exosome complex component RRP46         142   8e-36    Monodelphis domestica
emb|CBJ25452.1|  conserved unknown protein                              142   9e-36    Ectocarpus siliculosus
ref|XP_006189877.1|  PREDICTED: exosome complex component RRP46         141   2e-35    Camelus ferus
ref|XP_010983543.1|  PREDICTED: exosome complex component RRP46         141   2e-35    Camelus dromedarius [camel]
ref|XP_006900980.1|  PREDICTED: exosome complex component RRP46         141   2e-35    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006215046.1|  PREDICTED: exosome complex component RRP46         141   2e-35    Vicugna pacos
ref|XP_006165337.1|  PREDICTED: exosome complex component RRP46         141   3e-35    Tupaia chinensis
ref|XP_001790575.2|  PREDICTED: exosome complex component RRP46         140   4e-35    
ref|XP_010847573.1|  PREDICTED: exosome complex component RRP46         140   4e-35    Bison bison bison
ref|XP_005692493.1|  PREDICTED: exosome complex component RRP46         140   5e-35    
ref|XP_006871456.1|  PREDICTED: exosome complex component RRP46         140   5e-35    Chrysochloris asiatica
ref|XP_005971422.1|  PREDICTED: exosome complex component RRP46         140   5e-35    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003459176.2|  PREDICTED: exosome complex component RRP46-like    140   5e-35    
ref|XP_006052120.1|  PREDICTED: exosome complex component RRP46         140   6e-35    
ref|XP_007883779.1|  PREDICTED: exosome complex component RRP46         139   6e-35    Callorhinchus milii [Australian ghost shark]
gb|EPY77328.1|  exosome complex component RRP46                         141   8e-35    Camelus ferus
ref|NP_001231590.1|  exosome component 5                                139   1e-34    Sus scrofa [pigs]
gb|EFA75059.1|  hypothetical protein PPL_11677                          139   1e-34    Heterostelium album PN500
ref|XP_008986316.1|  PREDICTED: exosome complex component RRP46         139   2e-34    
ref|XP_011442915.1|  PREDICTED: exosome complex component RRP46-like    138   2e-34    Crassostrea gigas
ref|XP_005412404.1|  PREDICTED: exosome complex component RRP46         139   2e-34    Chinchilla lanigera
ref|XP_004670366.1|  PREDICTED: exosome complex component RRP46         138   2e-34    Jaculus jaculus
ref|XP_008307243.1|  PREDICTED: exosome complex component RRP46         138   2e-34    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009839526.1|  hypothetical protein H257_13641                    138   2e-34    Aphanomyces astaci
ref|XP_007941330.1|  PREDICTED: exosome complex component RRP46         138   3e-34    Orycteropus afer afer
ref|XP_004015323.2|  PREDICTED: exosome complex component RRP46         139   3e-34    
ref|XP_002722356.2|  PREDICTED: exosome complex component RRP46         139   3e-34    
ref|XP_008607929.1|  hypothetical protein SDRG_04054                    137   3e-34    Saprolegnia diclina VS20
ref|XP_002891497.1|  hypothetical protein ARALYDRAFT_891796             135   4e-34    
ref|XP_006814760.1|  PREDICTED: exosome complex component RRP46-like    136   4e-34    Saccoglossus kowalevskii
ref|XP_004060830.1|  PREDICTED: exosome complex component RRP46         137   4e-34    Gorilla gorilla gorilla [lowland gorilla]
ref|NP_001232110.1|  putative exosome component 5                       137   4e-34    Taeniopygia guttata
ref|XP_008880365.1|  hypothetical protein H310_14314                    137   4e-34    Aphanomyces invadans
ref|XP_010621639.1|  PREDICTED: exosome complex component RRP46         137   5e-34    Fukomys damarensis [Damara mole rat]
ref|XP_006796741.1|  PREDICTED: exosome complex component RRP46-like    137   5e-34    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004776116.1|  PREDICTED: exosome complex component RRP46 i...    137   6e-34    Mustela putorius furo [black ferret]
ref|XP_004560523.1|  PREDICTED: exosome complex component RRP46-like    137   6e-34    Maylandia zebra
ref|XP_004873054.1|  PREDICTED: exosome complex component RRP46         137   6e-34    Heterocephalus glaber [naked mole rat]
ref|XP_001152170.1|  PREDICTED: exosome complex component RRP46         137   7e-34    Pan troglodytes
ref|XP_005936836.1|  PREDICTED: exosome complex component RRP46-like    137   7e-34    Haplochromis burtoni
gb|AAH07742.1|  Exosome component 5                                     137   7e-34    Homo sapiens [man]
pdb|2NN6|D  Chain D, Structure Of The Human Rna Exosome Composed ...    137   7e-34    Homo sapiens [man]
ref|XP_004339442.1|  3' exoribonuclease family, domain 1 domain c...    137   8e-34    Acanthamoeba castellanii str. Neff
ref|NP_064543.3|  exosome complex component RRP46                       137   8e-34    Homo sapiens [man]
ref|XP_006677848.1|  hypothetical protein BATDEDRAFT_23824              136   8e-34    Batrachochytrium dendrobatidis JAM81
gb|AAH99290.1|  LOC733302 protein                                       136   8e-34    Xenopus laevis [clawed frog]
gb|EFB16301.1|  hypothetical protein PANDA_012923                       135   9e-34    Ailuropoda melanoleuca
ref|XP_852838.1|  PREDICTED: exosome complex component RRP46            136   1e-33    Canis lupus familiaris [dogs]
ref|XP_003968627.1|  PREDICTED: exosome complex component RRP46         135   1e-33    Takifugu rubripes [tiger puffer]
ref|XP_002923728.1|  PREDICTED: exosome complex component RRP46         136   1e-33    Ailuropoda melanoleuca
ref|XP_010379101.1|  PREDICTED: exosome complex component RRP46         137   1e-33    Rhinopithecus roxellana
ref|XP_011942250.1|  PREDICTED: exosome complex component RRP46         137   1e-33    Cercocebus atys
ref|XP_011791908.1|  PREDICTED: exosome complex component RRP46         137   1e-33    Colobus angolensis palliatus
ref|XP_003915633.1|  PREDICTED: exosome complex component RRP46         137   2e-33    Papio anubis [baboon]
ref|XP_003462029.1|  PREDICTED: exosome complex component RRP46         136   2e-33    Cavia porcellus [guinea pig]
ref|XP_010565491.1|  PREDICTED: exosome complex component RRP46         134   2e-33    Haliaeetus leucocephalus
ref|XP_007995095.1|  PREDICTED: exosome complex component RRP46 i...    137   2e-33    Chlorocebus sabaeus
ref|XP_009839527.1|  hypothetical protein, variant                      134   2e-33    Aphanomyces astaci
ref|XP_001658056.1|  AAEL006819-PA                                      135   2e-33    Aedes aegypti
gb|AAM75154.1|  chronic myelogenous leukemia tumor antigen 28           136   2e-33    Homo sapiens [man]
ref|XP_004776115.1|  PREDICTED: exosome complex component RRP46 i...    135   2e-33    
gb|AAH34358.1|  Exosome component 5                                     135   3e-33    synthetic construct
dbj|BAE33136.1|  unnamed protein product                                135   3e-33    Mus musculus [mouse]
ref|NP_613052.1|  exosome complex component RRP46                       135   3e-33    Mus musculus [mouse]
ref|XP_002952423.1|  hypothetical protein VOLCADRAFT_105481             135   3e-33    Volvox carteri f. nagariensis
ref|XP_001102687.2|  PREDICTED: exosome complex exonuclease RRP46       136   3e-33    
dbj|BAG37447.1|  unnamed protein product                                135   3e-33    Homo sapiens [man]
ref|XP_008704864.1|  PREDICTED: exosome complex component RRP46         135   3e-33    Ursus maritimus [white bear]
ref|XP_007231349.1|  PREDICTED: exosome complex component RRP46         134   4e-33    
ref|XP_007614880.1|  PREDICTED: exosome complex component RRP46 i...    134   4e-33    
ref|XP_003997820.1|  PREDICTED: exosome complex component RRP46         135   4e-33    Felis catus [cat]
ref|XP_003802126.1|  PREDICTED: exosome complex component RRP46         135   4e-33    Otolemur garnettii
ref|XP_006265050.1|  PREDICTED: exosome complex component RRP46         134   5e-33    
ref|XP_005361238.1|  PREDICTED: exosome complex component RRP46         135   5e-33    Microtus ochrogaster [prairie voles]
ref|XP_004620765.1|  PREDICTED: exosome complex component RRP46         134   5e-33    Sorex araneus [Eurasian shrew]
ref|XP_004388800.1|  PREDICTED: exosome complex component RRP46         134   5e-33    Trichechus manatus latirostris
ref|XP_008853228.1|  PREDICTED: exosome complex component RRP46 i...    134   5e-33    Nannospalax galili
ref|XP_008056990.1|  PREDICTED: exosome complex component RRP46         134   6e-33    Carlito syrichta
ref|XP_005336521.1|  PREDICTED: exosome complex component RRP46         134   6e-33    Ictidomys tridecemlineatus
gb|AAI67023.1|  Exosc5 protein                                          134   6e-33    Rattus norvegicus [brown rat]
ref|XP_001868566.1|  exosome complex exonuclease RRP46                  134   6e-33    Culex quinquefasciatus
ref|NP_001100963.2|  exosome complex component RRP46                    134   6e-33    Rattus norvegicus [brown rat]
ref|XP_006910753.1|  PREDICTED: exosome complex component RRP46         134   7e-33    Pteropus alecto
ref|NP_001038817.2|  exosome complex component RRP46                    134   7e-33    Danio rerio [leopard danio]
ref|XP_007086646.1|  PREDICTED: exosome complex component RRP46         134   7e-33    Panthera tigris altaica
ref|XP_006988101.1|  PREDICTED: exosome complex component RRP46         135   7e-33    Peromyscus maniculatus bairdii
ref|XP_004884092.1|  PREDICTED: exosome complex component RRP46         134   9e-33    
ref|XP_001500390.2|  PREDICTED: exosome complex component RRP46         134   9e-33    
ref|XP_008535841.1|  PREDICTED: exosome complex component RRP46         134   1e-32    Equus przewalskii [Przewalski horse]
ref|XP_004598054.1|  PREDICTED: exosome complex component RRP46         134   1e-32    Ochotona princeps [southern American pika]
ref|XP_003270380.1|  PREDICTED: exosome complex component RRP46 i...    134   1e-32    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004396380.1|  PREDICTED: exosome complex component RRP46         134   1e-32    Odobenus rosmarus divergens
ref|XP_011381936.1|  PREDICTED: exosome complex component RRP46         133   1e-32    Pteropus vampyrus
ref|XP_005589410.1|  PREDICTED: exosome complex component RRP46 i...    132   1e-32    
ref|XP_002161086.1|  PREDICTED: exosome complex component RRP46-like    133   2e-32    Hydra vulgaris
gb|AAI22388.1|  Exosome component 5                                     132   2e-32    Danio rerio [leopard danio]
ref|XP_011598192.1|  PREDICTED: exosome complex component RRP46         132   2e-32    Aquila chrysaetos canadensis
ref|XP_003420841.1|  PREDICTED: exosome complex component RRP46         133   2e-32    Loxodonta africana [African bush elephant]
gb|AAI67726.1|  LOC100170617 protein                                    133   2e-32    Xenopus tropicalis [western clawed frog]
ref|XP_004694201.1|  PREDICTED: exosome complex component RRP46         133   2e-32    Condylura cristata
ref|XP_004710406.1|  PREDICTED: exosome complex component RRP46         132   2e-32    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004441635.1|  PREDICTED: exosome complex component RRP46         132   2e-32    
ref|XP_005810607.1|  PREDICTED: exosome complex component RRP46-like    132   3e-32    
ref|XP_005890679.1|  PREDICTED: exosome complex component RRP46         132   3e-32    Bos mutus
ref|XP_004479958.1|  PREDICTED: exosome complex component RRP46         132   3e-32    Dasypus novemcinctus
ref|XP_002939437.2|  PREDICTED: exosome complex component RRP46         132   3e-32    
ref|XP_006102702.1|  PREDICTED: exosome complex component RRP46         132   4e-32    Myotis lucifugus
ref|XP_007552430.1|  PREDICTED: exosome complex component RRP46         132   5e-32    Poecilia formosa
ref|XP_007458677.1|  PREDICTED: exosome complex component RRP46         131   6e-32    Lipotes vexillifer [baiji]
ref|XP_008424727.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    132   7e-32    
ref|XP_004271294.1|  PREDICTED: exosome complex component RRP46         131   8e-32    Orcinus orca [Orca]
ref|XP_007168080.1|  PREDICTED: exosome complex component RRP46         131   8e-32    Balaenoptera acutorostrata scammoni
ref|XP_007128181.1|  PREDICTED: exosome complex component RRP46 i...    131   9e-32    Physeter catodon
ref|XP_010329358.1|  PREDICTED: exosome complex component RRP46 i...    130   9e-32    Saimiri boliviensis boliviensis
ref|XP_008581518.1|  PREDICTED: exosome complex component RRP46         132   1e-31    Galeopterus variegatus [Malayan flying lemur]
ref|XP_007536651.1|  PREDICTED: exosome complex component RRP46         131   1e-31    Erinaceus europaeus [common hedgehog]
ref|XP_008137779.1|  PREDICTED: exosome complex component RRP46         130   1e-31    Eptesicus fuscus
ref|XP_008295409.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    130   1e-31    Stegastes partitus
ref|XP_005868826.1|  PREDICTED: exosome complex component RRP46         130   1e-31    Myotis brandtii
ref|XP_006750387.1|  PREDICTED: transforming growth factor beta-1...    134   2e-31    Leptonychotes weddellii
ref|XP_006771927.1|  PREDICTED: exosome complex component RRP46         130   2e-31    Myotis davidii
gb|ABO26648.1|  exosome component 5                                     129   2e-31    Haliotis discus discus
ref|XP_003222900.2|  PREDICTED: exosome complex component RRP46         130   3e-31    Anolis carolinensis [Carolina anole]
gb|EPB89162.1|  hypothetical protein HMPREF1544_04029                   129   7e-31    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008650209.1|  PREDICTED: exosome complex exonuclease RRP46...    125   9e-31    
ref|XP_002679009.1|  predicted protein                                  127   4e-30    Naegleria gruberi strain NEG-M
emb|CEG76184.1|  hypothetical protein RMATCC62417_11114                 126   5e-30    Rhizopus microsporus
ref|XP_007442684.1|  PREDICTED: exosome complex component RRP46         126   5e-30    Python bivittatus
ref|XP_005774369.1|  hypothetical protein EMIHUDRAFT_240695             125   8e-30    Emiliania huxleyi CCMP1516
ref|XP_001692824.1|  exosome complex exonuclease                        124   2e-29    Chlamydomonas reinhardtii
gb|KFH68948.1|  hypothetical protein MVEG_05750                         124   4e-29    Mortierella verticillata NRRL 6337
ref|XP_010901343.1|  PREDICTED: exosome complex component RRP46         122   6e-29    Esox lucius
gb|AFW74802.1|  hypothetical protein ZEAMMB73_831356                    125   2e-28    
gb|ESA19320.1|  hypothetical protein GLOINDRAFT_344174                  121   2e-28    
ref|XP_005061357.1|  PREDICTED: exosome complex component RRP46-like    120   5e-28    Ficedula albicollis
ref|XP_006616550.1|  PREDICTED: exosome complex component RRP46-like    120   5e-28    Apis dorsata [rock honeybee]
gb|EFX86237.1|  hypothetical protein DAPPUDRAFT_193332                  120   5e-28    Daphnia pulex
emb|CDH57247.1|  exosome complex component rrp46                        120   6e-28    Lichtheimia corymbifera JMRC:FSU:9682
gb|EPZ31397.1|  Exoribonuclease, phosphorolytic 1 domain-containi...    119   2e-27    Rozella allomycis CSF55
gb|KFP06545.1|  Exosome complex component RRP46                         117   3e-27    Calypte anna
ref|XP_008488170.1|  PREDICTED: exosome complex component RRP46         116   3e-27    
gb|AFW78644.1|  hypothetical protein ZEAMMB73_813724                    122   4e-27    
ref|XP_002130542.1|  PREDICTED: exosome complex component RRP46 i...    118   4e-27    
ref|XP_005185686.1|  PREDICTED: exosome complex component RRP46         118   5e-27    Musca domestica
ref|XP_010748235.1|  PREDICTED: exosome complex component RRP46         116   5e-27    
ref|XP_011185302.1|  PREDICTED: exosome complex component RRP46         118   6e-27    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008499405.1|  PREDICTED: exosome complex component RRP46         116   8e-27    Calypte anna
ref|XP_002198831.2|  PREDICTED: exosome complex component RRP46-like    116   9e-27    
ref|XP_003701893.1|  PREDICTED: exosome complex component RRP46         116   9e-27    Megachile rotundata
emb|CDQ92111.1|  unnamed protein product                                121   1e-26    Oncorhynchus mykiss
gb|KIY97888.1|  Exosome complex exonuclease RRP46                       117   2e-26    Monoraphidium neglectum
gb|EHJ72793.1|  exosome complex exonuclease RRP46                       115   3e-26    
dbj|GAN03216.1|  rho GTPase activation protein                          122   3e-26    Mucor ambiguus
ref|XP_002185170.1|  predicted protein                                  112   4e-26    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002897007.1|  conserved hypothetical protein                     113   5e-26    Phytophthora infestans T30-4
ref|XP_003696793.1|  PREDICTED: exosome complex component RRP46-like    114   6e-26    Apis florea [dwarf honeybee]
gb|ELT92240.1|  hypothetical protein CAPTEDRAFT_152902                  114   9e-26    Capitella teleta
ref|XP_003493132.1|  PREDICTED: exosome complex component RRP46-like    114   9e-26    Bombus impatiens
ref|XP_007650519.1|  PREDICTED: exosome complex component RRP46 i...    114   1e-25    
ref|XP_004521225.1|  PREDICTED: exosome complex component RRP46-like    114   1e-25    Ceratitis capitata [medfly]
emb|CEI97070.1|  hypothetical protein RMCBS344292_11211                 113   1e-25    Rhizopus microsporus
gb|KFM61210.1|  Exosome complex component RRP46                         110   2e-25    Stegodyphus mimosarum
ref|XP_009230910.1|  PREDICTED: exosome complex component RRP46         112   2e-25    
gb|KJB65533.1|  hypothetical protein B456_010G107600                    110   3e-25    Gossypium raimondii
ref|XP_004998282.1|  hypothetical protein PTSG_00813                    112   3e-25    Salpingoeca rosetta
emb|CEI92690.1|  hypothetical protein RMCBS344292_06943                 112   3e-25    Rhizopus microsporus
ref|XP_011563389.1|  PREDICTED: exosome complex component RRP46         112   3e-25    Plutella xylostella [cabbage moth]
ref|XP_006564800.1|  PREDICTED: exosome complex component RRP46         112   4e-25    Apis mellifera [bee]
ref|XP_005853681.1|  exosome complex component RRP46                    112   4e-25    Nannochloropsis gaditana CCMP526
ref|XP_004776117.1|  PREDICTED: exosome complex component RRP46 i...    112   4e-25    
ref|XP_005109238.1|  PREDICTED: exosome complex component RRP46-like    112   6e-25    Aplysia californica
emb|CEG69322.1|  hypothetical protein RMATCC62417_05415                 110   1e-24    Rhizopus microsporus
ref|XP_011210482.1|  PREDICTED: exosome complex component RRP46         111   1e-24    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011641262.1|  PREDICTED: exosome complex component RRP46         110   1e-24    
gb|EWM26414.1|  exosome complex component rrp46                         112   1e-24    
ref|XP_007128180.1|  PREDICTED: exosome complex component RRP46 i...    110   1e-24    
ref|XP_793149.4|  PREDICTED: exosome complex component RRP46            109   1e-24    
ref|XP_003395595.1|  PREDICTED: exosome complex component RRP46-like    110   2e-24    
ref|XP_011159705.1|  PREDICTED: exosome complex component RRP46         110   2e-24    
ref|XP_011342703.1|  PREDICTED: exosome complex component RRP46         110   2e-24    
ref|XP_003426267.1|  PREDICTED: exosome complex component RRP46 i...    109   2e-24    
ref|XP_011881783.1|  PREDICTED: exosome complex component RRP46-like    109   2e-24    
emb|CEP18640.1|  hypothetical protein                                   115   3e-24    
ref|XP_012055110.1|  PREDICTED: exosome complex component RRP46         109   3e-24    
ref|XP_011878170.1|  PREDICTED: exosome complex component RRP46         109   4e-24    
ref|XP_011689371.1|  PREDICTED: exosome complex component RRP46         109   4e-24    
ref|XP_001948203.1|  PREDICTED: exosome complex component RRP46         108   4e-24    
ref|XP_005086667.1|  PREDICTED: exosome complex component RRP46         109   4e-24    
ref|XP_011062336.1|  PREDICTED: exosome complex component RRP46         108   5e-24    
ref|XP_011251396.1|  PREDICTED: exosome complex component RRP46         108   6e-24    
emb|CCA16947.1|  conserved hypothetical protein                         108   9e-24    
ref|XP_008550556.1|  PREDICTED: exosome complex component RRP46-like    108   9e-24    
ref|XP_009526502.1|  hypothetical protein PHYSODRAFT_499334             106   1e-23    
ref|XP_004925740.1|  PREDICTED: exosome complex component RRP46-like    107   2e-23    
ref|XP_308011.5|  AGAP002177-PA                                         107   2e-23    
ref|XP_011404798.1|  PREDICTED: exosome complex component RRP46-like    106   4e-23    
gb|EIE88787.1|  hypothetical protein RO3G_13498                         106   5e-23    
gb|ETN58435.1|  exosome complex exonuclease RRP46                       105   6e-23    
ref|XP_007067374.1|  PREDICTED: exosome complex component RRP46         105   1e-22    
gb|KFB40550.1|  AGAP002177-PA-like protein                              105   1e-22    
ref|XP_005708673.1|  exosome complex component RRP46                    103   3e-22    
ref|XP_005854552.1|  exosome complex component RRP41                    104   4e-22    
ref|XP_008205890.1|  PREDICTED: exosome complex component RRP46 i...    101   6e-22    
ref|XP_011139041.1|  PREDICTED: exosome complex component RRP46         102   8e-22    
gb|KDR22065.1|  Exosome complex exonuclease RRP46                       100   2e-21    
ref|XP_011251426.1|  PREDICTED: radial spoke head protein 6 homol...    106   2e-21    
ref|XP_002505053.1|  predicted protein                                97.8    1e-20    
ref|XP_011307572.1|  PREDICTED: exosome complex component RRP46       99.0    2e-20    
gb|ETN62706.1|  exosome complex exonuclease RRP41                     99.8    2e-20    
gb|EPB92041.1|  hypothetical protein HMPREF1544_01105                 99.8    2e-20    
gb|EMT14084.1|  hypothetical protein F775_28029                       95.5    2e-20    
ref|XP_007921933.1|  hypothetical protein MYCFIDRAFT_111815           98.2    2e-20    
ref|XP_009028437.1|  hypothetical protein HELRODRAFT_88777            98.6    2e-20    
emb|CCI44670.1|  unnamed protein product                                102   3e-20    
ref|XP_004350690.1|  Exosome complex exonuclease rrp41                99.0    3e-20    
ref|XP_009027732.1|  hypothetical protein HELRODRAFT_95842            99.0    3e-20    
dbj|GAN01275.1|  exosome component 4                                  98.6    4e-20    
ref|XP_008196414.1|  PREDICTED: exosome complex component RRP46       97.4    5e-20    
ref|XP_002069486.1|  GK11547                                          97.4    8e-20    
gb|KDR24253.1|  Exosome complex exonuclease RRP41                     97.4    9e-20    
ref|NP_178726.1|  uncharacterized protein                             95.1    1e-19    
ref|XP_006476132.1|  PREDICTED: exosome complex exonuclease RRP46...  92.8    1e-19    
ref|XP_004648894.1|  PREDICTED: exosome complex component RRP46-like  94.0    1e-19    
gb|AGM32792.1|  putative exosome complex exonuclease RRP41            96.7    2e-19    
ref|WP_013605046.1|  exosome complex exonuclease 1                    96.7    2e-19    
ref|XP_001952937.1|  GF17467                                          96.3    2e-19    
emb|CEP13221.1|  hypothetical protein                                 96.3    2e-19    
gb|KFB49939.1|  hypothetical protein ZHAS_00017973                    96.3    2e-19    
gb|EMS49807.1|  hypothetical protein TRIUR3_08678                     92.8    3e-19    
ref|XP_005987972.1|  PREDICTED: exosome complex component RRP46       95.1    3e-19    
ref|WP_013335951.1|  exosome complex exonuclease 1                    95.9    3e-19    
ref|XP_002879110.1|  hypothetical protein ARALYDRAFT_320572           93.2    3e-19    
ref|WP_011839150.1|  ribosomal RNA-processing protein RRP41/SKI6      95.5    4e-19    
ref|NP_191721.1|  exonuclease RRP41                                   95.5    4e-19    
ref|XP_002878393.1|  hypothetical protein ARALYDRAFT_486650           95.5    4e-19    
emb|CEG70724.1|  hypothetical protein RMATCC62417_06568               95.5    4e-19    
gb|KIO28717.1|  hypothetical protein M407DRAFT_178888                 95.9    4e-19    
ref|XP_009067052.1|  hypothetical protein LOTGIDRAFT_237076           95.5    5e-19    
ref|XP_002130561.1|  PREDICTED: exosome complex component RRP46 i...  94.4    5e-19    
ref|WP_012608991.1|  MULTISPECIES: putative exosome complex exonu...  95.1    5e-19    
emb|CDS02710.1|  hypothetical protein LRAMOSA00114                    95.1    5e-19    
ref|XP_011496302.1|  PREDICTED: exosome complex component RRP46       94.7    5e-19    
ref|WP_013130188.1|  ribosomal RNA-processing protein RRP41/SKI6      95.1    6e-19    
ref|WP_014558475.1|  exosome complex exonuclease 1                    95.1    6e-19    
ref|XP_005096780.1|  PREDICTED: exosome complex component RRP41-like  95.1    7e-19    
ref|WP_014768171.1|  exosome complex exonuclease 1                    94.7    7e-19    
emb|CBY32963.1|  unnamed protein product                              94.4    8e-19    
emb|CBY21703.1|  unnamed protein product                              94.4    8e-19    
ref|XP_011483108.1|  PREDICTED: exosome complex component RRP46       93.6    9e-19    
gb|KHJ88111.1|  exosome complex exonuclease 1 family protein          94.7    9e-19    
ref|XP_001990019.1|  GH18468                                          94.4    9e-19    
ref|XP_010469104.1|  PREDICTED: exosome complex component RRP41-like  94.4    1e-18    
ref|XP_003737781.1|  PREDICTED: exosome complex component RRP41-like  94.4    1e-18    
ref|WP_014737087.1|  ribosomal RNA-processing protein RRP41/SKI6      94.4    1e-18    
ref|XP_010413376.1|  PREDICTED: exosome complex component RRP41-like  94.0    1e-18    
ref|XP_006286552.1|  hypothetical protein CARUB_v10001838mg           94.0    1e-18    
ref|XP_005712972.1|  unnamed protein product                          94.4    1e-18    
ref|WP_013143894.1|  exosome complex exonuclease 1                    94.0    1e-18    
emb|CDH60675.1|  exosome component 4                                  94.0    2e-18    
ref|XP_001358191.1|  GA17911                                          93.6    2e-18    
ref|XP_002677284.1|  predicted protein                                94.0    2e-18    
emb|CEJ04572.1|  hypothetical protein RMCBS344292_18527               94.0    2e-18    
gb|EYC16115.1|  hypothetical protein Y032_0034g2806                   93.6    2e-18    
ref|XP_002012867.1|  GL23700                                          93.6    2e-18    
ref|XP_003289985.1|  hypothetical protein DICPUDRAFT_88747            93.6    2e-18    
ref|XP_002097098.1|  GE26036                                          93.2    2e-18    
ref|XP_001980673.1|  GG17562                                          93.2    2e-18    
ref|XP_008195879.1|  PREDICTED: exosome complex component RRP41       93.6    2e-18    
ref|XP_008157921.1|  PREDICTED: exosome complex component RRP41       93.2    3e-18    
ref|WP_013413901.1|  ribosomal RNA-processing protein rrp41/ski6      93.2    3e-18    
ref|WP_021791068.1|  hypothetical protein                             93.6    3e-18    
ref|XP_002431780.1|  conserved hypothetical protein                   92.0    3e-18    
ref|XP_002875607.1|  hypothetical protein ARALYDRAFT_484800           90.5    3e-18    
ref|XP_002031744.1|  GM23883                                          92.8    3e-18    
emb|CDX71725.1|  BnaC08g31490D                                        92.8    3e-18    
ref|WP_015591777.1|  ribosomal RNA-processing protein RRP41/SKI6      93.2    3e-18    
ref|XP_002103983.1|  GD18693                                          92.4    4e-18    
ref|WP_014027276.1|  exosome complex exonuclease 1                    92.8    4e-18    
ref|XP_006627590.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...  92.0    4e-18    
ref|XP_001634554.1|  predicted protein                                92.8    4e-18    
ref|XP_006041139.1|  PREDICTED: exosome complex component RRP41       92.8    4e-18    
ref|XP_004618705.1|  PREDICTED: exosome complex component RRP41       92.8    4e-18    
gb|AFW81702.1|  hypothetical protein ZEAMMB73_884899                  95.1    4e-18    
ref|XP_006989395.1|  PREDICTED: exosome complex component RRP41       92.8    4e-18    
gb|ELR54878.1|  Exosome complex exonuclease RRP41                     92.4    5e-18    
ref|XP_003507723.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_002140257.1|  3' exoribonuclease family protein                92.4    5e-18    
ref|XP_006291576.1|  hypothetical protein CARUB_v10017729mg           93.6    5e-18    
ref|XP_010420627.1|  PREDICTED: exosome complex component RRP41-like  92.4    5e-18    
ref|XP_004265316.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_007118242.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_005316111.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_004316865.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_007166913.1|  PREDICTED: exosome complex component RRP41       92.4    5e-18    
ref|XP_667867.1|  hypothetical protein                                92.4    5e-18    
ref|NP_001128332.1|  exosome complex component RRP41                  92.4    5e-18    
ref|XP_001917049.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...  92.4    6e-18    
ref|NP_780608.1|  exosome complex component RRP41                     92.4    6e-18    
ref|XP_005086044.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_004000217.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|NP_061910.1|  exosome complex component RRP41                     92.4    6e-18    
ref|XP_003802388.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_007954266.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_010959469.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_002736568.1|  PREDICTED: exosome complex component RRP41-like  92.4    6e-18    
ref|XP_008832691.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_002759197.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_006830832.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_004656468.1|  PREDICTED: exosome complex component RRP41       92.4    6e-18    
ref|XP_010454107.1|  PREDICTED: exosome complex component RRP41-like  92.0    6e-18    
ref|XP_004906892.1|  PREDICTED: exosome complex component RRP41       92.0    6e-18    
ref|XP_008569903.1|  PREDICTED: exosome complex component RRP41       92.0    6e-18    
ref|XP_008068188.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|XP_539207.1|  PREDICTED: exosome complex component RRP41 isof...  92.0    7e-18    
ref|XP_005897913.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|XP_004011653.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|XP_006745465.1|  PREDICTED: exosome complex component RRP41 i...  92.0    7e-18    
ref|XP_004400773.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|XP_004638942.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|WP_014587690.1|  Exosome complex exonuclease 1                    92.0    7e-18    
pdb|2NN6|B  Chain B, Structure Of The Human Rna Exosome Composed ...  92.0    7e-18    Homo sapiens [man]
ref|XP_004472072.1|  PREDICTED: exosome complex component RRP41 i...  92.0    7e-18    
ref|XP_003422437.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
ref|XP_005395898.1|  PREDICTED: exosome complex component RRP41 i...  92.0    7e-18    
ref|XP_003463730.1|  PREDICTED: exosome complex component RRP41       92.0    7e-18    
gb|EDL29545.1|  exosome component 4, isoform CRA_b                    92.4    7e-18    
ref|XP_002922117.1|  PREDICTED: exosome complex component RRP41       92.0    8e-18    
ref|XP_004697414.1|  PREDICTED: exosome complex component RRP41       92.0    8e-18    
ref|XP_004387447.1|  PREDICTED: exosome complex component RRP41       92.0    8e-18    
ref|XP_011553417.1|  PREDICTED: exosome complex component RRP41       92.0    8e-18    
ref|XP_010628859.1|  PREDICTED: exosome complex component RRP41 i...  92.0    9e-18    
ref|WP_013562831.1|  ribosomal RNA-processing protein RRP41/SKI6      91.7    9e-18    
ref|XP_011373181.1|  PREDICTED: exosome complex component RRP41       91.7    9e-18    
ref|WP_012997063.1|  exosome complex exonuclease 1                    91.7    1e-17    
gb|EXX78965.1|  Ski6p                                                 90.9    1e-17    
ref|WP_008084891.1|  exosome complex exonuclease 1                    91.7    1e-17    
ref|XP_006402463.1|  hypothetical protein EUTSA_v10006211mg           91.7    1e-17    
ref|XP_001743014.1|  hypothetical protein                             91.7    1e-17    
ref|WP_012939914.1|  exosome complex exonuclease 1                    91.7    1e-17    
ref|WP_042668571.1|  exonuclease                                      91.7    1e-17    
ref|WP_020265552.1|  hypothetical protein                             91.7    1e-17    
gb|EHH64485.1|  hypothetical protein EGM_17708                        91.7    1e-17    
gb|EHH28832.1|  hypothetical protein EGK_19355                        91.7    1e-17    
gb|AAL13710.1|  GM01970p                                              91.3    1e-17    
gb|ETN73313.1|  3' exoribonuclease family, domain 1                   92.4    1e-17    
gb|ETE57050.1|  Exosome complex component RRP46                       89.4    1e-17    
ref|XP_006879294.1|  PREDICTED: exosome complex component RRP41       91.3    1e-17    
ref|WP_022541652.1|  exosome complex exonuclease Rrp41                91.3    1e-17    
ref|XP_002065667.1|  GK15569                                          91.3    1e-17    
gb|EXX78964.1|  Ski6p                                                 91.3    2e-17    
ref|WP_015283367.1|  archaeal exosome-like complex exonuclease 1      91.3    2e-17    
ref|WP_042664257.1|  exonuclease                                      90.9    2e-17    
ref|WP_039192899.1|  MULTISPECIES: exonuclease                        90.9    2e-17    
ref|XP_625789.1|  RPR46-like RNAse PH domain                          90.9    2e-17    
ref|WP_004578055.1|  ribosomal RNA-processing protein RRP41/SKI6      91.3    2e-17    
ref|WP_012185236.1|  exosome complex exonuclease 1                    90.9    2e-17    
ref|XP_011431370.1|  PREDICTED: exosome complex component RRP41-like  90.9    2e-17    
gb|ESA11560.1|  hypothetical protein GLOINDRAFT_96754                 90.9    2e-17    
ref|WP_013303956.1|  ribosomal RNA-processing protein RRP41/SKI6      90.9    2e-17    
ref|NP_650001.2|  Rrp46                                               90.5    2e-17    
ref|XP_001869459.1|  exosome complex exonuclease RRP41                90.5    2e-17    
ref|XP_007516081.1|  PREDICTED: exosome complex component RRP41       90.5    2e-17    
ref|WP_011821749.1|  ribonuclease PH                                  90.5    3e-17    
ref|XP_001524240.1|  exosome complex exonuclease RRP41                90.1    4e-17    
ref|XP_003125499.1|  PREDICTED: exosome complex component RRP41 i...  90.1    4e-17    
emb|CDY52006.1|  BnaC06g42860D                                        89.7    4e-17    
gb|EFX76389.1|  hypothetical protein DAPPUDRAFT_213979                90.1    4e-17    
ref|XP_009104328.1|  PREDICTED: exosome complex component RRP41-l...  89.7    4e-17    
ref|XP_006913035.1|  PREDICTED: exosome complex component RRP41       90.1    4e-17    
ref|WP_013679310.1|  exosome complex exonuclease Rrp41                90.1    4e-17    
ref|NP_001071554.1|  exosome complex component RRP41                  89.7    4e-17    
gb|ENN71792.1|  hypothetical protein YQE_11526                        89.0    4e-17    
ref|WP_019264163.1|  exosome complex exonuclease Rrp41                89.7    4e-17    
ref|XP_004443076.1|  PREDICTED: exosome complex component RRP41       89.7    5e-17    
gb|ADE77635.1|  unknown                                               89.7    5e-17    
gb|EHJ76339.1|  putative exosome complex exonuclease RRP41            89.0    5e-17    
gb|ENN77829.1|  hypothetical protein YQE_05712                        89.7    5e-17    
ref|WP_011250585.1|  exosome complex exonuclease Rrp41                89.7    6e-17    
ref|WP_015232099.1|  archaeal exosome-like complex exonuclease 1      89.4    6e-17    
gb|KDQ13455.1|  hypothetical protein BOTBODRAFT_160382                89.7    6e-17    
ref|WP_004034311.1|  MULTISPECIES: exosome complex exonuclease 1      89.4    6e-17    
ref|XP_005688846.1|  PREDICTED: exosome complex component RRP41       89.4    7e-17    
ref|XP_009116829.1|  PREDICTED: exosome complex component RRP41-like  89.4    7e-17    
ref|XP_635144.1|  hypothetical protein DDB_G0291328                   89.4    7e-17    
ref|WP_020448383.1|  exosome complex exonuclease Rrp41                89.4    7e-17    
ref|XP_009242473.1|  PREDICTED: exosome complex component RRP41       90.1    8e-17    
ref|XP_008927004.1|  PREDICTED: exosome complex component RRP46       89.0    8e-17    
ref|WP_010885629.1|  exosome complex exonuclease Rrp41                89.4    8e-17    
gb|KFO30640.1|  Exosome complex component RRP41                       89.4    8e-17    
ref|WP_004034851.1|  hypothetical protein                             88.6    9e-17    
ref|WP_011953777.1|  exosome complex exonuclease Rrp41                88.6    1e-16    
ref|WP_010866376.1|  exosome complex exonuclease Rrp41                89.0    1e-16    
gb|KJH47079.1|  putative exosome complex exonuclease 1                88.6    1e-16    
ref|XP_002042132.1|  GM25757                                          88.6    1e-16    



>ref|XP_009804503.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Nicotiana 
sylvestris]
Length=243

 Score =   399 bits (1025),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 190/231 (82%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR+DGRTANQLRPLAC+R VLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRKDGRTANQLRPLACTRNVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+KRT+QSIC+L VHPNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CFEVIWKPKTGQIGKAEKEYEMILKRTVQSICVLNVHPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALVDAGIPLKHLAVAICC LAES +++LDP KLEEQKMKAFVYLVFPNS    LP
Sbjct  121  NAVCAALVDAGIPLKHLAVAICCSLAESGHILLDPSKLEEQKMKAFVYLVFPNSTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +ESL+  GEPME G+ITS THG + VDDY+ CL R RAA+ KLS++LRRSL
Sbjct  181  EESLKVRGEPMEHGLITSFTHGVMSVDDYIRCLERGRAATGKLSDFLRRSL  231



>ref|XP_008220073.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Prunus 
mume]
Length=243

 Score =   394 bits (1013),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR VLNRAHGSASW QG+TKVL AVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRLDGRTPNQLRPLACSRNVLNRAHGSASWCQGDTKVLVAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIE+IWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVIIQVVNDDGALLPCAI
Sbjct  61   CIEIIWKPKTGQSGKLEREYEMILKRTLQSICILTLNPNTTTSVIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICCCLAES YV+LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKHLAVAICCCLAESGYVILDPSKLEEQKMKAFAYLVFPNSVLSILP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +E LQ GGEPME GIITSVT G + VDDYL CL R RAA+ K+S +LR+SL
Sbjct  181  EEQLQVGGEPMEHGIITSVTQGAMSVDDYLHCLERGRAATAKMSAFLRKSL  231



>ref|XP_009620114.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Nicotiana 
tomentosiformis]
Length=243

 Score =   393 bits (1010),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR+DGRTANQLRPLAC+R VLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRKDGRTANQLRPLACTRNVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQ GK EKE EMI+KRT+QSIC+L VHPNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CFEVIWKPKTGQSGKAEKEYEMILKRTVQSICVLNVHPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALVDAGIPLKHLAVAICC L+ES +++LDP KLEEQKMKAFVYLVFPNS    LP
Sbjct  121  NAVCAALVDAGIPLKHLAVAICCSLSESGHILLDPSKLEEQKMKAFVYLVFPNSTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ESL+  GEP E G+ITS THG + VDDY+ CL R RAA+ KLS++LRRSL
Sbjct  181  DESLKVRGEPTEHGLITSFTHGVMSVDDYIRCLERGRAATAKLSDFLRRSL  231



>ref|XP_007223780.1| hypothetical protein PRUPE_ppa010603mg [Prunus persica]
 gb|EMJ24979.1| hypothetical protein PRUPE_ppa010603mg [Prunus persica]
Length=243

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/231 (83%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR VLNRAHGSASW QG+TKVL AVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRLDGRTPNQLRPLACSRNVLNRAHGSASWCQGDTKVLVAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIE+IWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVIIQVVNDDGALLPCAI
Sbjct  61   CIEIIWKPKTGQSGKLEREYEMILKRTLQSICILTLNPNTTTSVIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICCCLAES YVVLDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKHLAVAICCCLAESGYVVLDPSKLEEQKMKAFAYLVFPNSVLSILP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +E LQ GGEP+E GIITSVT G + VDDYL CL R RAA+ K+S +LR+SL
Sbjct  181  EEQLQVGGEPVEHGIITSVTQGAMSVDDYLHCLERGRAATAKMSAFLRKSL  231



>ref|XP_004245172.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Solanum 
lycopersicum]
Length=232

 Score =   392 bits (1006),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR+DGRTANQLRPL+C+R VLNRAHGSASWSQGETKVLAAVYGPKAGT KNENPEKA
Sbjct  1    MEIDRKDGRTANQLRPLSCARNVLNRAHGSASWSQGETKVLAAVYGPKAGTNKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+K+T+QSIC+L VHPNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CFEVIWKPKTGQIGKAEKEYEMILKKTVQSICVLNVHPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALVDAGIPLKHLAVAICCCL ES +++LDP KLEEQ+MKAFVYLVFPNS    LP
Sbjct  121  NALCAALVDAGIPLKHLAVAICCCLTESGHILLDPSKLEEQRMKAFVYLVFPNSTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +E+L+  GEPME G+ITS THG + VDDY+ CL R RAA+ KLS++ RR+L
Sbjct  181  EEALKVRGEPMEHGLITSSTHGVMSVDDYIRCLERGRAATSKLSDFFRRNL  231



>emb|CDP08145.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   392 bits (1006),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/231 (82%), Positives = 202/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR  NQLRP+ACSRG+LNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRGDGRKPNQLRPVACSRGILNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKECEMI+KRTLQSICLL VHPNTTTS+IIQVVNDDG LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKPEKECEMILKRTLQSICLLNVHPNTTTSIIIQVVNDDGGLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            N ACAALVDAGIPLKHLAVAICC LA++  V+LDP+K EEQ MK FVYL FPNS    LP
Sbjct  121  NVACAALVDAGIPLKHLAVAICCSLAKNGRVLLDPNKSEEQNMKGFVYLAFPNSIQSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SLQ GGEP+E GIITSVTHG + VDDYLLCL R RAA EKLS ++R SL
Sbjct  181  EGSLQVGGEPVEHGIITSVTHGAMSVDDYLLCLQRGRAACEKLSVFIRSSL  231



>ref|XP_006359768.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Solanum 
tuberosum]
Length=238

 Score =   391 bits (1004),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M+IDR+DGRTANQLRPL+CSR VLNRAHGSASWSQGETKVLAAVYGPKAGT KNENPEKA
Sbjct  1    MDIDRKDGRTANQLRPLSCSRNVLNRAHGSASWSQGETKVLAAVYGPKAGTNKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK+EKE EMI+K+T+QSIC+L VHPNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CFEVIWKPKTGQIGKEEKEYEMILKKTVQSICVLNVHPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALVDAGIPLKHLAVAICC L ES +++LDP KLEEQ+MKAFVYLVFPNS    LP
Sbjct  121  NALCAALVDAGIPLKHLAVAICCTLTESGHILLDPSKLEEQRMKAFVYLVFPNSTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +E+L+  GEPME G+ITS THG + VDDY+ CL R RAA+ KLS++ RR+L
Sbjct  181  EEALKVRGEPMEHGLITSSTHGVMSVDDYIRCLERGRAATSKLSDFFRRNL  231



>gb|KJB82884.1| hypothetical protein B456_013G218900 [Gossypium raimondii]
Length=242

 Score =   390 bits (1003),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR+ NQLRPLACSR +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDREDGRSQNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTL+S+C+LTV+PNTTTS+I+QVVNDDGALLP AI
Sbjct  61   CIEVIWKPKTGQIGKPEKEYEMILKRTLESVCILTVNPNTTTSIIVQVVNDDGALLPSAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIP+KHLAVA+CCC+A+S YV+LDP KLEEQKMKAF YLVFPNS H  LP
Sbjct  121  NAACMALVDAGIPMKHLAVAVCCCVAKSGYVILDPTKLEEQKMKAFAYLVFPNSVHSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SL+  GEP+E GIITSVTHG + VDDY  CL R RAAS KLS++LRR+L
Sbjct  181  EGSLRVEGEPIENGIITSVTHGIMSVDDYFYCLERGRAASVKLSDFLRRNL  231



>gb|KHG08508.1| Exosome complex component RRP41 [Gossypium arboreum]
Length=242

 Score =   389 bits (998),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 206/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR+ NQLRPLACSR +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDREDGRSQNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTL+SIC+LTV+PNTTTS+I+QVVNDDGALLP AI
Sbjct  61   CIEVIWKPKTGQIGKPEKEYEMILKRTLESICILTVNPNTTTSIIVQVVNDDGALLPSAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIP+KHLAVAICCC+A+S YV+LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACMALVDAGIPMKHLAVAICCCVAKSGYVILDPTKLEEQKMKAFAYLVFPNSVRSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SL+  GEP+E GIITSVTHG + VDDY  CL R RAAS KLS++LRR+L
Sbjct  181  EGSLRVEGEPIENGIITSVTHGIMSVDDYFYCLERGRAASVKLSDFLRRNL  231



>gb|KJB82886.1| hypothetical protein B456_013G218900 [Gossypium raimondii]
Length=243

 Score =   386 bits (991),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 207/232 (89%), Gaps = 1/232 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR+ NQLRPLACSR +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDREDGRSQNQLRPLACSRNILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTL+S+C+LTV+PNTTTS+I+QVVNDDGALLP AI
Sbjct  61   CIEVIWKPKTGQIGKPEKEYEMILKRTLESVCILTVNPNTTTSIIVQVVNDDGALLPSAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEE-QKMKAFVYLVFPNSPHLAL  648
            NAAC ALVDAGIP+KHLAVA+CCC+A+S YV+LDP KLEE QKMKAF YLVFPNS H  L
Sbjct  121  NAACMALVDAGIPMKHLAVAVCCCVAKSGYVILDPTKLEEQQKMKAFAYLVFPNSVHSVL  180

Query  649  PKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            P+ SL+  GEP+E GIITSVTHG + VDDY  CL R RAAS KLS++LRR+L
Sbjct  181  PEGSLRVEGEPIENGIITSVTHGIMSVDDYFYCLERGRAASVKLSDFLRRNL  232



>ref|XP_010049104.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Eucalyptus 
grandis]
 gb|KCW81565.1| hypothetical protein EUGRSUZ_C02924 [Eucalyptus grandis]
Length=243

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR  NQLRPL+CSRGVLNRAHGSASW+QG T+VLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRADGRNPNQLRPLSCSRGVLNRAHGSASWAQGSTQVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             +EVIWKPKTGQIGKQEKE EM++KRTLQSIC+LT+HPNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SVEVIWKPKTGQIGKQEKEYEMVLKRTLQSICILTIHPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVDAGIPLKHLAVAICCCLA+S  V+LDP KLEE+KMKAFVYLV PNS    LP
Sbjct  121  NASCAALVDAGIPLKHLAVAICCCLADSGLVMLDPTKLEEEKMKAFVYLVLPNSILSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +ES    GE ME G+ITSVTHG + VDDYL CL R RAA+ K+S++LRR+L
Sbjct  181  EESSSVKGEQMEQGLITSVTHGVMSVDDYLHCLERGRAATSKMSDFLRRNL  231



>ref|XP_004291185.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Fragaria 
vesca subsp. vesca]
Length=238

 Score =   385 bits (988),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 205/231 (89%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLAC+R VLNRAHGSASW QG+TKVLAAVYGPKAGTK+NENPEKA
Sbjct  1    MEIDRLDGRTPNQLRPLACTRNVLNRAHGSASWCQGDTKVLAAVYGPKAGTKRNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVIIQVVNDDGALLPCAI
Sbjct  61   CIEVIWKPKTGQSGKAEREYEMILKRTLQSICILTLNPNTTTSVIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHL+VAICCCLAES YV+LDP KLEEQKMKAFVYLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKHLSVAICCCLAESGYVILDPSKLEEQKMKAFVYLVFPNSVLSNLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +  L+  GEPME GIITSVT G + V+DYL CL R RAA+ K+S +LR+SL
Sbjct  181  EGQLKVQGEPMEHGIITSVTQGAMPVEDYLHCLERGRAATAKMSAFLRKSL  231



>ref|XP_007012122.1| Ribosomal protein S5 domain 2-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY29741.1| Ribosomal protein S5 domain 2-like superfamily protein isoform 
1 [Theobroma cacao]
Length=240

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 204/231 (88%), Gaps = 2/231 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGRT NQLRPLACSR VL+RAHGSASW QG+TKVLAAVYGPKAG +KNENPEKA
Sbjct  1    MEVDREDGRTQNQLRPLACSRNVLHRAHGSASWYQGDTKVLAAVYGPKAGARKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK EKE EMI+KRTLQSIC+LTV+PNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CIEVIWKPKTGQTGKLEKEYEMILKRTLQSICILTVNPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIP+KHLAVAICCC+A+S YV++DP KLEEQKMK+F YLVFPNS H  LP
Sbjct  121  NAACVALVDAGIPMKHLAVAICCCVAKSGYVIMDPTKLEEQKMKSFAYLVFPNSVHSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S+Q  GEPME GI+TSVTHG + VDDY  CL R  AAS KLS++LRRSL
Sbjct  181  EGSVQ--GEPMEHGIVTSVTHGIMSVDDYFYCLERGCAASAKLSDFLRRSL  229



>ref|XP_008385663.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Malus domestica]
Length=237

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 204/231 (88%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR VLNRAHGSASW+QG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRVDGRTPNQLRPLACSRSVLNRAHGSASWTQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVI+QVVNDDGALLPCAI
Sbjct  61   CIEVIWKPKTGQSGKLEREYEMILKRTLQSICILTLNPNTTTSVIVQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAG PLKHLAVAICCCLAES YV+LDP KLEEQKMKAF YLVFPNS  + L 
Sbjct  121  NAACAALVDAGTPLKHLAVAICCCLAESGYVILDPSKLEEQKMKAFAYLVFPNSLTI-LQ  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +   Q GGEPME GIITSVT G + VDDYL CL R RAA+ K+S +L++SL
Sbjct  180  EGGSQVGGEPMEHGIITSVTQGAMSVDDYLRCLERGRAATAKMSAFLQKSL  230



>gb|KJB82885.1| hypothetical protein B456_013G218900 [Gossypium raimondii]
Length=241

 Score =   384 bits (985),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 206/231 (89%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR+ NQLRPLACSR +L+RAHGSASWSQ +TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDREDGRSQNQLRPLACSRNILHRAHGSASWSQ-DTKVLAAVYGPKAGTKKNENPEKA  59

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTL+S+C+LTV+PNTTTS+I+QVVNDDGALLP AI
Sbjct  60   CIEVIWKPKTGQIGKPEKEYEMILKRTLESVCILTVNPNTTTSIIVQVVNDDGALLPSAI  119

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIP+KHLAVA+CCC+A+S YV+LDP KLEEQKMKAF YLVFPNS H  LP
Sbjct  120  NAACMALVDAGIPMKHLAVAVCCCVAKSGYVILDPTKLEEQKMKAFAYLVFPNSVHSVLP  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SL+  GEP+E GIITSVTHG + VDDY  CL R RAAS KLS++LRR+L
Sbjct  180  EGSLRVEGEPIENGIITSVTHGIMSVDDYFYCLERGRAASVKLSDFLRRNL  230



>ref|XP_009364817.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Pyrus x 
bretschneideri]
Length=237

 Score =   382 bits (981),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 204/231 (88%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSRGVLNRAHGSASW+QG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRVDGRTPNQLRPLACSRGVLNRAHGSASWTQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVI+QVVNDDG+LLPCAI
Sbjct  61   CIEVIWKPKTGQSGKLEREYEMILKRTLQSICILTLNPNTTTSVIVQVVNDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAG PLKHLAVAICCCLAES YV+LDP KLEEQ MKAF YLVFPN+    LP
Sbjct  121  NAACAALVDAGAPLKHLAVAICCCLAESGYVILDPSKLEEQNMKAFAYLVFPNA-LTTLP  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +  L+ GGEPME GIITSVT G + VDDYL  L R RAA+ K+S +L++SL
Sbjct  180  EGGLRVGGEPMEHGIITSVTQGAMSVDDYLHSLERGRAATAKMSAFLQKSL  230



>ref|XP_009364244.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Pyrus x 
bretschneideri]
Length=237

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 187/231 (81%), Positives = 203/231 (88%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR VLNRAHGSASW+QG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRVDGRTPNQLRPLACSRSVLNRAHGSASWTQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVI+QVVNDDGALLPCAI
Sbjct  61   CIEVIWKPKTGQSGKLEREYEMILKRTLQSICVLTLNPNTTTSVIVQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAG PLKHLAVAICCCLAES YV+LDP KLEEQKMKAF YLVFPNS  L L 
Sbjct  121  NAACAALVDAGAPLKHLAVAICCCLAESGYVILDPSKLEEQKMKAFAYLVFPNSLTL-LQ  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +     GGEPME GIITSVT G + VDDYL CL R RAA+ K+S +L++SL
Sbjct  180  EGGSPVGGEPMEHGIITSVTQGAMSVDDYLHCLERGRAATAKMSAFLQKSL  230



>ref|XP_006450678.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 ref|XP_006450680.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63918.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63920.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
Length=243

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTSVIIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSVIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCC AES Y +LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCSAESGYCILDPTKLEEQKMKAFAYLVFPNSILSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GEPME GIITSVTHG + VDDY  CL R RAAS KLS++LRRSL
Sbjct  181  EGSSLVQGEPMEHGIITSVTHGAMSVDDYFHCLERGRAASAKLSDFLRRSL  231



>ref|XP_007012123.1| Ribosomal protein S5 domain 2-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY29742.1| Ribosomal protein S5 domain 2-like superfamily protein isoform 
2 [Theobroma cacao]
Length=236

 Score =   376 bits (965),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 202/231 (87%), Gaps = 6/231 (3%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGRT NQLRPLACSR VL+RAHGSASW QG+TKVLAAVYGPKAG +KNENPEKA
Sbjct  1    MEVDREDGRTQNQLRPLACSRNVLHRAHGSASWYQGDTKVLAAVYGPKAGARKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK EKE EMI+KRTLQSIC+LTV+PNTTTS+IIQVVNDDGALLPCAI
Sbjct  61   CIEVIWKPKTGQTGKLEKEYEMILKRTLQSICILTVNPNTTTSIIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIP+KHLAVAICCC+A+S YV++DP KLEEQKMK+F YLVFPNS H  LP
Sbjct  121  NAACVALVDAGIPMKHLAVAICCCVAKSGYVIMDPTKLEEQKMKSFAYLVFPNSVHSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S+Q  GEPME GI+TSVTH    VDDY  CL R  AAS KLS++LRRSL
Sbjct  181  EGSVQ--GEPMEHGIVTSVTH----VDDYFYCLERGCAASAKLSDFLRRSL  225



>ref|XP_004150286.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Cucumis 
sativus]
 gb|KGN62820.1| hypothetical protein Csa_2G374620 [Cucumis sativus]
Length=243

 Score =   376 bits (966),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACS  VLNRAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRDDGRTPNQLRPLACSCNVLNRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK E+ECEMI+KRTLQSIC+LT +PNTTTS+I+QV++DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQIGKLERECEMILKRTLQSICILTTNPNTTTSIIVQVIHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVDAGIPLKHLAVAI CCL+E+ YV+LDP K+EE+KMKA V+LVFPN+P   +P
Sbjct  121  NASCAALVDAGIPLKHLAVAISCCLSENGYVILDPTKIEEEKMKASVHLVFPNAPVSVVP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S Q  GEP+E GIITSVT G + VDDY+ CL R RAA+ K+S +LRRSL
Sbjct  181  EGSTQGVGEPLEHGIITSVTQGAMSVDDYIHCLERGRAATTKMSAFLRRSL  231



>ref|XP_002324223.2| hypothetical protein POPTR_0018s00300g [Populus trichocarpa]
 gb|EEF02788.2| hypothetical protein POPTR_0018s00300g [Populus trichocarpa]
Length=243

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 202/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGR+ +QLRPL+C+R VL+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MESDRDDGRSPSQLRPLSCARNVLHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTLQSIC+LT++PNTTTS+I+QVVNDDGALL CAI
Sbjct  61   CIEVIWKPKTGQIGKLEKEFEMILKRTLQSICILTLNPNTTTSIIVQVVNDDGALLVCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLAE  YV+LDP KLEEQKM+ F YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLAEGGYVILDPTKLEEQKMRGFAYLVFPNSVVSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +      GEPME GIITSVTHG + V++YL CL R RAAS KLS++LRRSL
Sbjct  181  EGLSHVEGEPMEHGIITSVTHGVMSVEEYLKCLERGRAASTKLSDFLRRSL  231



>ref|XP_008445020.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Cucumis 
melo]
Length=243

 Score =   376 bits (965),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 204/231 (88%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACS  VLNRAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRDDGRTPNQLRPLACSCNVLNRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK E+ECEMI+KRTLQSIC+LT +PNTTTS+I+QV++DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQIGKLERECEMILKRTLQSICILTTNPNTTTSIIVQVIHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVDAGIPLKHLAVAI CCL+E+ YV+LDP K+EE+KMKA V+LVFPN+P   +P
Sbjct  121  NASCAALVDAGIPLKHLAVAISCCLSENGYVILDPTKIEEEKMKASVHLVFPNTPVSVVP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S Q  GEP+E G+ITSVT G + VDDY+ CL R RAA+ K+S +LRRSL
Sbjct  181  EGSTQGVGEPLEHGMITSVTQGAMSVDDYIHCLERGRAATTKMSAFLRRSL  231



>ref|XP_006476041.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Citrus sinensis]
 ref|XP_006476042.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Citrus sinensis]
 ref|XP_006476043.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X3 [Citrus sinensis]
Length=243

 Score =   375 bits (964),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTS IIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSFIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCC AES Y +LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCSAESGYCILDPTKLEEQKMKAFAYLVFPNSILSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GEPME GIITSVTHG + VDDY  CL R RAAS KLS++LRRSL
Sbjct  181  EGSSLVQGEPMEHGIITSVTHGAMSVDDYFHCLERGRAASAKLSDFLRRSL  231



>gb|KDO79811.1| hypothetical protein CISIN_1g024064mg [Citrus sinensis]
 gb|KDO79812.1| hypothetical protein CISIN_1g024064mg [Citrus sinensis]
Length=243

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTSVIIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSVIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCC AES Y +LDP KLEEQKMK F YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCSAESGYCILDPTKLEEQKMKGFAYLVFPNSILSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GEPME GIITSVTHG + VDDY  CL R RAAS KLS++LRRSL
Sbjct  181  EGSSLVQGEPMEHGIITSVTHGAMSVDDYFHCLERGRAASAKLSDFLRRSL  231



>ref|XP_010514947.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010514948.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010514949.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010514950.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010514951.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
Length=242

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMSAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SL A GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  EGSLVAEGEPVEHGIITSVTHGVMSVDDYFLCVENGRAATASLSAFFRKNF  231



>ref|XP_010244439.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Nelumbo 
nucifera]
 ref|XP_010244440.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Nelumbo 
nucifera]
Length=243

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGRT NQLRPLACSR +LNRAHGSA WSQG+T VLAAVYGPKAGT+KNENPEKA
Sbjct  1    MEVDRVDGRTRNQLRPLACSRNLLNRAHGSARWSQGDTIVLAAVYGPKAGTRKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK EKE EMI+KRTLQSICLLTV+PNTTTS+I+QVVNDDG+LLPCAI
Sbjct  61   SIEVIWKPKTGQIGKPEKEYEMILKRTLQSICLLTVYPNTTTSIIVQVVNDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHL+VAICCCL E+  VVLDP KLEEQKM+AF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKHLSVAICCCLEENGTVVLDPTKLEEQKMQAFAYLVFPNSVLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +       EP+E GIITSVTHG + VDDYL CL R R+AS K+S++LRRSL
Sbjct  181  QGPSSVESEPLEHGIITSVTHGVMSVDDYLHCLERGRSASAKISDFLRRSL  231



>ref|XP_010503239.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
Length=242

 Score =   373 bits (958),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEIDRVDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKECEMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKVEKECEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMSAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S  A GEP+E GIITSVTHG + VDDY LC+    AA+  LS + R++ 
Sbjct  181  EGSSVAEGEPVEHGIITSVTHGVMSVDDYFLCVENGHAATASLSAFFRKNF  231



>ref|XP_012089928.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Jatropha 
curcas]
 gb|KDP22671.1| hypothetical protein JCGZ_02513 [Jatropha curcas]
Length=244

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 201/232 (87%), Gaps = 0/232 (0%)
 Frame = +1

Query  109  VMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEK  288
            ++EI R DGRT NQLRPLACSR VL+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEK
Sbjct  1    MVEISRDDGRTPNQLRPLACSRNVLHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEK  60

Query  289  ACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCA  468
            ACIEVIWKPKTGQIGK EKE EMI+KRTLQ IC+LT++PNTTTSVIIQVV+DDGALL CA
Sbjct  61   ACIEVIWKPKTGQIGKLEKEYEMILKRTLQGICILTINPNTTTSVIIQVVHDDGALLTCA  120

Query  469  INAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLAL  648
            INAACAALVDAGIPL+HLAVAICCCLAE  YV+LDP KLEEQKMK F YLVFPNS    L
Sbjct  121  INAACAALVDAGIPLRHLAVAICCCLAEGGYVILDPTKLEEQKMKGFAYLVFPNSIQSVL  180

Query  649  PKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            P+ S    GEP+E GI+TSVTHG + V++YL CL+R RAA  KLS++ R+ L
Sbjct  181  PQGSALVEGEPIEHGILTSVTHGVMSVEEYLKCLDRGRAACAKLSDFFRKVL  232



>ref|XP_002877464.1| hypothetical protein ARALYDRAFT_485002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53723.1| hypothetical protein ARALYDRAFT_485002 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   372 bits (954),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKVEKEYEMIMKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ Y+VLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYLVLDPNKLEEKKMTAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S  A GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  EGSSVAEGEPVEHGIITSVTHGVMSVDDYFLCVENGRAATASLSAFFRKNF  231



>ref|XP_008352563.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Malus domestica]
Length=237

 Score =   371 bits (952),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSRG LNRAHGSASW+QG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRVDGRTPNQLRPLACSRGFLNRAHGSASWTQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEV+WKPKTG  GK E+E EMI+KRTLQSIC+LT++PNTTTSVI+QVVNDDG+LLPCAI
Sbjct  61   CIEVVWKPKTGXSGKLEREYEMILKRTLQSICILTLNPNTTTSVIVQVVNDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAG PLKHLAVA CCCLAES Y++LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGTPLKHLAVAXCCCLAESGYIILDPSKLEEQKMKAFAYLVFPNS-LTTLP  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +  L  GGEPME GIITSVT G + VDDYL  L R  AA+ K+S +L++ L
Sbjct  180  EGGLLVGGEPMEHGIITSVTQGAMSVDDYLHSLERGCAATAKMSAFLQKRL  230



>ref|NP_190207.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 ref|NP_001030817.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 ref|NP_001030818.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 ref|NP_001030819.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 ref|NP_001078250.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 ref|NP_001190019.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 emb|CAB90948.1| putative protein [Arabidopsis thaliana]
 gb|AAO24557.1| At3g46210 [Arabidopsis thaliana]
 dbj|BAF00127.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19939.1| AT3G46210 [Arabidopsis thaliana]
 dbj|BAH20201.1| AT3G46210 [Arabidopsis thaliana]
 gb|AEE78129.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEE78130.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEE78131.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEE78132.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEE78133.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEE78134.1| ribosomal protein S5 domain 2-like superfamily protein [Arabidopsis 
thaliana]
Length=239

 Score =   370 bits (951),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 200/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPK+GQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKSGQIGKVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLAE+ Y+VLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLAENGYLVLDPNKLEEKKMTAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S  A GEP+E GIITS+THG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  EGSSVAEGEPVEHGIITSITHGVMSVDDYFLCVENGRAATASLSAFFRKNF  231



>ref|XP_007223779.1| hypothetical protein PRUPE_ppa010603mg [Prunus persica]
 gb|EMJ24978.1| hypothetical protein PRUPE_ppa010603mg [Prunus persica]
Length=235

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 197/231 (85%), Gaps = 8/231 (3%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR VLNRAHGSASW QG+TKVL AVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRLDGRTPNQLRPLACSRNVLNRAHGSASWCQGDTKVLVAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIE+IWKPKTGQ GK E+E EMI+KRTLQSIC+LT++PNTTTSVIIQVVNDDGALLPCAI
Sbjct  61   CIEIIWKPKTGQSGKLEREYEMILKRTLQSICILTLNPNTTTSVIIQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKH        LAES YVVLDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKH--------LAESGYVVLDPSKLEEQKMKAFAYLVFPNSVLSILP  172

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +E LQ GGEP+E GIITSVT G + VDDYL CL R RAA+ K+S +LR+SL
Sbjct  173  EEQLQVGGEPVEHGIITSVTQGAMSVDDYLHCLERGRAATAKMSAFLRKSL  223



>ref|XP_006291764.1| hypothetical protein CARUB_v10017935mg [Capsella rubella]
 gb|EOA24662.1| hypothetical protein CARUB_v10017935mg [Capsella rubella]
Length=242

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEVDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM A  YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMTALAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S  A GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  EGSSVAEGEPVEHGIITSVTHGVMSVDDYFLCVENGRAATASLSAFFRKNF  231



>emb|CDX86067.1| BnaC03g55820D [Brassica napus]
Length=238

 Score =   367 bits (941),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 199/231 (86%), Gaps = 4/231 (2%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPK+GT+KNENPEKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKSGTRKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPK+GQIGK EKE EMI+K+T+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKSGQIGKAEKEFEMILKKTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVA+CCCLA+S YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAVCCCLADSGYVVLDPNKLEEKKMTAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                +  GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  ----EVEGEPVEHGIITSVTHGVMSVDDYFLCVENGRAATASLSAFFRKNF  227



>ref|XP_006418935.1| hypothetical protein EUTSA_v10002814mg [Eutrema salsugineum]
 gb|ESQ37371.1| hypothetical protein EUTSA_v10002814mg [Eutrema salsugineum]
Length=240

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 202/231 (87%), Gaps = 2/231 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C E+IWKPK+GQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFELIWKPKSGQIGKAEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMTAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S +  GEP+E G+ITSVT+G + VDDY LC+   RAA+  LS ++R++ 
Sbjct  181  EGSSE--GEPVEHGLITSVTYGVMSVDDYFLCVENGRAATASLSAFIRKNF  229



>ref|XP_009149983.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Brassica 
rapa]
 ref|XP_009149984.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Brassica 
rapa]
Length=238

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 197/231 (85%), Gaps = 4/231 (2%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPK GT+KNENPEKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKPGTRKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPK+GQIGK EKE E+I+K+T+ SIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKSGQIGKAEKEFEIILKKTIHSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA+S YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADSGYVVLDPNKLEEKKMTAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                +  GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  ----EVEGEPVEHGIITSVTHGVMSVDDYFLCVETGRAATASLSAFFRKNF  227



>ref|XP_010648497.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Vitis vinifera]
 ref|XP_010648498.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Vitis vinifera]
Length=245

 Score =   361 bits (926),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/233 (79%), Positives = 203/233 (87%), Gaps = 0/233 (0%)
 Frame = +1

Query  106  LVMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPE  285
            + MEI R DGRTANQLRPLACSR +LNRAHGSASWSQG+TKVLAAVYGPKAGTKKNENPE
Sbjct  1    MSMEIGRDDGRTANQLRPLACSRNILNRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPE  60

Query  286  KACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC  465
            KACIEV+WKPKTGQIGK EKE E+I+KRTL+SICLL ++PNTTTS+IIQVV+DDGALLPC
Sbjct  61   KACIEVVWKPKTGQIGKPEKEYEVILKRTLKSICLLNINPNTTTSIIIQVVSDDGALLPC  120

Query  466  AINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLA  645
            AINAACAALVDA IPLKHLAVAICCCL ES YV+LDP K+EEQKMKAF YLVFPNS    
Sbjct  121  AINAACAALVDAAIPLKHLAVAICCCLTESGYVILDPTKVEEQKMKAFAYLVFPNSAISI  180

Query  646  LPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            +P+ S    GE ME GIITSVTHG + VDDYL CL R +AAS K+S +LRRSL
Sbjct  181  IPEGSSHMEGELMEHGIITSVTHGVMSVDDYLHCLERGQAASTKMSAFLRRSL  233



>emb|CBI20856.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 202/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEI R DGRTANQLRPLACSR +LNRAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIGRDDGRTANQLRPLACSRNILNRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEV+WKPKTGQIGK EKE E+I+KRTL+SICLL ++PNTTTS+IIQVV+DDGALLPCAI
Sbjct  61   CIEVVWKPKTGQIGKPEKEYEVILKRTLKSICLLNINPNTTTSIIIQVVSDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDA IPLKHLAVAICCCL ES YV+LDP K+EEQKMKAF YLVFPNS    +P
Sbjct  121  NAACAALVDAAIPLKHLAVAICCCLTESGYVILDPTKVEEQKMKAFAYLVFPNSAISIIP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GE ME GIITSVTHG + VDDYL CL R +AAS K+S +LRRSL
Sbjct  181  EGSSHMEGELMEHGIITSVTHGVMSVDDYLHCLERGQAASTKMSAFLRRSL  231



>emb|CDX99121.1| BnaA06g18120D [Brassica napus]
Length=246

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 199/239 (83%), Gaps = 12/239 (5%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT+NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPK GT+KNENPEKA
Sbjct  1    MEIDREDGRTSNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKPGTRKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVII--------QVVNDD  447
            C EVIWKPK+GQIGK EKE EMI+K+T+QSIC+LTV+PNTTTSVII        QVV+DD
Sbjct  61   CFEVIWKPKSGQIGKAEKEFEMILKKTIQSICVLTVNPNTTTSVIIQAIICFLVQVVHDD  120

Query  448  GALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFP  627
            G+LLPCAINAACAALVDAGIP+KHLAVAICCCLA+S YVVLDP+KLEE+KM AF YLVFP
Sbjct  121  GSLLPCAINAACAALVDAGIPMKHLAVAICCCLADSGYVVLDPNKLEEKKMTAFAYLVFP  180

Query  628  NSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            N+    LP    +  GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  181  NTTLSVLP----EVEGEPVEHGIITSVTHGVMSVDDYFLCIETGRAATASLSAFFRKNF  235



>gb|KDO79813.1| hypothetical protein CISIN_1g024064mg [Citrus sinensis]
Length=273

 Score =   360 bits (924),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/261 (70%), Positives = 200/261 (77%), Gaps = 30/261 (11%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQG------------------------  219
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG                        
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGFRFIQTSHFYHFNLFVFTSKCYFC  60

Query  220  ------ETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQS  381
                  +TKVLAAVYGPKAGTKKNENPEKA IEVIWKP+TGQIGK EKE E+I+KRTLQS
Sbjct  61   YWVGSGDTKVLAAVYGPKAGTKKNENPEKASIEVIWKPRTGQIGKPEKEYEIILKRTLQS  120

Query  382  ICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKY  561
            IC+LT++PNTTTSVIIQVV+DDGALLPCAINAACAALVDAGIP+KHLAVAICCC AES Y
Sbjct  121  ICILTINPNTTTSVIIQVVHDDGALLPCAINAACAALVDAGIPMKHLAVAICCCSAESGY  180

Query  562  VVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYL  741
             +LDP KLEEQKMK F YLVFPNS    LP+ S    GEPME GIITSVTHG + VDDY 
Sbjct  181  CILDPTKLEEQKMKGFAYLVFPNSILSVLPEGSSLVQGEPMEHGIITSVTHGAMSVDDYF  240

Query  742  LCLNRARAASEKLSEYLRRSL  804
             CL R RAAS KLS++LRRSL
Sbjct  241  HCLERGRAASAKLSDFLRRSL  261



>gb|KHM99392.1| Exosome complex exonuclease RRP46 like [Glycine soja]
Length=243

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGRT NQLRPL CS  +L+R+HGSASW+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRPDGRTPNQLRPLVCSCSILHRSHGSASWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK EKE EMI+KRTL+SIC+ T++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQIGKVEKEYEMILKRTLESICIRTIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICC + +S  ++LDP K EE+KMKAF+ LVFPN+    LP
Sbjct  121  NAACAALVDAGIPLKHLAVAICCSVTDSGCIILDPTKDEEEKMKAFINLVFPNTIVSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SLQAG EPM  GI+TS+T G + VDDYL CL R RAAS +LSE++R+++
Sbjct  181  EGSLQAGSEPMAHGIMTSITQGAMSVDDYLHCLERGRAASARLSEFVRKNI  231



>gb|AFK43786.1| unknown [Lotus japonicus]
Length=243

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR+ NQLRPLACSR VL+RAHGSASW+QGETKV AAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRADGRSPNQLRPLACSRSVLHRAHGSASWAQGETKVFAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV WKP TGQIG+ EK  EMI+KRTL+SIC+ +++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SIEVTWKPNTGQIGQVEKGYEMILKRTLESICIRSIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPL+HLAVAICC +A++  ++LDP K EE+K KAF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPLRHLAVAICCSVADNSCIILDPTKQEEEKAKAFAYLVFPNTNISVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S Q G EPM  GIITSVT G + VDDYL CL R RA SE+LSE+LR+++
Sbjct  181  EGSSQGGSEPMAHGIITSVTQGAMSVDDYLRCLERGRATSERLSEFLRKNI  231



>ref|XP_010426057.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010426058.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
 ref|XP_010426059.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Camelina 
sativa]
Length=242

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNEN EKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPKTGQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKTGQIGKVEKEYEMIMKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM AF YLVFPN+    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMSAFAYLVFPNTTLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCL  750
            + S  A GEP+E GIITSVTHG + VDDY LC+
Sbjct  181  EGSSVADGEPVEHGIITSVTHGVMSVDDYFLCV  213



>ref|XP_010541255.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Tarenaya 
hassleriana]
 ref|XP_010541256.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Tarenaya 
hassleriana]
 ref|XP_010541257.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Tarenaya 
hassleriana]
Length=243

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 198/233 (85%), Gaps = 0/233 (0%)
 Frame = +1

Query  106  LVMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPE  285
            + M+IDR DGR  NQLRPLACSR +L+RAHGSASWSQG+TKVL AVYGPKAGTK+NENPE
Sbjct  1    MSMDIDREDGRAPNQLRPLACSRNILHRAHGSASWSQGDTKVLVAVYGPKAGTKRNENPE  60

Query  286  KACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC  465
            KAC EVIWKPKTGQIGK E+E EM++K+TLQSIC+LTV+PNTTTSVI+QVV+DDG+LLPC
Sbjct  61   KACFEVIWKPKTGQIGKVEREYEMVLKKTLQSICVLTVNPNTTTSVIVQVVHDDGSLLPC  120

Query  466  AINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLA  645
            A+NAACAALV+AGIP+KHLAVAICCCLA++ Y +LDP+K+EEQKMKAF  LVFPNS    
Sbjct  121  AVNAACAALVEAGIPMKHLAVAICCCLADNGYAILDPNKIEEQKMKAFACLVFPNSILSV  180

Query  646  LPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            LP+ S    GEP E GIITS T+G + V+DY LC+ R +AAS  LS + R++ 
Sbjct  181  LPEGSSLVEGEPAEHGIITSTTYGVMSVEDYFLCVERGQAASASLSAFFRKNF  233



>ref|XP_003552384.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Glycine max]
 ref|XP_006602785.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Glycine max]
Length=243

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 199/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGRT NQLRPL CS  +L+R+HGSASW+QGETKVLAAVYGPKAGTKK+ENPEKA
Sbjct  1    METDRPDGRTPNQLRPLVCSCSILHRSHGSASWAQGETKVLAAVYGPKAGTKKSENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK EKE EMI+KRTL+SIC+ T++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQIGKVEKEYEMILKRTLESICIRTIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICC + +S  ++LDP K EE+KMKAF+ LVFPN+    LP
Sbjct  121  NAACAALVDAGIPLKHLAVAICCSVTDSGCIILDPTKDEEEKMKAFINLVFPNTIVSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + SLQAG EPM  GI+TS+T G + VDDYL CL R RAAS +LSE++R+++
Sbjct  181  EGSLQAGSEPMAHGIMTSITQGAMSVDDYLHCLERGRAASARLSEFVRKNI  231



>ref|XP_003534569.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Glycine max]
 ref|XP_006587855.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Glycine max]
 gb|KHN29369.1| Exosome complex exonuclease RRP46 like [Glycine soja]
Length=243

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGRT NQLRPLACS  +L+RAHGSASW+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRPDGRTPNQLRPLACSCSILHRAHGSASWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK EKE EMI+KRTL+SIC+ T++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQIGKLEKEYEMILKRTLESICIRTIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAAC ALVDAGIPLKHLAVAICC + +S  ++LDP K EE+KMKA++ LVFPN+    LP
Sbjct  121  NAACTALVDAGIPLKHLAVAICCSVTDSGCIILDPTKEEEEKMKAYINLVFPNTIVSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S Q G EPM  GI+TSVT G + VDDYL CL+R RAAS +LSE++R+++
Sbjct  181  ERSSQVGSEPMAHGIMTSVTQGAMSVDDYLHCLDRGRAASARLSEFVRKNI  231



>ref|XP_003623909.1| Exosome complex exonuclease RRP46 [Medicago truncatula]
 gb|AES80127.1| exosome complex exonuclease RRP46 [Medicago truncatula]
Length=243

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 198/231 (86%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR+ NQLRPLACS  VL+RAHGSA+W+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRPDGRSPNQLRPLACSHSVLHRAHGSATWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP TG +G+ ++E EMI+K+TL+SIC+ T++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SIEVIWKPNTGHVGQADREYEMILKKTLESICIRTIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPL+HLAVAICC + ++  ++LDP K EE+K KAF YLVFPN+    +P
Sbjct  121  NAACAALVDAGIPLRHLAVAICCSVTDNNSIILDPSKKEEEKSKAFAYLVFPNTTVSVVP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            ++S Q G +PM  GIITSVTHG + VDDYL CL R RA +++LSE+LR+++
Sbjct  181  EKSSQVGNDPMAHGIITSVTHGAMSVDDYLHCLERGRATTQRLSEFLRKNI  231



>ref|XP_010668302.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 196/231 (85%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGRT   LRPLACS  VLNRAHGSASWSQG+TKVLAAVYGP+AGTKKNENPEKA
Sbjct  1    MEVDRVDGRTPTMLRPLACSINVLNRAHGSASWSQGDTKVLAAVYGPRAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             +EVIWKPKTGQ+GK E+E EMI+KRTLQSIC+LTV+PNTTTS+I+QVVNDDGALLPCAI
Sbjct  61   SVEVIWKPKTGQVGKLEREYEMILKRTLQSICILTVNPNTTTSIIVQVVNDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAG+PLKHLAVAICCCLAE+  V+LDP K EEQ+MKAFVYLVFPNS  L++ 
Sbjct  121  NAACAALVDAGVPLKHLAVAICCCLAETGCVILDPTKQEEQEMKAFVYLVFPNS-MLSVL  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S     EPME GIITSVTHG + V+DY  CL    AA+ KLS +LR  L
Sbjct  180  QGSSHTDDEPMEHGIITSVTHGAMSVEDYFDCLKIGCAATAKLSGFLRSRL  230



>ref|XP_011007654.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Populus euphratica]
Length=243

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 201/231 (87%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGR+ +QLRPL+C+R VL RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRDDGRSPSQLRPLSCARNVLCRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTLQSIC+LT++PNTTTS+I+QVVNDDGALL CA+
Sbjct  61   CIEVIWKPKTGQIGKLEKEFEMILKRTLQSICILTLNPNTTTSIIVQVVNDDGALLVCAV  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLAE  YV+LDP KLEEQKM+ F  LVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLAEDGYVILDPTKLEEQKMRGFACLVFPNSVASVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GEPME GIITSVTHG + V++YL CL R RAAS KLS++LRRSL
Sbjct  181  EGSSHVEGEPMEHGIITSVTHGVMSVEEYLKCLERGRAASAKLSDFLRRSL  231



>ref|XP_004492714.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Cicer arietinum]
 ref|XP_004492715.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Cicer arietinum]
 ref|XP_004492716.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X3 [Cicer arietinum]
Length=243

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 197/230 (86%), Gaps = 0/230 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGR+ NQLRPLACS  VL+RAHGSA+W+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEKDRPDGRSPNQLRPLACSHSVLHRAHGSATWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             +EVIWKP TG IG+ ++E EMI+K+TL+SIC+ T++PNTTTSVI+QVV+DDGALLPCAI
Sbjct  61   SVEVIWKPNTGHIGQVDREYEMILKKTLESICIRTIYPNTTTSVIVQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICC + +S  ++LDP K EE+K KAF YLVFPNS    +P
Sbjct  121  NAACAALVDAGIPLKHLAVAICCSVTDSNCIILDPSKQEEEKAKAFAYLVFPNSTVSVIP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
            ++S QAG +PM  GIITSVTHG + VDDYL CL R RAA+ +LSE+LR++
Sbjct  181  EKSSQAGSDPMAHGIITSVTHGAMLVDDYLHCLERGRAATLRLSEFLRKN  230



>ref|XP_002516498.1| Exosome complex exonuclease RRP46, putative [Ricinus communis]
 gb|EEF45839.1| Exosome complex exonuclease RRP46, putative [Ricinus communis]
Length=211

 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M+IDR DGRT NQLRPLACSR VLNRAHGSASW QG+TKVLAAVYGPK GTKKNENPEKA
Sbjct  1    MDIDRDDGRTPNQLRPLACSRNVLNRAHGSASWCQGDTKVLAAVYGPKPGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTLQ+IC+LT++PNTTTSVI+QVV+DDGALL CAI
Sbjct  61   CIEVIWKPKTGQIGKVEKEYEMILKRTLQTICVLTINPNTTTSVIVQVVHDDGALLTCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCL+ES YV+LDP KLEEQKMK F YLVFPNS H  L 
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLSESGYVILDPTKLEEQKMKGFTYLVFPNSVHSVLQ  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEV  729
            KES+   GEPM+ GIITSVTHG + V
Sbjct  181  KESVLVEGEPMDHGIITSVTHGVMSV  206



>ref|XP_009396849.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 186/231 (81%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M +DR DGR+ NQLRPLACSR +L+RAHGSA WSQG+T VLAAVYGPKAGTKK ENPEKA
Sbjct  4    MTVDRADGRSVNQLRPLACSRNILHRAHGSARWSQGDTIVLAAVYGPKAGTKKGENPEKA  63

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQIGK EKE EMI+KRTLQSICL+T+HPNTTTS+I+QV  DDGALLPCAI
Sbjct  64   SIEVIWKPKTGQIGKLEKEYEMILKRTLQSICLMTIHPNTTTSIIVQVFGDDGALLPCAI  123

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVDAGIPLKHLAVAICC L E    +LDP K EEQK++AF YLVFPNSP   LP
Sbjct  124  NASCAALVDAGIPLKHLAVAICCGLTEGGSAILDPTKAEEQKIQAFAYLVFPNSPLSILP  183

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                     P+E GIITSVTHG + V DY  CL R RAA  K+SE+ RRS 
Sbjct  184  SAPSAEVDGPIENGIITSVTHGVMPVVDYFNCLERGRAACAKISEFHRRSF  234



>ref|XP_010090354.1| Exosome complex exonuclease RRP46-like protein [Morus notabilis]
 gb|EXB39324.1| Exosome complex exonuclease RRP46-like protein [Morus notabilis]
Length=313

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 198/257 (77%), Gaps = 26/257 (10%)
 Frame = +1

Query  82   RVSHFHYLLVMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAG  261
            ++SH    + MEIDR DGRT NQLRPLACSR VLNRAHGSASWSQG+TKVLAAVYGPKAG
Sbjct  61   KISHCERKIAMEIDRIDGRTPNQLRPLACSRNVLNRAHGSASWSQGDTKVLAAVYGPKAG  120

Query  262  TKKNENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVN  441
            TKK+ENPEKACIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LTV+PNTTTSVIIQVVN
Sbjct  121  TKKHENPEKACIEVIWKPKTGQTGKSEREYEMILKRTLQSICILTVNPNTTTSVIIQVVN  180

Query  442  DDGALLPCAINAACAALVDAGIPLKHLA----------------VAICCCLAESKYVVLD  573
            DDGA+          +  DAGIPLKHLA                VAICC LAES YV+LD
Sbjct  181  DDGAV----------SFKDAGIPLKHLAGSNTYVVNDDGAVSFKVAICCGLAESGYVILD  230

Query  574  PDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLN  753
            P KLEEQKMKAF YLVFPNS   ALP+ S +  GEPME GIITSVT G + VDDY  CL 
Sbjct  231  PAKLEEQKMKAFAYLVFPNSVLSALPEGSPKVEGEPMENGIITSVTQGAMAVDDYFHCLE  290

Query  754  RARAASEKLSEYLRRSL  804
            R RAA+EK+S +LRRSL
Sbjct  291  RGRAANEKMSAFLRRSL  307



>gb|KFK33969.1| exosome complex component rrp46 [Arabis alpina]
Length=243

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 192/239 (80%), Gaps = 15/239 (6%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTK+NE+PEKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKRNEDPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPK+GQIGK EKE EMI+K+T+QSIC+LTV+PNTTTSVIIQ       LLPCAI
Sbjct  61   CFEVIWKPKSGQIGKVEKEYEMILKKTIQSICVLTVNPNTTTSVIIQ-------LLPCAI  113

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEE--------QKMKAFVYLVFP  627
            NAACAALVDAGIP+KHLAVAICCCLA+  YVVLDP+KLEE        QKM AF YLVFP
Sbjct  114  NAACAALVDAGIPMKHLAVAICCCLADKGYVVLDPNKLEEKTYLNYDGQKMTAFAYLVFP  173

Query  628  NSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            N+    LPK S    GEP+E GIITSVTHG + VDDY LC+   RAA+  LS + R++ 
Sbjct  174  NTTLSVLPKGSSVVEGEPVEHGIITSVTHGVMSVDDYFLCVENGRAATASLSAFFRKNF  232



>ref|XP_008786334.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X1 [Phoenix dactylifera]
Length=240

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+ R DGRT NQLRPLACSR +L+RAHGSA WSQG+T VLAAVYGPKAGT+K ENPEKA
Sbjct  1    MEVVRADGRTPNQLRPLACSRNLLHRAHGSARWSQGDTIVLAAVYGPKAGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK+EKE EMI+KRTLQSICLLT+HPNTTTS+I+QVV DDGALLPCAI
Sbjct  61   CIEVIWKPKTGQIGKEEKEYEMILKRTLQSICLLTIHPNTTTSIILQVVGDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVD+GIPLKHLAVAICC L E+  V+LDP K EEQKM+AF YLVFPNSP   LP
Sbjct  121  NASCAALVDSGIPLKHLAVAICCGLTETGSVILDPTKAEEQKMRAFAYLVFPNSPLSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            K       EP   GIITSVTHG +    Y+ CL    AA  K+SE+LRRS+
Sbjct  181  KAPSAVDDEP---GIITSVTHGLMSECHYINCLGHGHAACAKISEFLRRSM  228



>gb|ABD33427.2| Peptidase S8 and S53, subtilisin, kexin, sedolisin; 3 exoribonuclease 
[Medicago truncatula]
Length=241

 Score =   345 bits (886),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 196/231 (85%), Gaps = 2/231 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR+ NQLRPLACS  VL+RAHGSA+W+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRPDGRSPNQLRPLACSHSVLHRAHGSATWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP TG +G+ ++E EMI+K+TL+SIC+ T++PNTTTSVI  VV+DDGALLPCAI
Sbjct  61   SIEVIWKPNTGHVGQADREYEMILKKTLESICIRTIYPNTTTSVI--VVHDDGALLPCAI  118

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPL+HLAVAICC + ++  ++LDP K EE+K KAF YLVFPN+    +P
Sbjct  119  NAACAALVDAGIPLRHLAVAICCSVTDNNSIILDPSKKEEEKSKAFAYLVFPNTTVSVVP  178

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            ++S Q G +PM  GIITSVTHG + VDDYL CL R RA +++LSE+LR+++
Sbjct  179  EKSSQVGNDPMAHGIITSVTHGAMSVDDYLHCLERGRATTQRLSEFLRKNI  229



>gb|EYU20440.1| hypothetical protein MIMGU_mgv1a012696mg [Erythranthe guttata]
Length=243

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 194/231 (84%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M+ +R+ GR ANQLRP+ CSR VL+RAHGSAS S GET+VLAAVYGPKAGTKKNENPEKA
Sbjct  1    MDSERKGGRGANQLRPVDCSRNVLSRAHGSASCSHGETRVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIE+ WKPKTGQIGK EKE EMI+KRTL++ICLLTVHPNTTTS+I+QVV+DDG+LLPCAI
Sbjct  61   CIEITWKPKTGQIGKPEKEFEMILKRTLENICLLTVHPNTTTSIIVQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            +AACAAL+DAGIPLK+LAVAICCCL ES  ++LDP KLEEQKMKAFV LVFP+S H  LP
Sbjct  121  HAACAALLDAGIPLKYLAVAICCCLTESGNILLDPSKLEEQKMKAFVCLVFPSSIHSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S+  GGE    GIITS+THG + V+DY  C+ + RAA   LS  L++ L
Sbjct  181  EGSISIGGESKGDGIITSLTHGVMRVEDYFQCVEQGRAAITPLSNILKKKL  231



>ref|XP_010933463.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Elaeis 
guineensis]
 ref|XP_010933464.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Elaeis 
guineensis]
Length=240

 Score =   340 bits (871),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 185/231 (80%), Gaps = 3/231 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+ R DGRT NQLRPLACSR +L+RAHGSA WSQG+T VLAAVYGPKAG +K ENPEKA
Sbjct  1    MEVVRADGRTPNQLRPLACSRNLLHRAHGSARWSQGDTIVLAAVYGPKAGIRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKPKTGQ GK EKE EMI+KRTLQSICLL VHPNTTTS+I+QVV DDGALLPCAI
Sbjct  61   SIEVIWKPKTGQTGKAEKEYEMILKRTLQSICLLAVHPNTTTSIILQVVGDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVDAG+PLKHLAVAICC L E  YVVLDP K EEQKM+AF YLVFPNS H  LP
Sbjct  121  NASCAALVDAGVPLKHLAVAICCGLTEGGYVVLDPTKSEEQKMRAFAYLVFPNSSHSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            K       EP   GIITSVT+G +    Y+ CL    AA  K+SE+LR+SL
Sbjct  181  KAPSAVDEEP---GIITSVTYGLMSESHYINCLGHGHAACAKISEFLRKSL  228



>ref|XP_011081797.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Sesamum 
indicum]
Length=243

 Score =   338 bits (868),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 194/238 (82%), Gaps = 0/238 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M+++R  GR ANQLRP+ C+R VL+RAHGSAS S GET+VLAAVYGPKAGTKKNENPEKA
Sbjct  1    MDLEREGGRGANQLRPIDCTRNVLSRAHGSASCSHGETRVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTLQ+ICLLTVHPNTTTS+I+QVV+DDG+LLPCAI
Sbjct  61   CIEVIWKPKTGQIGKSEKEFEMILKRTLQNICLLTVHPNTTTSIIVQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            +AACAALVDAGIPLK+LAVAICCCL ES  ++LDP KLEEQ+MK FV + FP+S    + 
Sbjct  121  HAACAALVDAGIPLKYLAVAICCCLTESGQIILDPSKLEEQRMKGFVCIAFPSSIQSVIS  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSLIAVPVGK  825
            + S   GGE +  G+ITS+THG + VDDY  C+ + RAA   LS  L++ L + P  K
Sbjct  181  QGSADVGGESVGNGVITSLTHGVMPVDDYFQCVEQGRAAIIPLSNILKKRLQSQPASK  238



>ref|XP_006450682.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63922.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
Length=218

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTSVIIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSVIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCC AES Y +LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCSAESGYCILDPTKLEEQKMKAFAYLVFPNSILSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKL  723
            + S    GEPME GIITSVTHG +
Sbjct  181  EGSSLVQGEPMEHGIITSVTHGAM  204



>ref|XP_006853610.2| PREDICTED: exosome complex exonuclease RRP46 homolog [Amborella 
trichopoda]
Length=244

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 186/231 (81%), Gaps = 0/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR+ NQLRPL CSR VL R HGSA W QG+T VLAAVYGPKAG+KKNE+PEKA
Sbjct  1    MEDSRVDGRSPNQLRPLTCSRNVLTRPHGSARWCQGDTIVLAAVYGPKAGSKKNESPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKPK+GQIGK E+E EMI+ RTLQSI L T+HPNTTTSVIIQV++DDGALLPCAI
Sbjct  61   SIEVLWKPKSGQIGKAEREYEMILTRTLQSIFLSTIHPNTTTSVIIQVMHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLK LAVAICC + ES  ++LDP K EEQ+M AF YLVFPNS    LP
Sbjct  121  NAACAALVDAGIPLKSLAVAICCGITESGSIILDPTKQEEQEMPAFAYLVFPNSSLAVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                   GEP+E GIITSVTHG + VDDY  CL+R R AS KLSE+LR++L
Sbjct  181  GTPPLIEGEPVEHGIITSVTHGAMSVDDYFDCLDRGRVASAKLSEFLRKNL  231



>ref|XP_011007656.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Populus euphratica]
Length=236

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 194/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGR+ +QLRPL+C+R VL RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRDDGRSPSQLRPLSCARNVLCRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK EKE EMI+KRTLQSIC+LT++PNTTTS+I+Q       LL CA+
Sbjct  61   CIEVIWKPKTGQIGKLEKEFEMILKRTLQSICILTLNPNTTTSIIVQ-------LLVCAV  113

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIP+KHLAVAICCCLAE  YV+LDP KLEEQKM+ F  LVFPNS    LP
Sbjct  114  NAACAALVDAGIPMKHLAVAICCCLAEDGYVILDPTKLEEQKMRGFACLVFPNSVASVLP  173

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S    GEPME GIITSVTHG + V++YL CL R RAAS KLS++LRRSL
Sbjct  174  EGSSHVEGEPMEHGIITSVTHGVMSVEEYLKCLERGRAASAKLSDFLRRSL  224



>ref|XP_008786335.1| PREDICTED: exosome complex exonuclease RRP46 homolog isoform 
X2 [Phoenix dactylifera]
Length=232

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 184/231 (80%), Gaps = 11/231 (5%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+ R DGRT NQLRPLACSR +L+RAHGSA WSQG+T VLAAVYGPKAGT+K ENPEKA
Sbjct  1    MEVVRADGRTPNQLRPLACSRNLLHRAHGSARWSQGDTIVLAAVYGPKAGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGK+EKE EMI+KRTLQSICLLT+HPNTTTS+I+QVV DDGALLPCAI
Sbjct  61   CIEVIWKPKTGQIGKEEKEYEMILKRTLQSICLLTIHPNTTTSIILQVVGDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALVD+GIPLKH        LAE+  V+LDP K EEQKM+AF YLVFPNSP   LP
Sbjct  121  NASCAALVDSGIPLKH--------LAETGSVILDPTKAEEQKMRAFAYLVFPNSPLSVLP  172

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            K       EP   GIITSVTHG +    Y+ CL    AA  K+SE+LRRS+
Sbjct  173  KAPSAVDDEP---GIITSVTHGLMSECHYINCLGHGHAACAKISEFLRRSM  220



>ref|XP_010096367.1| hypothetical protein L484_021115 [Morus notabilis]
 gb|EXB63842.1| hypothetical protein L484_021115 [Morus notabilis]
Length=217

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 177/231 (77%), Gaps = 20/231 (9%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPL CSR VLNRAHGS+SWSQG+TKVLAAVYGPKAGTKKNENPEK 
Sbjct  1    MEIDRIDGRTPNQLRPLTCSRNVLNRAHGSSSWSQGDTKVLAAVYGPKAGTKKNENPEKT  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQ GK E+E EMI+KRTLQSIC+LTV+PNTTT VIIQVVNDDGA+     
Sbjct  61   CIEVIWKPKTGQTGKSEREYEMILKRTLQSICILTVNPNTTTLVIIQVVNDDGAV-----  115

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
                              VAICC LAES YV+LDP KLEEQKMKAF YLVFPNS    LP
Sbjct  116  ---------------SFKVAICCGLAESGYVILDPAKLEEQKMKAFPYLVFPNSVLSVLP  160

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            + S +  GE ME GIITSVT G + VD+Y  CL R RAA+EK+S +LRRSL
Sbjct  161  EGSPKVEGELMENGIITSVTQGAMAVDNYFHCLERGRAANEKMSAFLRRSL  211



>ref|XP_007139880.1| hypothetical protein PHAVU_008G066200g [Phaseolus vulgaris]
 gb|ESW11874.1| hypothetical protein PHAVU_008G066200g [Phaseolus vulgaris]
Length=212

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR+ANQLRPLACS  VL+RAHGS+SW+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDRPDGRSANQLRPLACSCSVLHRAHGSSSWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IE+IWKPK+GQIGK EKE EMI+K+T +SIC+ T++PNTTT+VI+QV++DDGALLPCAI
Sbjct  61   SIEIIWKPKSGQIGKVEKEYEMILKKTFESICIRTIYPNTTTTVIVQVLHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDAGIPLKHLAVAICC + +S  V+LDP K EE+K+KAF  LVFPN+    LP
Sbjct  121  NAACAALVDAGIPLKHLAVAICCSVTDSGCVLLDPTKDEEEKLKAFANLVFPNAIVSVLP  180

Query  652  KESLQAGGEPMECGIITSVTHGKL  723
              SL+ G EPM  GI+TSVT G +
Sbjct  181  DRSLKVGTEPMAHGIMTSVTQGAM  204



>ref|XP_006650920.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Oryza brachyantha]
Length=238

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR ANQLRP +C+R  L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA
Sbjct  1    MEETRADGRNANQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKP TGQIGKQEKE EM +KRTLQSICLLTVHPNTTTSVI+QVV DDG+LLPCAI
Sbjct  61   SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALV AGIPLKHLAVAI C + E   V+LD  K EEQ++K+F +LVFPNS   A  
Sbjct  121  NASCAALVFAGIPLKHLAVAIGCGVLEDGEVILDTSKSEEQQLKSFAHLVFPNSRKSAGS  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            KE+ Q   E  E G+ITS+THG +  +DY  C+ R  AAS ++S+++R +L
Sbjct  181  KEANQK-EEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISDFMRTTL  230



>gb|EPS64194.1| hypothetical protein M569_10586, partial [Genlisea aurea]
Length=228

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 185/229 (81%), Gaps = 1/229 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            M ++R  GR ANQLRP+ CSR VL+RAHGSAS S GETKVLAAV+GPK GTKKNENPEKA
Sbjct  1    MVMEREAGRGANQLRPMDCSRNVLDRAHGSASCSHGETKVLAAVFGPKPGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            CIEVIWKPKTGQIGKQEKE EMI+KRTLQ+IC+L+V+ NTTTS+ IQV++DDG+LLPCAI
Sbjct  61   CIEVIWKPKTGQIGKQEKEFEMILKRTLQNICILSVNLNTTTSITIQVIHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            +AACAAL+DAGIPLKHLAVAICCC+ ES  ++LDP+KLEEQK KA V L FP     +L 
Sbjct  121  HAACAALLDAGIPLKHLAVAICCCVEESGQIILDPNKLEEQKTKASVCLAFPCCVD-SLL  179

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRR  798
             E L   G     G+ITS THG + V++Y  CL+RARAA   LS+ LR+
Sbjct  180  GEELSTNGGGGGGGVITSFTHGVMAVEEYFRCLDRARAAILPLSKILRK  228



>ref|NP_001051936.1| Os03g0854200 [Oryza sativa Japonica Group]
 sp|Q84T68.2|EXOS5_ORYSJ RecName: Full=Exosome complex exonuclease RRP46 homolog; AltName: 
Full=Exosome component 5; AltName: Full=Ribosomal RNA-processing 
protein 46; Short=oRrp46 [Oryza sativa Japonica Group]
 gb|AAO66540.2| putative exosome component [Oryza sativa Japonica Group]
 gb|ABF99960.1| 3' exoribonuclease family, domain 1 containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13850.1| Os03g0854200 [Oryza sativa Japonica Group]
 dbj|BAG91256.1| unnamed protein product [Oryza sativa Japonica Group]
Length=238

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR  NQLRP +C+R  L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA
Sbjct  1    MEESRADGRNPNQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKP TGQIGKQEKE EM +KRTLQSICLLTVHPNTTTSVI+QVV +DG+LLPCAI
Sbjct  61   SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALV AGIPLKHLAVAI C + E   V+LD +K EEQ++K+F +LVFPNS   A  
Sbjct  121  NACCAALVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASS  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            KE  Q   E  E G+ITS+THG +  +DY  C+ R  AAS ++S+++R +L
Sbjct  181  KEPNQK-EEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISDFMRTTL  230



>pdb|3HKM|A Chain A, Crystal Structure Of Rice(Oryza Sativa) Rrp46
 pdb|3HKM|B Chain B, Crystal Structure Of Rice(Oryza Sativa) Rrp46
 pdb|3HKM|C Chain C, Crystal Structure Of Rice(Oryza Sativa) Rrp46
Length=246

 Score =   307 bits (786),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 180/231 (78%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR  NQLRP +C+R  L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA
Sbjct  1    MEESRADGRNPNQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKP TGQIGKQEKE EM +KRTLQSICLLTVHPNTTTSVI+QVV +DG+LLPCAI
Sbjct  61   SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALV AGIPLKHLAVAI C + E   V+LD +K EEQ++K+F +LVFPNS   A  
Sbjct  121  NACCAALVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASS  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            KE  Q   E  E G+ITS+THG +  +DY  C+ R  AAS ++S+++R +L
Sbjct  181  KEPNQK-EEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISDFMRTTL  230



>gb|EEC76561.1| hypothetical protein OsI_14380 [Oryza sativa Indica Group]
Length=238

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR  NQLRP +C+R  L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA
Sbjct  1    MEESRADGRNPNQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKP TGQIGKQEKE EM +KRTLQSICLLTVHPNTTTSVI+QVV +DG+LLPCAI
Sbjct  61   SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA CAALV AGIPLKHLAVAI C + E   V+LD +K EEQ++K+F +LVFPNS   A  
Sbjct  121  NACCAALVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLVFPNSRKSASS  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            KE  Q   E  E G+ITS+THG +  +DY  C+ R  AAS ++S ++R +L
Sbjct  181  KEPNQK-EEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISHFMRTTL  230



>ref|XP_004981002.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Setaria 
italica]
Length=241

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 181/232 (78%), Gaps = 2/232 (1%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLRP  C+   LNRAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA IEV
Sbjct  6    RADGRNPNQLRPFKCTGNPLNRAHGSARWAQGDTVVLAAVYGPKPGTRKGENPEKASIEV  65

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            +WKPKTGQIG+QEKE EM +KRTLQSIC+LTVHPNTTTSV++QVV DDG+LLPCAINA+C
Sbjct  66   VWKPKTGQIGRQEKEYEMTLKRTLQSICVLTVHPNTTTSVVLQVVGDDGSLLPCAINASC  125

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
             AL  AG PLKHLAVAI C + E+  V+LD +  EEQ++K++V+LVFPNS  L   KES 
Sbjct  126  TALSFAGFPLKHLAVAIGCGVMENGAVILDMNTAEEQQLKSYVHLVFPNSRKLVDSKESK  185

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL-IAVP  816
            Q   E  E G+ITS+THG +  DDY  C+ R  AAS ++S+++R++L  AVP
Sbjct  186  QK-DEEFERGLITSITHGVMSEDDYFNCIERGLAASSRVSDFMRKTLKKAVP  236



>ref|XP_003560307.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Brachypodium 
distachyon]
Length=238

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 179/231 (77%), Gaps = 1/231 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR ANQLRP  C+R  L+RAHGSA WSQG+T VLAAVYGP+ GT+K ENPEKA
Sbjct  1    MEGSRGDGRNANQLRPFTCARNPLDRAHGSARWSQGDTVVLAAVYGPRPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEV+WKPKTGQ GKQEK  EM +KRTLQSICLLTVHPNTTTSVI+QV+ DDG+LLPCAI
Sbjct  61   SIEVVWKPKTGQSGKQEKGYEMTLKRTLQSICLLTVHPNTTTSVILQVMGDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NA+CAALV AGIPLKHLAVAI C +  +  V+LD  K EEQ++K+F +LVFPNS      
Sbjct  121  NASCAALVFAGIPLKHLAVAIGCGVLGNGAVILDTSKAEEQELKSFAHLVFPNSRKSVES  180

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            KES Q   E  E G++TS+THG +  D+Y  C+ R  AAS ++S+++R +L
Sbjct  181  KESQQK-DEHSERGLLTSITHGVMSEDEYFSCIERGLAASSRISDFMRTTL  230



>ref|XP_002463494.1| hypothetical protein SORBIDRAFT_01g000760 [Sorghum bicolor]
 gb|EER90492.1| hypothetical protein SORBIDRAFT_01g000760 [Sorghum bicolor]
Length=239

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 177/227 (78%), Gaps = 1/227 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLRP +C+   L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA IEV
Sbjct  6    RADGRNPNQLRPFSCTGNPLHRAHGSARWAQGDTVVLAAVYGPKPGTRKGENPEKASIEV  65

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            +WKPKTGQIG+QE+E EM +KRTLQSICLLTVHPNTTTSV++QVV DDG+LLPCAINA+C
Sbjct  66   VWKPKTGQIGRQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSLLPCAINASC  125

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
            AAL  AGIP+KHLAVAICC + ++  V+LD    EEQ+ K+F +LVFPNS      K+ +
Sbjct  126  AALAFAGIPMKHLAVAICCGVMDNGAVILDTSTAEEQQAKSFAHLVFPNSRKSVDSKDPM  185

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            Q   E  E G+I+ +THG +  D+Y  C+ R  AAS K+S+++R++L
Sbjct  186  QK-DEESERGLISCITHGTMSEDNYFNCIERGIAASSKISDFMRKTL  231



>ref|XP_006418943.1| hypothetical protein EUTSA_v10002689mg [Eutrema salsugineum]
 gb|ESQ37379.1| hypothetical protein EUTSA_v10002689mg [Eutrema salsugineum]
Length=168

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGRT NQLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C EVIWKPK+GQIGK EKE EMI+K+T+QSIC+LTV+PNTTTSVIIQVV+DDG+LLPCAI
Sbjct  61   CFEVIWKPKSGQIGKAEKEYEMILKKTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMK  603
            NAACAALVDAGIP+KHLAVAICCCLA++ YVVLDP+KLEE+KM+
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCLADNGYVVLDPNKLEEKKMR  164



>ref|NP_001146469.1| exosome complex exonuclease RRP46 [Zea mays]
 gb|ACL54086.1| unknown [Zea mays]
 gb|AFW66940.1| exosome complex exonuclease RRP46 [Zea mays]
Length=240

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 175/227 (77%), Gaps = 1/227 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLRP  C+   L+RAHGSA W+QG+T VLAAVYGPK+GT+K ENPEKA IEV
Sbjct  7    RADGRNPNQLRPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKSGTRKGENPEKASIEV  66

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            +WKPKTGQIG+QE+E EM +KRTLQSICLLTVHPNTTTSV++QVV DDG+L+ CAINA+C
Sbjct  67   VWKPKTGQIGRQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSLMSCAINASC  126

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
            AAL  AGIP+KHLAVAI C + ++  V+LD  + EEQ+ ++F +LVFPNS      K++ 
Sbjct  127  AALAFAGIPMKHLAVAISCGVMDNGVVILDTSRAEEQQARSFAHLVFPNSRKSVESKDTT  186

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            Q   E  E G+IT +THG +  DDY  C+ R   AS ++S+++R++L
Sbjct  187  QR-DEESERGLITCITHGAMSEDDYFNCIERGVMASSRISDFMRKTL  232



>ref|XP_002308603.2| hypothetical protein POPTR_0006s25550g, partial [Populus trichocarpa]
 gb|EEE92126.2| hypothetical protein POPTR_0006s25550g, partial [Populus trichocarpa]
Length=193

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 165/204 (81%), Gaps = 12/204 (6%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR+ +QLRPL+CS  VL+RAHGSASWSQG+TKVLAA            NPEKA
Sbjct  1    MEIDRDDGRSPSQLRPLSCSHNVLHRAHGSASWSQGDTKVLAA------------NPEKA  48

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
            C+EVIWKPKTGQIGK E+E EMI+KRTLQSIC+LT++PNTTTS+I+QVVNDDGALL CAI
Sbjct  49   CVEVIWKPKTGQIGKLEREYEMILKRTLQSICILTLNPNTTTSIIVQVVNDDGALLVCAI  108

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            NAACAALVDA IP+KHLAVAICCCLA+  YV+LDP KLEEQKMK F YLVFPNS    L 
Sbjct  109  NAACAALVDARIPMKHLAVAICCCLADVGYVILDPTKLEEQKMKGFAYLVFPNSVLSVLL  168

Query  652  KESLQAGGEPMECGIITSVTHGKL  723
            + S    GE  E GIITSVTHG +
Sbjct  169  EGSSLVEGESTEHGIITSVTHGVM  192



>gb|ACG36561.1| exosome complex exonuclease RRP46 [Zea mays]
Length=240

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 173/227 (76%), Gaps = 1/227 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLRP  C+   L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA IEV
Sbjct  7    RADGRNPNQLRPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKPGTRKGENPEKASIEV  66

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            +WKPKTGQIG+QE+E EM +KRTLQSICLLTVHPNTTTSV++QVV DDG+L+ CAINA+C
Sbjct  67   VWKPKTGQIGRQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSLMSCAINASC  126

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
            AAL  AGIP+KHLAVAI C + ++  V+LD  + EEQ+ ++F +LVFPNS      K+  
Sbjct  127  AALAFAGIPMKHLAVAISCGVMDNGVVILDTSRAEEQQARSFAHLVFPNSRKSVESKDPT  186

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            Q   E  E G+IT +THG +  DDY  C+ R   AS ++S+++R++L
Sbjct  187  QR-DEESERGLITCITHGAMSEDDYFNCIERGVMASSRISDFMRKTL  232



>gb|ACV40374.1| ribosomal RNA-processing protein 46 [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = +1

Query  142  ANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKT  321
            ANQLR  +C+R  L RAHGSA W+QG+T VLAAVYGP+ GT+K ENPEKA +EV+WKPKT
Sbjct  13   ANQLRAYSCTRNPLERAHGSARWAQGDTVVLAAVYGPRPGTRKGENPEKASLEVVWKPKT  72

Query  322  GQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDA  501
            GQIG+QEKE EM +KRTLQSICLLTVHPNTTTS+I+QV+ DDG+LLPCAINA+CAALV A
Sbjct  73   GQIGRQEKEYEMTLKRTLQSICLLTVHPNTTTSIILQVMGDDGSLLPCAINASCAALVFA  132

Query  502  GIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEP  681
            GIP+KHLAVAI C +     V+LD  K EEQ++K+F +LVFPNS      KE  Q  G+ 
Sbjct  133  GIPMKHLAVAIGCGVLPDGSVILDTSKAEEQQLKSFAHLVFPNSSLSVDVKEPQQKDGQS  192

Query  682  MECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             E G+ITS+THG +  DDY  C+ R  AAS ++S+++R +L
Sbjct  193  -ERGLITSITHGVMSEDDYFNCIERGLAASARISDFMRTTL  232



>ref|XP_003545427.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Glycine 
max]
Length=237

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 182/233 (78%), Gaps = 7/233 (3%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRG--VLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPE  285
            ME DR D +T NQLRPLACS    +L+R+HGSASW+Q ETKVLAAVYGPKAGTKKNENP+
Sbjct  1    METDRPDSQTPNQLRPLACSCSCSILHRSHGSASWAQRETKVLAAVYGPKAGTKKNENPK  60

Query  286  KACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC  465
            KA I+VIWKPKTGQIGK EKE EMI+KRTL+SIC+ T++PNTTT VI+Q+V+DDG LLPC
Sbjct  61   KASIKVIWKPKTGQIGKVEKEYEMILKRTLESICIRTIYPNTTTLVIVQIVHDDGVLLPC  120

Query  466  AINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLA  645
            AINAAC ALVDA IPLKHL VAICC + +S  ++LDP K +E+KMKAF+ LVFPN+    
Sbjct  121  AINAACVALVDARIPLKHLVVAICCSITDSGCIILDPTKDQEEKMKAFINLVFPNTIVSV  180

Query  646  LPKESLQAGGEPMECGIITSVTHGKLE-VDDYLLCLNRARAASEKLSEYLRRS  801
            LP+ SLQ G E M  GI+TS+T G +  +  ++ C    RA S++ ++  + S
Sbjct  181  LPEGSLQEGSETMAHGIMTSITQGAMSGLGGFVAC----RALSQRNTDPTKAS  229



>gb|ERN15077.1| hypothetical protein AMTR_s00056p00044410 [Amborella trichopoda]
Length=229

 Score =   288 bits (737),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +1

Query  217  GETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLT  396
            G+T VLAAVYGPKAG+KKNE+PEKA IEV+WKPK+GQIGK E+E EMI+ RTLQSI L T
Sbjct  21   GDTIVLAAVYGPKAGSKKNESPEKASIEVLWKPKSGQIGKAEREYEMILTRTLQSIFLST  80

Query  397  VHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDP  576
            +HPNTTTSVIIQV++DDGALLPCAINAACAALVDAGIPLK LAVAICC + ES  ++LDP
Sbjct  81   IHPNTTTSVIIQVMHDDGALLPCAINAACAALVDAGIPLKSLAVAICCGITESGSIILDP  140

Query  577  DKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNR  756
             K EEQ+M AF YLVFPNS    LP       GEP+E GIITSVTHG + VDDY  CL+R
Sbjct  141  TKQEEQEMPAFAYLVFPNSSLAVLPGTPPLIEGEPVEHGIITSVTHGAMSVDDYFDCLDR  200

Query  757  ARAASEKLSEYLRRSL  804
             R AS KLSE+LR++L
Sbjct  201  GRVASAKLSEFLRKNL  216



>ref|XP_006450683.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63923.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
Length=178

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 156/177 (88%), Gaps = 1/177 (1%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTSVIIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSVIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQK-MKAFVYLVFPNSPH  639
            NAACAALVDAGIP+KHLAVAICCC AES Y +LDP KLEEQ  + +F+ ++     H
Sbjct  121  NAACAALVDAGIPMKHLAVAICCCSAESGYCILDPTKLEEQVIIISFLMIIMSFCGH  177



>gb|EEE60325.1| hypothetical protein OsJ_13416 [Oryza sativa Japonica Group]
Length=248

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 143/241 (59%), Positives = 176/241 (73%), Gaps = 11/241 (5%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME  R DGR  NQLRP +C+R  L+RAHGSA W+QG+T VLAAVYGPK GT+K ENPEKA
Sbjct  1    MEESRADGRNPNQLRPFSCTRNPLDRAHGSARWAQGDTIVLAAVYGPKPGTRKGENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC--  465
             IEV+WKP TGQIGKQEKE EM +KRTLQSICLLTVHPNTTTSVI+QVV +DG++  C  
Sbjct  61   SIEVVWKPMTGQIGKQEKEYEMTLKRTLQSICLLTVHPNTTTSVILQVVGNDGSVSFCRN  120

Query  466  ---AINAAC-----AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLV  621
               +I + C      +LV AGIPLKHLAVAI C + E   V+LD +K EEQ++K+F +LV
Sbjct  121  VLLSIVSGCLLDYEHSLVFAGIPLKHLAVAIGCGVLEDGEVILDTNKAEEQQLKSFAHLV  180

Query  622  FPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
            FPNS   A  KE  Q   E  E G+ITS+THG +  +DY  C+ R  AAS ++S+++R +
Sbjct  181  FPNSRKSASSKEPNQK-EEDSERGLITSITHGVMSEEDYFSCIERGLAASSRISDFMRTT  239

Query  802  L  804
            L
Sbjct  240  L  240



>ref|XP_006450679.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 ref|XP_006450681.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63919.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
 gb|ESR63921.1| hypothetical protein CICLE_v10009310mg [Citrus clementina]
Length=142

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+DR DGR  NQLRPLACS  +L+RAHGSASWSQG+TKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    MEVDRADGRNPNQLRPLACSCSILHRAHGSASWSQGDTKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             IEVIWKP+TGQIGK EKE E+I+KRTLQSIC+LT++PNTTTSVIIQVV+DDGALLPCAI
Sbjct  61   SIEVIWKPRTGQIGKPEKEYEIILKRTLQSICILTINPNTTTSVIIQVVHDDGALLPCAI  120

Query  472  NAACAALVDAGIPLKHLA  525
            NAACAALVDAGIP+KHLA
Sbjct  121  NAACAALVDAGIPMKHLA  138



>gb|KCW81566.1| hypothetical protein EUGRSUZ_C02924 [Eucalyptus grandis]
Length=196

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +1

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G+ EKE EM++KRTLQSIC+LT+HPNTTTSVI+QVV+DDGALLPCAINA+CAALVDAGIP
Sbjct  27   GRLEKEYEMVLKRTLQSICILTIHPNTTTSVIVQVVHDDGALLPCAINASCAALVDAGIP  86

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            LKHLAVAICCCLA+S  V+LDP KLEE+KMKAFVYLV PNS    LP+ES    GE ME 
Sbjct  87   LKHLAVAICCCLADSGLVMLDPTKLEEEKMKAFVYLVLPNSILSVLPEESSSVKGEQMEQ  146

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
            G+ITSVTHG + VDDYL CL R RAA+ K+S++LRR+L
Sbjct  147  GLITSVTHGVMSVDDYLHCLERGRAATSKMSDFLRRNL  184



>ref|XP_001775388.1| predicted protein [Physcomitrella patens]
 gb|EDQ59858.1| predicted protein [Physcomitrella patens]
Length=256

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 164/228 (72%), Gaps = 0/228 (0%)
 Frame = +1

Query  121  DRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
            +R DGR+A+QLRPL+ SRG+L RAHGSA+WSQ  T VLAAVYGPK    K EN E+A IE
Sbjct  18   ERADGRSASQLRPLSLSRGLLTRAHGSATWSQENTTVLAAVYGPKPAAMKKENAERAIIE  77

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V+W+ K+G  G  EK+ E++V+R+L+ I L  +HPNT  SVI+QV+NDDG+LL CA+NAA
Sbjct  78   VVWRAKSGLSGSYEKDAEVVVRRSLEYIILTALHPNTAISVILQVINDDGSLLACAMNAA  137

Query  481  CAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKES  660
            CAALVDAGIPL  L  A+ C +     V LDP K EEQK KA+V  VFP+    A+P+  
Sbjct  138  CAALVDAGIPLNGLLSAVSCGVTHDGQVFLDPTKPEEQKCKAYVSFVFPSRRLSAVPELP  197

Query  661  LQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                GEP+E GI+TSVT G +EV++Y  C+   RAA+ K+SE+ R S+
Sbjct  198  ADVDGEPVEYGILTSVTRGAMEVEEYFSCVENCRAAAAKVSEFSRSSI  245



>gb|KHN27081.1| Exosome complex exonuclease RRP46 like [Glycine soja]
Length=179

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME DR DGRT NQLRPLA S  +L+RAHGSASW+QGETKVLAAVYGPKAGTKKNENPEKA
Sbjct  1    METDRPDGRTPNQLRPLAYSCSILHRAHGSASWAQGETKVLAAVYGPKAGTKKNENPEKA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQ---VVNDDGALLP  462
             IEVIWKPKTGQIGK EKE EMI+KRTL+SIC+ T++PNTTTSVI+Q   V++    LLP
Sbjct  61   SIEVIWKPKTGQIGKMEKEYEMILKRTLESICIRTIYPNTTTSVIVQASFVLSIRNLLLP  120

Query  463  CAINAACAALVDAGIPLKHLAV  528
            CAINAACAALVDAGIPLKHLAV
Sbjct  121  CAINAACAALVDAGIPLKHLAV  142



>gb|KJB65534.1| hypothetical protein B456_010G107600 [Gossypium raimondii]
Length=235

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 149/237 (63%), Gaps = 29/237 (12%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNE-----  276
            ME+D  DGRT NQLRPLACS  +L RA+GSASWS   T+ L    G      K+      
Sbjct  1    MEVDGEDGRTQNQLRPLACSHNILYRAYGSASWSL-RTRTLRKQTGQIDNLLKSHLMRMR  59

Query  277  ---NPEKACIEV------IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVII  429
               N  K  +E       +W   +G     E+E EMI+KRTLQSICLLT++PNTTTS+II
Sbjct  60   PWLNGNKEALEFKFHHVWVWFRYSGL--PLEEEYEMILKRTLQSICLLTINPNTTTSIII  117

Query  430  QVVNDDGALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAF  609
            QVVNDDG LL CAINAAC ALVDAGIP +HLAVAICCC+A+S             KMKAF
Sbjct  118  QVVNDDG-LLSCAINAACVALVDAGIPTEHLAVAICCCVAKSGC-----------KMKAF  165

Query  610  VYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKL  780
             YL F N  H  LP+ S    GEP+E GI+TSVT+G +  D+Y   L R RAAS ++
Sbjct  166  AYLAFLNCVHSVLPEGSSSVQGEPIEHGIVTSVTNGIMSEDNYFYSLERGRAASVRV  222



>gb|KHN07227.1| Exosome complex exonuclease RRP46 like [Glycine soja]
Length=193

 Score =   189 bits (479),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 125/207 (60%), Gaps = 51/207 (25%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRG--VLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPE  285
            ME DR D +T NQLRPLACS    +L+R+HGSASW+Q ETKVLAAVYGPKAGTKKNENP+
Sbjct  1    METDRPDSQTPNQLRPLACSCSCSILHRSHGSASWAQRETKVLAAVYGPKAGTKKNENPK  60

Query  286  KACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC  465
            KA I+VIWKPKTGQI                                             
Sbjct  61   KASIKVIWKPKTGQI---------------------------------------------  75

Query  466  AINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLA  645
                AC ALVDA IPLKHL VAICC + +S  ++LDP K +E+KMKAF+ LVFP++    
Sbjct  76   ----ACVALVDARIPLKHLVVAICCSITDSGCIILDPTKDQEEKMKAFINLVFPSTIVSV  131

Query  646  LPKESLQAGGEPMECGIITSVTHGKLE  726
            LP+ SLQ G E M  GI+TS+T G + 
Sbjct  132  LPEGSLQEGSETMAHGIMTSITQGAMS  158



>gb|AFW66941.1| hypothetical protein ZEAMMB73_899121 [Zea mays]
 gb|AFW66942.1| hypothetical protein ZEAMMB73_899121 [Zea mays]
Length=122

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLRP  C+   L+RAHGSA W+QG+T VLAAVYGPK+GT+K ENPEKA IEV
Sbjct  7    RADGRNPNQLRPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKSGTRKGENPEKASIEV  66

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGAL  456
            +WKPKTGQIG+QE+E EM +KRTLQSICLLTVHPNTTTSV++QVV DDG++
Sbjct  67   VWKPKTGQIGRQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVVGDDGSV  117



>gb|ACN34857.1| unknown [Zea mays]
 gb|AFW66943.1| hypothetical protein ZEAMMB73_899121 [Zea mays]
Length=149

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  121  DRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
             R DGR  NQLRP  C+   L+RAHGSA W+QG+T VLAAVYGPK+GT+K ENPEKA IE
Sbjct  6    SRADGRNPNQLRPFTCTGNPLHRAHGSARWAQGDTVVLAAVYGPKSGTRKGENPEKASIE  65

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVV  438
            V+WKPKTGQIG+QE+E EM +KRTLQSICLLTVHPNTTTSV++QV+
Sbjct  66   VVWKPKTGQIGRQEREYEMTLKRTLQSICLLTVHPNTTTSVVLQVM  111



>gb|KDO79816.1| hypothetical protein CISIN_1g047153mg [Citrus sinensis]
Length=100

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 89/108 (82%), Gaps = 9/108 (8%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEIDR DGR  NQLRPLAC   +L+RAHGSASWSQG+TKVLAA         KNENPEK 
Sbjct  1    MEIDRADGRNPNQLRPLACYCSILHRAHGSASWSQGDTKVLAA---------KNENPEKV  51

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQV  435
             IEVIWK KTGQIGKQEKE EMI+KRTLQSIC+LT++PNTTTSVIIQV
Sbjct  52   SIEVIWKSKTGQIGKQEKEYEMILKRTLQSICILTINPNTTTSVIIQV  99



>ref|XP_006439144.1| hypothetical protein CICLE_v10010872mg [Citrus clementina]
 gb|ESR52384.1| hypothetical protein CICLE_v10010872mg [Citrus clementina]
Length=100

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 90/108 (83%), Gaps = 9/108 (8%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            MEI+R DGR  NQLRPLAC   +L+RAHGSASWSQG+TKVLAA         KNENPEKA
Sbjct  1    MEIERADGRNPNQLRPLACYCSILHRAHGSASWSQGDTKVLAA---------KNENPEKA  51

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQV  435
             IEVIWK KTGQIGKQEKE EMI+KRTLQSIC+LT++PNTTTSVIIQV
Sbjct  52   SIEVIWKSKTGQIGKQEKEYEMILKRTLQSICILTINPNTTTSVIIQV  99



>dbj|GAM24985.1| hypothetical protein SAMD00019534_081600 [Acytostelium subglobosum 
LB1]
Length=240

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 109/175 (62%), Gaps = 0/175 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R D RT NQ+RP+   + +LN+A GSA ++Q ++ VLAAVYGP     + E   KA I+V
Sbjct  3    RSDKRTPNQIRPIESEQALLNKADGSAKFTQNKSSVLAAVYGPVEVIPRKEKISKANIDV  62

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            ++ P TG    ++KE EM+++  L+S+ + ++HP T  S+IIQV +DDG+++ CAINAAC
Sbjct  63   VFTPATGNSSYEDKEKEMLIRNALESVIITSLHPRTQISIIIQVYSDDGSIVSCAINAAC  122

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLAL  648
             AL+DAGI L  L  +I  C      V LDPD +EE+  K      F N   L +
Sbjct  123  LALLDAGIELNSLLGSITLCYNHDGTVCLDPDTVEEELAKGLAIYAFNNQTKLVM  177



>ref|XP_002880804.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57063.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=140

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 87/109 (80%), Gaps = 8/109 (7%)
 Frame = +1

Query  130  DGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIW  309
            D +  NQL  +        R+ G   + +G+TKVLAAVYGPKAGTKKNEN EKAC EVIW
Sbjct  9    DKQVRNQLSVI--------RSTGDRRYEKGDTKVLAAVYGPKAGTKKNENDEKACFEVIW  60

Query  310  KPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGAL  456
            KPKTGQIGK EKE EMI+KRT+QSIC+LTV+PNTTTSVIIQVV+DDG++
Sbjct  61   KPKTGQIGKVEKEYEMILKRTMQSICVLTVNPNTTTSVIIQVVHDDGSI  109



>ref|XP_011270851.1| hypothetical protein CAOG_09141 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE97874.1| hypothetical protein CAOG_009141 [Capsaspora owczarzaki ATCC 
30864]
Length=227

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 126/235 (54%), Gaps = 23/235 (10%)
 Frame = +1

Query  118  IDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACI  297
            + R DGR  NQLR L+    VL+RA GS+ +SQ +T  L AVYGP       E  +KA +
Sbjct  2    VTRADGRMPNQLRELSIEHAVLSRADGSSRFSQRDTSALTAVYGPAEVKSSKELLDKATV  61

Query  298  EVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINA  477
            + +++PKTG  G  +  CE I+++ L+ +   T +P T+ +VI+QV++DDGALL CA+N+
Sbjct  62   QTVFRPKTGLAGVDDHVCEAILRQALEPVIQRTANPRTSITVIVQVMHDDGALLACALNS  121

Query  478  ACAALVDAGIPLKHLAVAICCCL------AESKYVVLDPDKLEEQKMKAFVYLVFPNSPH  639
            A  AL+DAG+P+  +  A+ C        +  + ++LDP   E+    +     F     
Sbjct  122  ASMALIDAGVPMSAVLAAVTCAWLPAADGSSERRLLLDPTLEEQTAATSIATFAF-----  176

Query  640  LALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                        E     I+ S T G+L VD+Y   +  A+ A+  +  ++R SL
Sbjct  177  ------------ESTNQEIVFSSTEGQLTVDEYFYTIEMAQKAAANVLAFMRLSL  219



>ref|XP_001635076.1| predicted protein [Nematostella vectensis]
 gb|EDO43013.1| predicted protein [Nematostella vectensis]
Length=232

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 126/219 (58%), Gaps = 17/219 (8%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
            +LR + C  G+L++A GS+ ++QG+T+V+AA YGP       E  ++A +EVI++PK G 
Sbjct  14   ELRAMFCEHGLLDKADGSSKFAQGDTQVMAAAYGPVEVKLNKELIDRATLEVIFRPKIGI  73

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E I++ + + I L  +HP  + ++++QVV + G+LL CA+NAAC A++DAG 
Sbjct  74   PGCSEKLVEGIIRNSCEPIVLTALHPRASLTIVVQVVQNSGSLLSCAVNAACLAMMDAGF  133

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            P++ +   I C + E   +VLDP   +E+K  A +  VF                 + + 
Sbjct  134  PMRCMMCGITCAITEQDELVLDPTLEQERKATAVLTFVF-----------------DSVN  176

Query  688  CGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              ++TS T G  +VD Y  CL  ++AA   +  + R+S+
Sbjct  177  QNLLTSSTKGSFDVDQYNKCLAASKAAMGNILAFYRQSV  215



>ref|XP_003283749.1| hypothetical protein DICPUDRAFT_85962 [Dictyostelium purpureum]
 gb|EGC39763.1| hypothetical protein DICPUDRAFT_85962 [Dictyostelium purpureum]
Length=233

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 120/224 (54%), Gaps = 24/224 (11%)
 Frame = +1

Query  115  EIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGP-KAGTKKNENPEKA  291
            E  R +GRT  QLR +   + +LN+A GSA +SQ +T VLAAVYGP +  + + E   K+
Sbjct  6    EFRRLNGRTQGQLRSMESEQSLLNKADGSAKFSQNKTSVLAAVYGPIEVNSARKEKILKS  65

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             +EV + P  G     +KE E++VK  ++S+ L T+HP T  SVIIQV +DDG+++ C+I
Sbjct  66   YVEVTFTPALGNTTYLDKEKELLVKNAVESVILTTLHPRTQVSVIIQVYSDDGSIVSCSI  125

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESK------YVVLDPDKLEEQKMKAFVYLVFPNS  633
            NAAC AL+DAGI +  L  +I     +         +++DPD  EE   KA     F ++
Sbjct  126  NAACLALLDAGIEMNGLIGSITLMNEDDDEDNNKCLMIVDPDLNEENNSKAMAIFAFSSN  185

Query  634  PHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARA  765
             +                  I+ S T G L  D Y  CL  AR 
Sbjct  186  SN-----------------NIVMSKTIGTLTEDQYFECLKAARG  212



>ref|XP_009045277.1| hypothetical protein LOTGIDRAFT_110121 [Lottia gigantea]
 gb|ESP03795.1| hypothetical protein LOTGIDRAFT_110121 [Lottia gigantea]
Length=218

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 130/232 (56%), Gaps = 21/232 (9%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+D  +     +LRP++C  G L+R+ GSA+ +QG+T V++AVYGP       E  +KA
Sbjct  1    MEVDSPN----VELRPISCDLGHLSRSDGSATLTQGDTTVISAVYGPGDVRISKEIIDKA  56

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             ++V++KPKTG    ++K  E I++ + ++I L  +HP T   +I+Q + + G+ L C I
Sbjct  57   TVDVVYKPKTGLPKCEDKIKERIIRNSCETIILAGLHPRTCIEIILQEMQNCGSFLACCI  116

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALP  651
            N+AC AL+DA IPLK+L  A+ CC+     + LDP   EE++  A    VF +  H    
Sbjct  117  NSACLALLDASIPLKYLMGAVTCCVTNQGDITLDPTLREEKESVAGATFVFDSKDH----  172

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSLI  807
                          +IT  T+G L  + +   L   R AS+K+ E+ R S++
Sbjct  173  -------------NVITVSTYGTLSTEQFQTILKTCREASKKVFEFYRESML  211



>gb|KJB65531.1| hypothetical protein B456_010G107600 [Gossypium raimondii]
 gb|KJB65532.1| hypothetical protein B456_010G107600 [Gossypium raimondii]
Length=178

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  334  KQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPL  513
            K E+E EMI+KRTLQSICLLT++PNTTTS+IIQVVNDDGALL CAINAAC ALVDAGIP 
Sbjct  72   KLEEEYEMILKRTLQSICLLTINPNTTTSIIIQVVNDDGALLSCAINAACVALVDAGIPT  131

Query  514  KHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            +HLAVAICCC+A+S  V+LDP +LEEQ +  F  L++
Sbjct  132  EHLAVAICCCVAKSGCVILDPTRLEEQIIIEFPLLIY  168



>ref|XP_002590540.1| hypothetical protein BRAFLDRAFT_124523 [Branchiostoma floridae]
 gb|EEN46551.1| hypothetical protein BRAFLDRAFT_124523 [Branchiostoma floridae]
Length=219

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 124/222 (56%), Gaps = 17/222 (8%)
 Frame = +1

Query  139  TANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPK  318
            T+  LR   C + +L+R  GSAS  QG+T VLAAVYGP       E  +KA ++VI+KPK
Sbjct  7    TSALLRSFECEQNLLSRPDGSASVRQGDTSVLAAVYGPGEVKMSEEIIDKATLKVIFKPK  66

Query  319  TGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVD  498
             G  G  EK  E +++ T +S+ L  +HP +  ++++QV+ D G+LL C INAAC ALVD
Sbjct  67   IGLPGCAEKLQERLLRNTCESVVLAILHPRSGVNIVLQVIQDSGSLLSCCINAACMALVD  126

Query  499  AGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGE  678
            + +P+K L  A+ C + E   +VLDPD  +E++  A +   F                 +
Sbjct  127  SAVPMKCLVSAVTCAVMEEGRIVLDPDSKQEKESSAVLTFAF-----------------D  169

Query  679  PMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              E  ++T  T G    + Y  CL+   AAS+ +S + R+++
Sbjct  170  SRENNVVTCSTKGCYTPEKYQECLSACGAASKNISSFFRQAV  211



>ref|XP_638714.1| hypothetical protein DDB_G0284053 [Dictyostelium discoideum AX4]
 gb|EAL65367.1| hypothetical protein DDB_G0284053 [Dictyostelium discoideum AX4]
Length=237

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 18/225 (8%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGP-KAGTKKNENPEKACIE  300
            R DGR  N +RP+   +G LN+A GSA +SQ ++KVLAAVYGP +  + + E   K+ +E
Sbjct  7    RNDGRCENSIRPVESEQGSLNKADGSAKFSQDKSKVLAAVYGPIEVNSARKEKILKSYVE  66

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V + P  G     +KE E+++K  ++S+ L T++P T  SVI+QV +DDG+++ CAINAA
Sbjct  67   VTFTPAFGNTNYIDKEKELLIKNAVESMILTTLYPRTQISVILQVFSDDGSIVSCAINAA  126

Query  481  CAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKES  660
            C AL+DAGI +  L  ++  C      + +DP   EE + KA     F +          
Sbjct  127  CLALLDAGIEMNGLLGSVTLCFNNDGSIYVDPSTEEENQSKAIAIYSFSS----------  176

Query  661  LQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                   +   I+ S T G L  D Y   L++A  + + +  +++
Sbjct  177  -------INKNIVLSKTIGTLTEDQYFKGLDKASESCDLIISFIK  214



>ref|XP_005529520.1| PREDICTED: exosome complex component RRP46-like [Pseudopodoces 
humilis]
Length=221

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 123/219 (56%), Gaps = 17/219 (8%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
            +LRP +C  G+L+R  GSA++ QG+T VLA +YGP       E P++  +EV+ +PK G 
Sbjct  13   RLRPFSCELGLLSRPDGSATFLQGDTSVLAGLYGPAEAKLSKELPDRTALEVLLRPKVGL  72

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  E+  E ++++T +++ L  +HP T  S+++QV++D G+LL C +NAAC AL+DAG+
Sbjct  73   PGVLERSREQLLRQTCEAVVLGVLHPRTAISLVLQVLSDAGSLLSCCLNAACMALLDAGL  132

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            PL  L   + C L     ++LDP   +EQ  +A +     +S                 E
Sbjct  133  PLATLFCGVTCALQPDGTILLDPTARQEQDARAILTFAIASS-----------------E  175

Query  688  CGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              ++ + T G   V++   CL  A+ A++ + ++ R S+
Sbjct  176  RKVLMATTKGSCSVEEMQQCLAAAQRAADTIFQFYRDSV  214



>ref|XP_004362002.1| hypothetical protein DFA_06297 [Dictyostelium fasciculatum]
 gb|EGG24151.1| hypothetical protein DFA_06297 [Dictyostelium fasciculatum]
Length=329

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 123/228 (54%), Gaps = 21/228 (9%)
 Frame = +1

Query  118  IDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGP-KAGTKKNENPEKAC  294
            I R D R +NQ+RP+   + +LN+A GSA +SQG++ VLAAVYGP    T + E   K+ 
Sbjct  83   IKRDDTRLSNQIRPIESEQALLNKADGSAKFSQGKSSVLAAVYGPIDVKTARKEKISKSV  142

Query  295  IEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAIN  474
            ++V + P TG     +KE EM+V+  ++SI L  +HP T  +VI+QV ++DG+++ CAIN
Sbjct  143  VDVSFTPATGNTTYFDKEREMLVRNAVESIILTLLHPRTQINVIVQVYSNDGSIISCAIN  202

Query  475  AACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAF-VYLVFPNSPHLALP  651
            A C AL+DAGI L  L  +I         + LDP + EE   K   VY +   S      
Sbjct  203  ACCLALLDAGIELNCLISSITLSFTHDNQIYLDPTQKEENNSKGLAVYAINSKSE-----  257

Query  652  KESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                          I+ + T G +    Y   LN A+ + EK+S Y R
Sbjct  258  --------------IVMTKTTGIIGESLYFQGLNIAKQSCEKVSAYTR  291



>ref|XP_003643513.1| PREDICTED: exosome complex component RRP46-like, partial [Gallus 
gallus]
Length=173

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 103/161 (64%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP +C +G+L+R  GSA++ QG+T VLA +YGP       E+P+ A +EV+ +PK G  
Sbjct  12   LRPFSCEQGLLSRPDGSATFVQGDTSVLAGLYGPAEVKGSRESPDGATVEVLLRPKVGLP  71

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  E+  E +++RT +++ L ++HP T+ +V++QV++D G+LL C +NAAC  L+DAG+P
Sbjct  72   GVAERSREQLLRRTFEAVLLGSLHPRTSITVVLQVLSDAGSLLACCLNAACMGLLDAGLP  131

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            L  L   + C L     ++LDP   +EQ+  A +     ++
Sbjct  132  LSSLFCGVTCALDPHGDIILDPTARQEQEAHAVLTFAIDSA  172



>gb|KDO30684.1| hypothetical protein SPRG_04585 [Saprolegnia parasitica CBS 223.65]
Length=224

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 123/229 (54%), Gaps = 19/229 (8%)
 Frame = +1

Query  121  DRR-DGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGT-KKNENPEKAC  294
            DRR DGR   ++RPLAC +G+LNRA GSA ++ G T VLA+V GP A   ++ E    A 
Sbjct  5    DRREDGRLVQEIRPLACEQGLLNRADGSARFNHGTTSVLASVSGPAAAKLRRQEKATGAT  64

Query  295  IEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAIN  474
            +EV +K + G    ++KE EMI++ T + I +L   P    S+ +QVV DDGALL  AIN
Sbjct  65   LEVTFKAEKGAPSARDKEYEMILRETFEPIIVLENFPRAVVSITVQVVEDDGALLAVAIN  124

Query  475  AACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPK  654
            A   AL+DAG+P++ +  AI C + E   + LDP + E +   A V      +       
Sbjct  125  AVNLALIDAGVPMRSIVGAITCSILEDGQLCLDPSRSEGETAAATVTTACCGNND-----  179

Query  655  ESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
                        GI+TS+T G L  + Y  C    R A + +  ++R S
Sbjct  180  ------------GILTSMTSGVLSEEQYFACSEICRRAIDSVLAFVRIS  216



>ref|XP_008892901.1| hypothetical protein PPTG_01379 [Phytophthora parasitica INRA-310]
 ref|XP_008892902.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 ref|XP_008892903.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETI45620.1| hypothetical protein F443_09870 [Phytophthora parasitica P1569]
 gb|ETI45621.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETI45622.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETK85570.1| hypothetical protein L915_09669 [Phytophthora parasitica]
 gb|ETK85571.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETK85572.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL38999.1| hypothetical protein L916_09572 [Phytophthora parasitica]
 gb|ETL39000.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL39001.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL92120.1| hypothetical protein L917_09497 [Phytophthora parasitica]
 gb|ETL92121.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL92122.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM45419.1| hypothetical protein L914_09536 [Phytophthora parasitica]
 gb|ETM45420.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM45421.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETN21066.1| hypothetical protein PPTG_01379 [Phytophthora parasitica INRA-310]
 gb|ETN21067.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN21068.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETO74264.1| hypothetical protein F444_09964 [Phytophthora parasitica P1976]
 gb|ETO74265.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
 gb|ETO74266.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETP15430.1| hypothetical protein F441_09818 [Phytophthora parasitica CJ01A1]
 gb|ETP15431.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
 gb|ETP15432.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP43500.1| hypothetical protein F442_09773 [Phytophthora parasitica P10297]
 gb|ETP43501.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
 gb|ETP43502.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=229

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 124/232 (53%), Gaps = 18/232 (8%)
 Frame = +1

Query  103  LLVMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGP-KAGTKKNEN  279
            ++   + R+DGR  N+LRP A  +G L RA GSA  S G + VLAAVYGP +A   + E 
Sbjct  1    MVATTLQRQDGRAGNELRPFASEQGALFRADGSARMSHGSSTVLAAVYGPGQARNWRAEK  60

Query  280  PEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALL  459
             +KA ++V +K + G +  +EKE E I++ T   + L    P    S+++QV+ D+G+LL
Sbjct  61   TDKATLDVCFKLEKGIMTSKEKEYEQIIRETFTPVVLTDNFPRAVISIVVQVIEDNGSLL  120

Query  460  PCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPH  639
              AINA   AL+DAG+P+  +  A  C + +   + LDP   EE++  ++V     ++  
Sbjct  121  AVAINAVSLALMDAGVPMISVVTATSCSIFDDGNLYLDPTSAEEEEAVSWVTTARSSTSD  180

Query  640  LALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                             G++T +++G L  + Y  C    + ASE ++ + R
Sbjct  181  -----------------GVLTCISNGLLSEEQYFACSEACQRASESVAAFFR  215



>ref|XP_001372178.1| PREDICTED: exosome complex component RRP46 [Monodelphis domestica]
Length=237

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VL  VYGP       E   KA +EVI KPK G  
Sbjct  30   LRHFACEQNLLSRPDGSASFLQGDTSVLVGVYGPAEVKVSKEIFNKATLEVILKPKIGLP  89

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++Q+V+D G+LL C +NAAC ALVDAG+P
Sbjct  90   GVAEKSRERLIRTTCEAVVLGTLHPRTSITVVLQIVSDAGSLLACCLNAACLALVDAGVP  149

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            L+ L   + C L     +VLDP   +E++ +A +     ++                 E 
Sbjct  150  LRALFCGVTCALDLDGGLVLDPTAKQEKEARAILTFALDST-----------------EQ  192

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V ++  CL  A+ AS  +  + R SL
Sbjct  193  KLLMSTTKGLYSVAEFQQCLAAAQHASLHIFRFYRDSL  230



>emb|CBJ25452.1| conserved unknown protein [Ectocarpus siliculosus]
Length=230

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 134/234 (57%), Gaps = 21/234 (9%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPK-AGTKKNENPEK  288
            ME  RRDGR ANQ+RPLA  +G+LNRA GSA + QG T VLAAVYGP  A + + E  E 
Sbjct  1    MEETRRDGRRANQIRPLAAEQGILNRADGSARFVQGNTSVLAAVYGPAPAKSLRMERSEG  60

Query  289  ACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCA  468
            A ++V +KP++G     + E E +++R+L+ + L + +P T  SVIIQV+ DDGA+L  A
Sbjct  61   ATLDVSFKPESGITSSADAESEALLRRSLEEVVLRSRYPRTVVSVIIQVIVDDGAVLSAA  120

Query  469  INAACAALVDAGIPLKHLAVAICCCLAES---KYVVLDPDKLEEQKMKAFVYLVFPNSPH  639
            +NAA  AL++AG+ +  +A+++ CC+  +   + V+LDP K EE    A           
Sbjct  121  LNAATMALLNAGVEMTGMALSVTCCITATVSGRSVLLDPCKAEEIDAAA-----------  169

Query  640  LALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
                  +L AGG  + C  +     G +  ++Y  C   A   +  +  ++R S
Sbjct  170  -TAVVATLSAGGGVLSCHAV-----GSMSQEEYFACCEAASLGTTAVRSFVRLS  217



>ref|XP_006189877.1| PREDICTED: exosome complex component RRP46 [Camelus ferus]
 ref|XP_010945600.1| PREDICTED: exosome complex component RRP46 [Camelus bactrianus]
Length=235

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSGGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_010983543.1| PREDICTED: exosome complex component RRP46 [Camelus dromedarius]
Length=235

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSGGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_006900980.1| PREDICTED: exosome complex component RRP46 [Elephantulus edwardii]
Length=235

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVLLRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGVLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGNLVLDPTAKQEKEARAVLTFAL-----------------DSVEQ  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A++AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSNTELQQCLAAAQSASQHVFRFFRESL  228



>ref|XP_006215046.1| PREDICTED: exosome complex component RRP46 [Vicugna pacos]
Length=235

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_006165337.1| PREDICTED: exosome complex component RRP46 [Tupaia chinensis]
 gb|ELV12200.1| Exosome complex component RRP46 [Tupaia chinensis]
Length=235

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NA C ALVDAG+P
Sbjct  88   GVAEKTRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNATCMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + +E 
Sbjct  148  MQALFCGVTCTLDSDGALVLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     ++  CL  A+AAS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSNAEFHQCLAAAQAASQHVFRFYRESL  228



>ref|XP_001790575.2| PREDICTED: exosome complex component RRP46 [Bos taurus]
 ref|XP_002695041.2| PREDICTED: exosome complex component RRP46 [Bos taurus]
Length=235

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  191  KLLMSTTKGLYSDTELQQCLAAAQTASTHVFRFYRESL  228



>ref|XP_010847573.1| PREDICTED: exosome complex component RRP46 [Bison bison bison]
Length=235

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GIAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  191  KLLMSTTKGLYSDTELQQCLAAAQTASTHVFRFYRESL  228



>ref|XP_005692493.1| PREDICTED: exosome complex component RRP46 [Capra hircus]
Length=235

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASTHVFRFYRESL  228



>ref|XP_006871456.1| PREDICTED: exosome complex component RRP46 [Chrysochloris asiatica]
Length=238

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PK G  
Sbjct  31   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVLLRPKIGLP  90

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  91   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  150

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   I C L +   +VLDP   +E+  +A +                     + +E 
Sbjct  151  MRALFCGITCALDDDGNLVLDPTVKQEKVARAILTFAL-----------------DSVEQ  193

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     ++  CL  A+ AS+ +  + R SL
Sbjct  194  KLLMSTTKGLYSNAEFQQCLVAAQTASQHVFRFYRESL  231



>ref|XP_005971422.1| PREDICTED: exosome complex component RRP46 [Pantholops hodgsonii]
Length=235

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASTHVFRFYRESL  228



>ref|XP_003459176.2| PREDICTED: exosome complex component RRP46-like [Oreochromis 
niloticus]
Length=232

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 123/224 (55%), Gaps = 17/224 (8%)
 Frame = +1

Query  133  GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWK  312
            G     LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+ +
Sbjct  18   GSLTVSLREFGCEQSLLSRPDGSASFVQGDTSVMAGVYGPAEVKVSKEIYDRATLEVLVQ  77

Query  313  PKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAAL  492
            PK G    +E+  E  V+ T ++  LLT+HP ++ ++I+QV++DDG+LL C +NAAC AL
Sbjct  78   PKVGLPSVRERSQEQCVRETCEASLLLTLHPRSSLTLILQVLHDDGSLLSCCLNAACMAL  137

Query  493  VDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            +DAG+P+  L   + C ++    ++ DP   +E++ +A +     ++ H           
Sbjct  138  MDAGLPMSCLFCGVTCAISTDGQIITDPTAAQEKESRALMTFAIDSAKH-----------  186

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                   ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  187  ------SVLMSSTKGSFSVHELQQCIAVSQKASEKIFQFYRDSV  224



>ref|XP_006052120.1| PREDICTED: exosome complex component RRP46 [Bubalus bubalis]
Length=235

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASTHVFRFYRESL  228



>ref|XP_007883779.1| PREDICTED: exosome complex component RRP46 [Callorhinchus milii]
Length=221

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 121/218 (56%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP  C   +L+R  GSA ++QG+T VLAAVYGP       E  +KA +EV+ KPK G  
Sbjct  11   LRPFGCEYSLLSRPDGSACFTQGDTTVLAAVYGPAEVKVSKEIFDKATLEVLLKPKVGLP  70

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  E+  E +++ T ++  L  +HP ++ +V++QV++D G+LL C +NAAC AL+DAG+P
Sbjct  71   GVAERSKEQLIRNTCEATILTALHPRSSITVVLQVIHDAGSLLSCCLNAACTALIDAGLP  130

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   I C +     ++LDP   +E++ +A                  L    + ++ 
Sbjct  131  MRSLFCGITCLIDSDGNILLDPTSKQEKEYRAV-----------------LTFSMDSVDK  173

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V++   C+   +  SEK+ ++ R S+
Sbjct  174  KVLLSSTKGSYSVEELQQCIATCQKGSEKVFQFYRDSV  211



>gb|EPY77328.1| exosome complex component RRP46 [Camelus ferus]
Length=296

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  89   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKTGLP  148

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  149  GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  208

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  209  MRALFCGVTCALDSGGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  251

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  252  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  289



>ref|NP_001231590.1| exosome component 5 [Sus scrofa]
Length=235

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP     + E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVRKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L      +LDP   +E++ +A +                     + +E 
Sbjct  148  MRALFCGVTCALDSDGTFMLDPTAKQEKEARAVLTFAL-----------------DSVER  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>gb|EFA75059.1| hypothetical protein PPL_11677 [Polysphondylium pallidum PN500]
Length=233

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 117/224 (52%), Gaps = 18/224 (8%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R D R  NQ+R +     +LN+A GSA +S   + VLAA+YGP     + E   KA +EV
Sbjct  3    RIDKRNNNQIRSIESELALLNKADGSAKFSLDNSSVLAAIYGPVEVNPRKEKISKATVEV  62

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            ++ P +G    Q KE E +++  ++S+ +  +HP T  S+IIQV + DG+++ C+INAAC
Sbjct  63   VFTPDSGNQNYQTKEQESLIRNAIESVIMTMLHPRTLISIIIQVYSTDGSIVSCSINAAC  122

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
             AL+DAGI L  L  +I         + LDP   EE + KA     F +   L + K S 
Sbjct  123  LALLDAGIELNSLIASISLSFNSDGQIYLDPTMKEENESKATAIYAFNSQLKLMMIKSS-  181

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                     GIIT   + +         L  AR++ E++  Y+R
Sbjct  182  ---------GIITEQQNQE--------ALQLARSSCERILAYIR  208



>ref|XP_008986316.1| PREDICTED: exosome complex component RRP46 [Callithrix jacchus]
Length=255

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN--------SPHLALPKESL  663
            P++ L   + C L     +VLDP    E++ +A +     N        S + +LP+ S 
Sbjct  147  PMRALFCGVTCALDSDGTLVLDPTSKREKEARAVLTFALDNVERKLLMSSTNQSLPRSSS  206

Query  664  QAGGEPMECGIITSVTHG  717
             A   P      +S + G
Sbjct  207  SAWPRPRRLRNTSSASTG  224



>ref|XP_011442915.1| PREDICTED: exosome complex component RRP46-like [Crassostrea 
gigas]
 gb|EKC43209.1| Exosome complex exonuclease RRP46 [Crassostrea gigas]
Length=215

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 126/220 (57%), Gaps = 17/220 (8%)
 Frame = +1

Query  145  NQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTG  324
            ++LR L+ + G L+R  G A+ SQG+T V +AVYGP       E  +KA I+V++KPK+G
Sbjct  6    SKLRQLSSTLGDLSRPDGDATVSQGDTCVTSAVYGPGEVKVTKELLDKATIDVVYKPKSG  65

Query  325  QIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAG  504
              G  EK  E  ++ + +++ L  +HP ++ S+ +Q + + G+LL C IN+ C AL+D+G
Sbjct  66   LPGCAEKLLERTIRNSCETVILGNLHPRSSISITVQEIQNRGSLLSCCINSTCMALLDSG  125

Query  505  IPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPM  684
            + +++L  A+ C + ++  +++DP+ L+EQ   A +  VF N  +               
Sbjct  126  VSMRYLMAAVSCAINDNGSIIMDPNTLQEQSTVAMLTFVFENCNY---------------  170

Query  685  ECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              G+IT    G   +D +  CL++ R AS+ + ++ + S+
Sbjct  171  --GVITVSAKGCYTLDQFQQCLSKCRDASKYVFQFFKDSI  208



>ref|XP_005412404.1| PREDICTED: exosome complex component RRP46 [Chinchilla lanigera]
Length=261

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSA++ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  54   LRHFACEQNLLSRPDGSAAFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  113

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T Q++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  114  GVAEKSRERLIRNTCQAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  173

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  174  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  216

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  217  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  254



>ref|XP_004670366.1| PREDICTED: exosome complex component RRP46 [Jaculus jaculus]
Length=222

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (1%)
 Frame = +1

Query  112  MEIDRRDGRTAN-QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEK  288
            ME+D    R     LR  AC + +L+R  GS+S+ QG+T VLA VYGP       E   K
Sbjct  1    MEVDEPSSRPPGCSLRHFACEQNLLSRPDGSSSFLQGDTSVLAGVYGPAEVKVSKEIFNK  60

Query  289  ACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCA  468
            A +EVI +PKTG  G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C 
Sbjct  61   ATLEVILRPKTGLPGVPEKSRERLIRSTCEAVVLGALHPRTSITVVLQVVSDAGSLLACC  120

Query  469  INAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYL  618
            +NAAC ALVDAG+P++ L   + C L     +VLDP   +E++ +A +  
Sbjct  121  LNAACMALVDAGVPMRALFCGVTCALDSDGTLVLDPTTKQEKEARAVLTF  170



>ref|XP_008307243.1| PREDICTED: exosome complex component RRP46 [Cynoglossus semilaevis]
Length=219

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 123/219 (56%), Gaps = 17/219 (8%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
            +LR   C + +L+R  GSAS+ QG+T V A VYGP       E  ++A +EV+ +PK G 
Sbjct  10   KLREFGCEQSLLSRPDGSASFIQGDTSVCAGVYGPAEVKVSKEIYDRATLEVLIQPKVGL  69

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G +E+  E  V+ T ++  LL++HP ++ ++++QV++DDG+LL C +NAAC AL+DAG+
Sbjct  70   AGVRERSQEQCVRETCEASLLLSLHPRSSLTLVLQVIHDDGSLLSCFLNAACMALMDAGL  129

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            P+  L   + C ++    +V DP   +E++ +A +     ++                 E
Sbjct  130  PMSCLFCGVTCAISADGQIVTDPTAAQEKESRALMTFAIDST-----------------E  172

Query  688  CGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              I+ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  173  RNILMSSTKGSFSVHELQQCIVVSQKASEKMFQFYRDSV  211



>ref|XP_009839526.1| hypothetical protein H257_13641 [Aphanomyces astaci]
 gb|ETV70863.1| hypothetical protein H257_13641 [Aphanomyces astaci]
Length=230

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 119/225 (53%), Gaps = 18/225 (8%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAG-TKKNENPEKACIE  300
            R DGR   ++RPL+C +G+LNRA GSA +S G T V+A+V GP A   ++ E  + A +E
Sbjct  11   REDGRLVQEIRPLSCEQGLLNRADGSARFSHGSTSVVASVNGPAAAKNRRQEKVDAATLE  70

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V++K   G    ++KE E+I+++T +++  L   P    S+ +QVV DDG+LL  AINA 
Sbjct  71   VVFKSDKGAPTARDKEYEVILRQTFETVVYLENFPRAVISLTVQVVEDDGSLLAVAINAV  130

Query  481  CAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKES  660
              AL+DAGIP++ L  AI C + +   + LDP   E     A                 S
Sbjct  131  NLALLDAGIPMRSLVGAITCSILDDGQLCLDPSLTEGDAATA-----------------S  173

Query  661  LQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
            + A       GI+TS+T G L    Y       R A + +  ++R
Sbjct  174  VTAACAGKNDGILTSLTTGLLNESQYFASSEICRRAIDSVLSFVR  218



>ref|XP_007941330.1| PREDICTED: exosome complex component RRP46 [Orycteropus afer 
afer]
Length=237

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PK G  
Sbjct  30   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVLLRPKIGLP  89

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  90   GVAEKSREWLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  149

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + +E 
Sbjct  150  MRALFCGVTCALDADGNLVLDPTAKQEKEARAVLTFAL-----------------DSVEQ  192

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+A S+ +  + R SL
Sbjct  193  KLLMSTTKGLYSNAELQQCLAAAQATSQHIFRFYRESL  230



>ref|XP_004015323.2| PREDICTED: exosome complex component RRP46 [Ovis aries]
 ref|XP_012027144.1| PREDICTED: exosome complex component RRP46 [Ovis aries musimon]
Length=297

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  90   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  149

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  150  GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  209

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     ++LDP   +E++ +A +                     + +E 
Sbjct  210  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL-----------------DSVER  252

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  253  KLLMSTTKGLYSDAELQQCLAAAQTASTHVFRFYRESL  290



>ref|XP_002722356.2| PREDICTED: exosome complex component RRP46 [Oryctolagus cuniculus]
Length=263

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 120/219 (55%), Gaps = 17/219 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  56   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  115

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++Q+V+D G+LL C +NAAC ALVDAG+P
Sbjct  116  GVAEKNRERMIRNTCEAVVLGALHPRTSITVVLQIVSDAGSLLACCLNAACMALVDAGVP  175

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  176  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  218

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSLI  807
             ++ S T G     +   CL  A+ AS+ +  + R SL+
Sbjct  219  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRDSLL  257



>ref|XP_008607929.1| hypothetical protein SDRG_04054 [Saprolegnia diclina VS20]
 gb|EQC38337.1| hypothetical protein SDRG_04054 [Saprolegnia diclina VS20]
Length=224

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 121/229 (53%), Gaps = 19/229 (8%)
 Frame = +1

Query  121  DRR-DGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGT-KKNENPEKAC  294
            DRR DGR   ++RPLAC + +LNRA GSA ++ G T VLA+V GP A   ++ E    A 
Sbjct  5    DRREDGRLVQEIRPLACEQSLLNRADGSARFNHGTTSVLASVSGPAAAKLRRQEKSSGAT  64

Query  295  IEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAIN  474
            +EV +K + G    ++KE EMI++ T + I +L   P    S+ +QVV DDGALL  AIN
Sbjct  65   LEVTFKAEKGAPSARDKEYEMILRETFEPIIVLENFPRAVVSITVQVVEDDGALLAVAIN  124

Query  475  AACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPK  654
            A   AL+DAG+P++ +  AI C + E   + LDP + E +   A V      +       
Sbjct  125  AVNLALIDAGVPMRSIVGAITCSILEDGQLCLDPSRSEGETAAATVTTACCGNND-----  179

Query  655  ESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
                        GI+TS+T G L  + Y  C    R A + +   +R S
Sbjct  180  ------------GILTSMTSGVLSEEQYFACSEICRRAIDSVLAVVRIS  216



>ref|XP_002891497.1| hypothetical protein ARALYDRAFT_891796 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67756.1| hypothetical protein ARALYDRAFT_891796 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 22/105 (21%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            +EIDR DGRT +QLRPLACSR +L+R HGSASWSQG+TKVLAAVYGPK GT+KNENPEKA
Sbjct  24   IEIDREDGRTPDQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKPGTRKNENPEKA  83

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVI  426
            C EVIWKPK+GQI                      V PNTT SV+
Sbjct  84   CFEVIWKPKSGQI----------------------VFPNTTLSVL  106


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +1

Query  616  LVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
            +VFPN+    LP+ S    GEP+E GII  VTHG + VDDY  C+   RAA+  LS + R
Sbjct  96   IVFPNTTLSVLPEGSSLVEGEPVEDGIIKLVTHGVMSVDDYFWCVENGRAATASLSAFFR  155

Query  796  RSL  804
            ++ 
Sbjct  156  KNF  158



>ref|XP_006814760.1| PREDICTED: exosome complex component RRP46-like, partial [Saccoglossus 
kowalevskii]
Length=190

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 113/190 (59%), Gaps = 17/190 (9%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
            +LR  +C + +L+R  GSA++ QG+T V+ AVYGP    +  E  +KA +EVI+KPK G 
Sbjct  12   ELRSQSCEQNLLSRPDGSATYCQGDTSVIVAVYGPAEVKQSKEFLDKATLEVIFKPKVGI  71

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T ++I L  +HP ++ ++IIQV+++ G+LL C +N+ C AL+DAG+
Sbjct  72   PGCSEKFQERLIRNTCETIVLTALHPRSSINIIIQVMHNAGSLLSCCVNSTCMALLDAGL  131

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            P+  L  A+ C L+    ++LDP   +E++ KA +  VF                 E  +
Sbjct  132  PMSCLVAAVTCSLSCDGDIILDPTSQQEKEAKAILTFVF-----------------ESRD  174

Query  688  CGIITSVTHG  717
              IITS THG
Sbjct  175  NEIITSNTHG  184



>ref|XP_004060830.1| PREDICTED: exosome complex component RRP46 [Gorilla gorilla gorilla]
Length=235

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   I C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGITCALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>ref|NP_001232110.1| putative exosome component 5 [Taeniopygia guttata]
 gb|ACH43655.1| putative exosome component 5 [Taeniopygia guttata]
Length=224

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 124/225 (55%), Gaps = 19/225 (8%)
 Frame = +1

Query  130  DGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIW  309
            DGR   +LR  +C  G+L+R  GSA++ QG+T VLA +YGP       E P++A ++V+ 
Sbjct  12   DGRC--RLRRFSCELGLLSRPDGSAAFLQGDTSVLAGLYGPAEAKISKELPDRAALDVLL  69

Query  310  KPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAA  489
            +PK G  G  E+  E ++++T +++ L  +HP T  S+++QV++D G+LL C +NAAC A
Sbjct  70   RPKVGLPGVLERSREQLLQQTCEAVVLGVLHPRTAISLVLQVLSDAGSLLSCCLNAACMA  129

Query  490  LVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQA  669
            L+DAG+PL  L   + C L     ++LDP   +EQ+ +A +     ++            
Sbjct  130  LLDAGLPLSALFCGVTCALQPDGAILLDPTARQEQEARAVLTFAIASADR----------  179

Query  670  GGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                    ++   T G   V +   CL  A+ A++ + ++ R S+
Sbjct  180  -------KVLMVTTKGSCSVQEMQQCLAAAQRAADTIFQFYRDSV  217



>ref|XP_008880365.1| hypothetical protein H310_14314 [Aphanomyces invadans]
 gb|ETV90976.1| hypothetical protein H310_14314 [Aphanomyces invadans]
Length=229

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/227 (36%), Positives = 118/227 (52%), Gaps = 19/227 (8%)
 Frame = +1

Query  121  DRRD-GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAG-TKKNENPEKAC  294
            DRRD GR   ++RPL+C +G+LNRA GSA +  G T VLA+V GP A   +++E  + A 
Sbjct  8    DRRDDGRLVQEIRPLSCEQGLLNRADGSARFCHGSTSVLASVNGPAAAKIRRHEKVDAAT  67

Query  295  IEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAIN  474
            +EV++K   G    ++KE E I+K+T   I  +  +P    S+ +QVV DDG+LL  AIN
Sbjct  68   VEVVFKSDKGAPTARDKEYEAILKQTFDPIVYVENYPRAVISITVQVVEDDGSLLAVAIN  127

Query  475  AACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPK  654
            A   AL+DAGIP++ L  AI C + +   + LDP   E     A V   +          
Sbjct  128  AVNLALLDAGIPMRSLVGAITCSILDDGQLCLDPSLTEGDAATASVTAAYAGKND-----  182

Query  655  ESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                        GI+TS+T G +    Y       R A + +  ++R
Sbjct  183  ------------GILTSITTGLVNESQYFAASEICRRAIDSVLSFVR  217



>ref|XP_010621639.1| PREDICTED: exosome complex component RRP46 [Fukomys damarensis]
 gb|KFO33652.1| Exosome complex component RRP46 [Fukomys damarensis]
Length=235

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSA++ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSAAFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAGIP
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGIP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   I C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  148  MRALFCGITCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSNTKGIYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_006796741.1| PREDICTED: exosome complex component RRP46-like [Neolamprologus 
brichardi]
Length=232

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 122/224 (54%), Gaps = 17/224 (8%)
 Frame = +1

Query  133  GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWK  312
            G     LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+ +
Sbjct  18   GSLTVSLREFGCEQSLLSRTDGSASFVQGDTSVMAGVYGPAEVKVSKEIYDRATLEVLVQ  77

Query  313  PKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAAL  492
            PK G    +E+  E  V+ T ++  LLT+HP ++ ++I+QV++DDG+LL C +NAAC AL
Sbjct  78   PKVGLPSVRERSQEQCVRETCEASLLLTLHPRSSLTLILQVLHDDGSLLSCCLNAACMAL  137

Query  493  VDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            +DAG+P+  L   + C ++    ++ DP   +E++ +A +     ++             
Sbjct  138  MDAGLPMSCLFCGVTCAISTDGQIITDPTAAQEKESRALMTFAIDSAKR-----------  186

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                   ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  187  ------SVLMSSTKGSFSVHELQQCIAVSQKASEKIFQFYRDSV  224



>ref|XP_004776116.1| PREDICTED: exosome complex component RRP46 isoform X2 [Mustela 
putorius furo]
 ref|XP_004810180.1| PREDICTED: exosome complex component RRP46 isoform X2 [Mustela 
putorius furo]
Length=231

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A + L  
Sbjct  144  MRALFCGVTCALNADGTLVLDPTAKQEKEARAVLTLAL  181



>ref|XP_004560523.1| PREDICTED: exosome complex component RRP46-like [Maylandia zebra]
 ref|XP_005735946.1| PREDICTED: exosome complex component RRP46-like [Pundamilia nyererei]
Length=232

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 122/224 (54%), Gaps = 17/224 (8%)
 Frame = +1

Query  133  GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWK  312
            G     LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+ +
Sbjct  18   GSLTVSLREFGCEQSLLSRTDGSASFVQGDTSVMAGVYGPAEVKVNKEIYDRATLEVLVQ  77

Query  313  PKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAAL  492
            PK G    +E+  E  V+ T ++  LLT+HP ++ ++I+QV++DDG+LL C +NAAC AL
Sbjct  78   PKVGLPSVRERSQEQCVRETCEASLLLTLHPRSSLTLILQVLHDDGSLLSCCLNAACMAL  137

Query  493  VDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            +DAG+P+  L   + C ++    ++ DP   +E++ +A +     ++             
Sbjct  138  MDAGLPMSCLFCGVTCAISTDGQIITDPTAAQEKESRALMTFAIDSAKR-----------  186

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                   ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  187  ------SVLMSSTKGSFSVHELQQCIAVSQKASEKIFQFYRDSV  224



>ref|XP_004873054.1| PREDICTED: exosome complex component RRP46 [Heterocephalus glaber]
Length=235

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSA++ QG+T +LA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSAAFLQGDTSILAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   I C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  148  MRALFCGITCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_001152170.1| PREDICTED: exosome complex component RRP46 [Pan troglodytes]
 ref|XP_003812509.1| PREDICTED: exosome complex component RRP46 [Pan paniscus]
Length=235

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>ref|XP_005936836.1| PREDICTED: exosome complex component RRP46-like [Haplochromis 
burtoni]
Length=246

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 122/224 (54%), Gaps = 17/224 (8%)
 Frame = +1

Query  133  GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWK  312
            G     LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+ +
Sbjct  32   GSLTVSLREFGCEQSLLSRTDGSASFVQGDTSVMAGVYGPAEVKVNKEIYDRATLEVLVQ  91

Query  313  PKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAAL  492
            PK G    +E+  E  V+ T ++  LLT+HP ++ ++I+QV++DDG+LL C +NAAC AL
Sbjct  92   PKVGLPSVRERSQEQCVRETCEASLLLTLHPRSSLTLILQVLHDDGSLLSCCLNAACMAL  151

Query  493  VDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            +DAG+P+  L   + C ++    ++ DP   +E++ +A +     ++             
Sbjct  152  MDAGLPMSCLFCGVTCAISTDGQIITDPTAAQEKESRALMTFAIDSAKR-----------  200

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                   ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  201  ------SVLMSSTKGSFSVHELQQCIAVSQKASEKIFQFYRDSV  238



>gb|AAH07742.1| Exosome component 5 [Homo sapiens]
 gb|AAI07697.1| Exosome component 5 [Homo sapiens]
 gb|EAW57038.1| exosome component 5 [Homo sapiens]
 gb|ADZ15693.1| exosome component 5 [synthetic construct]
 gb|AIC56814.1| EXOSC5, partial [synthetic construct]
Length=235

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>pdb|2NN6|D Chain D, Structure Of The Human Rna Exosome Composed Of Rrp41, 
Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40
Length=237

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  29   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  88

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  89   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  148

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  149  PMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFAL  187



>ref|XP_004339442.1| 3' exoribonuclease family, domain 1 domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR17429.1| 3' exoribonuclease family, domain 1 domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=236

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +1

Query  112  MEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            ME+ R  GRT NQLR +    G+LN+  GSA ++ G++ V+ AVYGP     ++E  ++A
Sbjct  1    MEVKRSGGRTNNQLRAVTSELGLLNKPDGSAKYTAGKSAVVVAVYGPIEVKHRDEILDRA  60

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             I+V W P +G  G +E+E EMIV   +Q+  + T+HP T   +++Q       +L  AI
Sbjct  61   TIKVHWSPSSGTGGPEEREKEMIVANVVQNAIIATLHPRTLIEIVVQ-------MLAAAI  113

Query  472  NAACAALVDAGIPLKH---------------LAVAICCCLAESKYVVLDPDKLEEQKMKA  606
            NA C ALVDAGIPLK+                  ++ C +A++   VLDPD  EE   +A
Sbjct  114  NATCLALVDAGIPLKYRPAHPTLDFALELLSWIASVTCAIAQNGVFVLDPDLAEESAARA  173

Query  607  FVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSE  786
             +   F N     +   S+         G++   + G+ E + YL CL  AR ++  L  
Sbjct  174  VLLFAFNNQNDGVVASHSV---------GVLRK-SEGEGE-EFYLTCLAAARQSAFTLFS  222

Query  787  Y  789
            Y
Sbjct  223  Y  223



>ref|NP_064543.3| exosome complex component RRP46 [Homo sapiens]
 sp|Q9NQT4.1|EXOS5_HUMAN RecName: Full=Exosome complex component RRP46; AltName: Full=Chronic 
myelogenous leukemia tumor antigen 28; AltName: Full=Exosome 
component 5; AltName: Full=Ribosomal RNA-processing 
protein 46; AltName: Full=p12B [Homo sapiens]
 gb|AAF82135.1|AF281134_1 exosome component Rrp46 [Homo sapiens]
 dbj|BAG73135.1| exosome component 5 [synthetic construct]
Length=235

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>ref|XP_006677848.1| hypothetical protein BATDEDRAFT_23824 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81417.1| hypothetical protein BATDEDRAFT_23824 [Batrachochytrium dendrobatidis 
JAM81]
Length=217

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 107/171 (63%), Gaps = 0/171 (0%)
 Frame = +1

Query  109  VMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEK  288
            +M   R D R+  QLR + C  G+L+RA GSA ++ G++ VL +VYGP A   ++E  + 
Sbjct  13   LMGHSRPDKRSVTQLRTMGCVVGMLSRADGSARFTLGKSSVLCSVYGPTASRPRDEKLDH  72

Query  289  ACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCA  468
            A I+V++ P +G  G QE+  E  +++ +++I L  +HP TT  + +QV+ DDG++L  A
Sbjct  73   AHIQVVFSPVSGISGTQERTYEHFIRQVVEAIVLSALHPRTTIQITLQVLFDDGSILSTA  132

Query  469  INAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLV  621
            INAA  AL+DAGIPL     A+ C +++   ++LDP  LE  + ++   LV
Sbjct  133  INAAVLALIDAGIPLSKTCSAVTCMISKEGVLLLDPVLLECSEAQSMHILV  183



>gb|AAH99290.1| LOC733302 protein [Xenopus laevis]
Length=224

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 118/215 (55%), Gaps = 17/215 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSA++ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  17   LREYGCEQSLLSRPDGSATFLQGDTSVLAGVYGPAEIKVSREIHNKATLEVILRPKTGLP  76

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              QEK  E +++ T +S+ + ++HP T+ ++++Q+++D G+LL C +NAAC  L+DAG+P
Sbjct  77   AIQEKNHEQLIRETCESVIIGSLHPRTSITIVLQIISDAGSLLSCCLNAACMGLMDAGLP  136

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     + LDP+  ++++ +A V                     E  E 
Sbjct  137  MRSLFCGVTCALDNDGNITLDPNDRQQKESRAVVTFAI-----------------ESTER  179

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
             ++ + + G     +   C+  A+ ASEKL ++ R
Sbjct  180  KVLMTSSRGLYSAAELQQCIAAAQLASEKLFQFYR  214



>gb|EFB16301.1| hypothetical protein PANDA_012923, partial [Ailuropoda melanoleuca]
Length=206

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  ANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKT  321
            A  LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK 
Sbjct  25   ACSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKI  84

Query  322  GQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDA  501
            G  G  EK  E +++ T +++ L T+HP T+ +V++QV++D G+LL C +NAAC ALVDA
Sbjct  85   GLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVISDAGSLLACCLNAACMALVDA  144

Query  502  GIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            G+P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  145  GVPMRALFCGVTCALNSDGTLVLDPTAKQEKEARAVLTFAL  185



>ref|XP_852838.1| PREDICTED: exosome complex component RRP46 [Canis lupus familiaris]
Length=235

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVTCALNSDGTLVLDPTAKQEKEARAVLTFAL  185



>ref|XP_003968627.1| PREDICTED: exosome complex component RRP46 [Takifugu rubripes]
Length=219

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 123/218 (56%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  +C + +L+R  GS+S+ QG+T VLA VYGP       E  ++A +EV+ +PK G  
Sbjct  11   LRDFSCEQSLLSRPDGSSSFMQGDTSVLAGVYGPAEVKVSKEIYDRATLEVLIQPKVGLP  70

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              +E+  E  V+ T ++  LL++HP ++ ++++QV++DDG+LL C +NAAC AL+DAG+P
Sbjct  71   SVKERSQEQNVRETCEASLLLSLHPRSSLTLVLQVLHDDGSLLSCFLNAACMALMDAGLP  130

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            +  L   + C +A    ++ DP   +E++ +A +                     +  +C
Sbjct  131  MSCLFCGVTCAIAVDGEIITDPTAAQEKECRALLTFAI-----------------DSKKC  173

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  174  RVMMSSTKGSFSVQELQQCIAISQKASEKIFQFYRDSV  211



>ref|XP_002923728.1| PREDICTED: exosome complex component RRP46 [Ailuropoda melanoleuca]
Length=239

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  ANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKT  321
            A  LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK 
Sbjct  29   ACSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKI  88

Query  322  GQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDA  501
            G  G  EK  E +++ T +++ L T+HP T+ +V++QV++D G+LL C +NAAC ALVDA
Sbjct  89   GLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVISDAGSLLACCLNAACMALVDA  148

Query  502  GIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            G+P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  149  GVPMRALFCGVTCALNSDGTLVLDPTAKQEKEARAVLTFAL  189



>ref|XP_010379101.1| PREDICTED: exosome complex component RRP46 [Rhinopithecus roxellana]
Length=260

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  53   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  112

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  113  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  172

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  173  MRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFAL  210



>ref|XP_011942250.1| PREDICTED: exosome complex component RRP46 [Cercocebus atys]
Length=260

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 0/160 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  53   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  112

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  113  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  172

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
            ++ L   + C L     +VLDP   +E++ +A +     +
Sbjct  173  MRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFALDS  212



>ref|XP_011791908.1| PREDICTED: exosome complex component RRP46 [Colobus angolensis 
palliatus]
Length=260

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 0/160 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  53   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  112

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  113  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  172

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
            ++ L   + C L     +VLDP   +E++ +A +     +
Sbjct  173  MRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFALDS  212



>ref|XP_003915633.1| PREDICTED: exosome complex component RRP46 [Papio anubis]
 ref|XP_005589409.1| PREDICTED: exosome complex component RRP46 isoform X1 [Macaca 
fascicularis]
 ref|XP_011838806.1| PREDICTED: exosome complex component RRP46 [Mandrillus leucophaeus]
 ref|XP_011762955.1| PREDICTED: exosome complex component RRP46 [Macaca nemestrina]
Length=260

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  52   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  111

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  112  PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  171

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
            P++ L   + C L     +VLDP   +E++ +A +     +
Sbjct  172  PMRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFALDS  212



>ref|XP_003462029.1| PREDICTED: exosome complex component RRP46 [Cavia porcellus]
Length=240

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 118/218 (54%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSA++ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  33   LRHFACEQNLLSRPDGSATFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  92

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +N AC ALVDAGIP
Sbjct  93   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNVACMALVDAGIP  152

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  153  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  195

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  196  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  233



>ref|XP_010565491.1| PREDICTED: exosome complex component RRP46, partial [Haliaeetus 
leucocephalus]
Length=188

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 102/161 (63%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP +C +G+L+R  GSA++ QG+T VL  +YGP       E P++A +EV+ +PK G  
Sbjct  10   LRPFSCEQGLLSRPDGSAAFLQGDTSVLVGLYGPAEVKVSKELPDRAALEVLLRPKVGLP  69

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  E+  E +++RT +++ L  +HP T  ++++QV++D G+LL C +NAAC  ++DAG+P
Sbjct  70   GVIERSREQLLRRTCEAVVLGVLHPRTAITLVLQVLSDAGSLLSCCLNAACMGMLDAGLP  129

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            L  L   + C +  +  +VLDP   +EQ+ +A +     ++
Sbjct  130  LSSLFCGVTCAIDPNGVIVLDPTTQQEQEARAILTFALDST  170



>ref|XP_007995095.1| PREDICTED: exosome complex component RRP46 isoform X1 [Chlorocebus 
sabaeus]
Length=260

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  52   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  111

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  112  PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  171

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
            P++ L   + C L     +VLDP   +E++ +A +     +
Sbjct  172  PMRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFALDS  212



>ref|XP_009839527.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV70864.1| hypothetical protein, variant [Aphanomyces astaci]
Length=174

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 98/156 (63%), Gaps = 1/156 (1%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAG-TKKNENPEKACIE  300
            R DGR   ++RPL+C +G+LNRA GSA +S G T V+A+V GP A   ++ E  + A +E
Sbjct  11   REDGRLVQEIRPLSCEQGLLNRADGSARFSHGSTSVVASVNGPAAAKNRRQEKVDAATLE  70

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V++K   G    ++KE E+I+++T +++  L   P    S+ +QVV DDG+LL  AINA 
Sbjct  71   VVFKSDKGAPTARDKEYEVILRQTFETVVYLENFPRAVISLTVQVVEDDGSLLAVAINAV  130

Query  481  CAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLE  588
              AL+DAGIP++ L  AI C + +   + LDP   E
Sbjct  131  NLALLDAGIPMRSLVGAITCSILDDGQLCLDPSLTE  166



>ref|XP_001658056.1| AAEL006819-PA [Aedes aegypti]
 gb|EAT41543.1| AAEL006819-PA [Aedes aegypti]
Length=217

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 114/218 (52%), Gaps = 17/218 (8%)
 Frame = +1

Query  136  RTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKP  315
            ++ N LRP+ C   +L R+ GSA  +QGET V+A+V GP     ++ N EK+ I++ +KP
Sbjct  5    KSENSLRPMHCELNLLTRSDGSAMLTQGETAVVASVNGPIEVKLQHMNVEKSHIDIYFKP  64

Query  316  KTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALV  495
            ++G     ++  E ++K T +S  L  +HP T  S+ +Q + D G L+ CAINA C AL+
Sbjct  65   RSGMGSVNDRLLESLIKNTYESAILTGLHPRTAISIQLQEMQDQGGLVACAINAVCLALM  124

Query  496  DAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGG  675
            ++GI +K L  A+   L E   +VLDPD L+ +  +A    VF N               
Sbjct  125  NSGIEMKFLVAAVHSVLREDGDIVLDPDALQSKDARAKFTFVFENCTR------------  172

Query  676  EPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEY  789
                   ++  THGK   + Y   L  A  A EK+  +
Sbjct  173  -----NTVSIYTHGKFTTEQYHRALKMAEEAVEKVFGF  205



>gb|AAM75154.1| chronic myelogenous leukemia tumor antigen 28 [Homo sapiens]
Length=268

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  61   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  120

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  121  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  180

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  181  MRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFAL  218



>ref|XP_004776115.1| PREDICTED: exosome complex component RRP46 isoform X1 [Mustela 
putorius furo]
 ref|XP_004810179.1| PREDICTED: exosome complex component RRP46 isoform X1 [Mustela 
putorius furo]
Length=241

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 100/159 (63%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  23   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  82

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  83   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  142

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A + L  
Sbjct  143  PMRALFCGVTCALNADGTLVLDPTAKQEKEARAVLTLAL  181



>gb|AAH34358.1| Exosome component 5 [Mus musculus]
Length=235

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +V+ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            ++ L   + C L     +VLDP   +E++ +A +     ++
Sbjct  148  MRALFCGVTCALDSDGNLVLDPTTKQEKEARAILTFALDSA  188



>dbj|BAE33136.1| unnamed protein product [Mus musculus]
Length=235

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +V+ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            ++ L   + C L     +VLDP   +E++ +A +     ++
Sbjct  148  MRALFCGVTCALDSDGNLVLDPTTKQEKEARAILTFALDSA  188



>ref|NP_613052.1| exosome complex component RRP46 [Mus musculus]
 sp|Q9CRA8.1|EXOS5_MOUSE RecName: Full=Exosome complex component RRP46; AltName: Full=Exosome 
component 5; AltName: Full=Ribosomal RNA-processing 
protein 46 [Mus musculus]
 dbj|BAB24607.1| unnamed protein product [Mus musculus]
 dbj|BAB24993.1| unnamed protein product [Mus musculus]
 gb|EDL24247.1| exosome component 5, isoform CRA_b [Mus musculus]
Length=235

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +V+ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLVRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            ++ L   + C L     +VLDP   +E++ +A +     ++
Sbjct  148  MRALFCGVTCALDSDGNLVLDPTTKQEKEARAILTFALDSA  188



>ref|XP_002952423.1| hypothetical protein VOLCADRAFT_105481 [Volvox carteri f. nagariensis]
 gb|EFJ46566.1| hypothetical protein VOLCADRAFT_105481 [Volvox carteri f. nagariensis]
Length=247

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 129/227 (57%), Gaps = 4/227 (2%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R  GR   QLR L C R VL+RA GSA W+Q  + VLAAVYGP+    + E+ E+A +EV
Sbjct  15   RARGRLPTQLRTLVCERSVLDRADGSAKWTQEGSSVLAAVYGPRQAKPQKEDAEQAVVEV  74

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            ++KP+ G  G +++  E+ V+  L+ +  L ++P T+  V++QV+  DGA+L CA+NAAC
Sbjct  75   VYKPRAGLQGHEDRTFELEVRGILEGVIPLGMYPRTSIMVVLQVLQGDGAVLSCALNAAC  134

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
            AALVDAGI +  +  ++ C L E + ++LD D  EEQ  KA      P+  H  L K   
Sbjct  135  AALVDAGIAMTSMYASVTCVLTEEERLLLDSDAAEEQAAKACFCFTVPH--HYDLTKAI-  191

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              G   +    + S ++G    D  L     AR   E+++ +   SL
Sbjct  192  -DGQVVISNAALGSRSYGSFTSDHMLDAFMLARLGCERVAIFAWLSL  237



>ref|XP_001102687.2| PREDICTED: exosome complex exonuclease RRP46 [Macaca mulatta]
Length=277

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  69   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  128

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  129  PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  188

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  189  PMRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFAL  227



>dbj|BAG37447.1| unnamed protein product [Homo sapiens]
Length=235

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  ANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKT  321
               LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK 
Sbjct  25   GRSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKI  84

Query  322  GQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDA  501
            G  G  EK  E +++ T +++ L T+HP T+ +V+ QVV+D G+LL C +NAAC ALVDA
Sbjct  85   GLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVPQVVSDAGSLLACCLNAACMALVDA  144

Query  502  GIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            G+P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  145  GVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>ref|XP_008704864.1| PREDICTED: exosome complex component RRP46 [Ursus maritimus]
Length=221

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  142  ANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKT  321
            A  LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK 
Sbjct  25   ACSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKI  84

Query  322  GQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDA  501
            G  G  EK  E +++ T +++ L T+HP T+ +V++QV++D G+LL C +NAAC ALVDA
Sbjct  85   GLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVISDAGSLLACCLNAACMALVDA  144

Query  502  GIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            G+P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  145  GVPMRALFCGVTCALNSDGTLVLDPTAKQEKEARAILTFAL  185



>ref|XP_007231349.1| PREDICTED: exosome complex component RRP46 [Astyanax mexicanus]
Length=220

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 126/229 (55%), Gaps = 17/229 (7%)
 Frame = +1

Query  118  IDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACI  297
            +D+ +  + + LR     + +L++  GSA++ QG+T VLA VYGP       E  ++A +
Sbjct  1    MDQIETGSGSVLREYGSEQNLLSKPDGSATFLQGDTSVLAGVYGPAEVKVNKEIYDRATL  60

Query  298  EVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINA  477
            EV+ +PK G    +E+  E  V+ T +++ L T+HP ++ ++I+QVV+DDG+LL C +NA
Sbjct  61   EVVVQPKVGMSSVRERAREQCVRETCEAVLLSTLHPRSSLTLILQVVHDDGSLLSCCLNA  120

Query  478  ACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKE  657
            AC AL+DAG+P+  L   + C +  +  ++ DP   +E++ +A +               
Sbjct  121  ACMALMDAGLPMGRLFCGVTCAIDSNSQIITDPTAQQERESRALMTFAI-----------  169

Query  658  SLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                  +  E  ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  170  ------DSKELNVLMSSTKGSFSVKELQQCIALSQKASEKIFQFYRDSV  212



>ref|XP_007614880.1| PREDICTED: exosome complex component RRP46 isoform X2, partial 
[Cricetulus griseus]
Length=223

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 0/154 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  16   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  75

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  76   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  135

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFV  612
            ++ L   + C L     +VLDP   +E++ +A +
Sbjct  136  MRALFCGVSCALDSDGNLVLDPTTKQEKEARAIL  169



>ref|XP_003997820.1| PREDICTED: exosome complex component RRP46 [Felis catus]
Length=235

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSEGTLVLDPTAKQEKEARAILTFAL  185



>ref|XP_003802126.1| PREDICTED: exosome complex component RRP46 [Otolemur garnettii]
Length=235

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFMQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  185



>ref|XP_006265050.1| PREDICTED: exosome complex component RRP46 [Alligator mississippiensis]
Length=204

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP A  +G+L+R  GSA++ QG+T VLA VYGP       E+PE+A ++V+ +PK G  
Sbjct  11   LRPFAVEQGLLSRPDGSAAFVQGDTSVLAGVYGPAEVRSSRESPERAALDVLLRPKVGLP  70

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  E+  E +V+R  ++  L  +HP ++ ++++QVV+D G+LL C +NAAC AL+DAG+P
Sbjct  71   GVLERSREQMVRRACEAALLGELHPRSSVTLVLQVVSDAGSLLSCCLNAACLALLDAGLP  130

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQ  594
            L+ L   + C LA    V LDP   +E+
Sbjct  131  LRSLFCGVTCALAPDGAVALDPSARQEK  158



>ref|XP_005361238.1| PREDICTED: exosome complex component RRP46 [Microtus ochrogaster]
Length=235

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGGLHPRTSITVVLQVVSDTGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVSCALDSDGNLVLDPTTKQEKEARAILTFAL  185



>ref|XP_004620765.1| PREDICTED: exosome complex component RRP46 [Sorex araneus]
Length=233

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  26   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  85

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NA C ALVDAG+P
Sbjct  86   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNATCMALVDAGVP  145

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +EQ+ +A +    
Sbjct  146  MRALFCGVTCALKSDGTLVLDPTARQEQEARAVLTFAL  183



>ref|XP_004388800.1| PREDICTED: exosome complex component RRP46 [Trichechus manatus 
latirostris]
Length=235

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVLLRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGNLVLDPTLKQEKEARAVLTFAL  185



>ref|XP_008853228.1| PREDICTED: exosome complex component RRP46 isoform X1 [Nannospalax 
galili]
Length=235

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSQERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E+K +A +    
Sbjct  148  MRALFCGVTCALDSDGNLLLDPTAKQEKKARAVLTFAL  185



>ref|XP_008056990.1| PREDICTED: exosome complex component RRP46 [Tarsius syrichta]
Length=240

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR LAC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  33   LRHLACEQNLLSRPDGSASFMQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  92

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  93   GVAEKSRERLIRNTCEAVVLGVLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  152

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  153  MQALFCGVTCALDSDGTLVLDPTVKQEKEARAVLTFAL  190



>ref|XP_005336521.1| PREDICTED: exosome complex component RRP46 [Ictidomys tridecemlineatus]
Length=235

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  185



>gb|AAI67023.1| Exosc5 protein [Rattus norvegicus]
Length=233

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  26   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  85

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  86   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDTGSLLACCLNAACMALVDAGVP  145

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            ++ L   + C L     +VLDP   +E++ +A +     ++
Sbjct  146  MRALFCGVTCALDPDGNLVLDPTTKQEKEARAILTFALDSA  186



>ref|XP_001868566.1| exosome complex exonuclease RRP46 [Culex quinquefasciatus]
 gb|EDS27152.1| exosome complex exonuclease RRP46 [Culex quinquefasciatus]
Length=217

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 113/217 (52%), Gaps = 17/217 (8%)
 Frame = +1

Query  145  NQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTG  324
            + LRP+ C   +L R+ GSA  +QGET V A+V GP     ++ N EK+ +E+ ++P++G
Sbjct  8    DSLRPMFCELNILTRSDGSAMLTQGETAVTASVNGPVEVKLQHMNVEKSYVEIHFRPRSG  67

Query  325  QIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAG  504
                 ++  E +++ T +S  L  +HP T  S+ IQ + D G L+ CAINA C AL+D+G
Sbjct  68   MGSVNDRLLENLIRNTYESALLTALHPRTAVSIQIQEMQDRGGLVACAINAVCLALIDSG  127

Query  505  IPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPM  684
            I +K+L  A+   L E   + LDPD+L  +  +A    VF N+                 
Sbjct  128  IEMKYLVAAVHSVLDEEGGITLDPDELRAKDARARFTFVFENTSR---------------  172

Query  685  ECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                ++  THGK   + Y   L  +  A  ++ ++ R
Sbjct  173  --NTVSIYTHGKFTSEQYHRALRMSTDAVGRVFDFYR  207



>ref|NP_001100963.2| exosome complex component RRP46 [Rattus norvegicus]
 ref|XP_006228499.1| PREDICTED: exosome complex component RRP46 isoform X1 [Rattus 
norvegicus]
Length=235

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDTGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            ++ L   + C L     +VLDP   +E++ +A +     ++
Sbjct  148  MRALFCGVTCALDPDGNLVLDPTTKQEKEARAILTFALDSA  188



>ref|XP_006910753.1| PREDICTED: exosome complex component RRP46 [Pteropus alecto]
 gb|ELK13728.1| Exosome complex exonuclease RRP46 [Pteropus alecto]
Length=231

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T +LA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSILAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++++A +    
Sbjct  144  MRALFCGVTCALDSDGTLVLDPTAKQEKEVRAVLTFAL  181



>ref|NP_001038817.2| exosome complex component RRP46 [Danio rerio]
Length=230

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 128/233 (55%), Gaps = 17/233 (7%)
 Frame = +1

Query  106  LVMEIDRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPE  285
            L M  +    R+   LR     + +L+R  GS+++ QG+T +LA VYGP       E  +
Sbjct  7    LCMRTEMELERSCPVLREYGSEQSLLSRPDGSSTFVQGDTSILAGVYGPAEVKVSKEIYD  66

Query  286  KACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPC  465
            +A +EV+ +PK G    +E+  E  V+ T ++  LLT+HP ++ +VI+QVV+DDG+LL C
Sbjct  67   RATVEVLIQPKMGLPSVRERAREQCVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSC  126

Query  466  AINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLA  645
             +NAAC AL+DAG+P+  L  ++ C +++   ++ DP   +E++ +A +     ++    
Sbjct  127  CLNAACMALMDAGLPMSRLFCSVTCAISKEGQIITDPTARQEKESRALLTFAIDSN----  182

Query  646  LPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                         E  ++ S T G   V +   C+  ++ ASE++ ++ R S+
Sbjct  183  -------------ERNVLMSSTTGSFSVQELQQCIAISQKASEQIFQFYRDSV  222



>ref|XP_007086646.1| PREDICTED: exosome complex component RRP46 [Panthera tigris altaica]
Length=235

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDAEGTLVLDPTAKQEKEARAILTFAL  185



>ref|XP_006988101.1| PREDICTED: exosome complex component RRP46 [Peromyscus maniculatus 
bairdii]
Length=254

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  47   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  106

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  107  GVAEKSREQLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  166

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  167  MRALFCGVSCALDSDGNLVLDPTTKQEKEARAILTFAL  204



>ref|XP_004884092.1| PREDICTED: exosome complex component RRP46 [Heterocephalus glaber]
Length=235

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 118/218 (54%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSA++ QG+T +LA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSAAFLQGDTSILAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+ 
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVS  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   I C L     +VLDP   +E++ +A +                     + ++ 
Sbjct  148  MRALFCGITCALDSDGTLVLDPTAKQEKEARAVLTFAL-----------------DSVDR  190

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G     +   CL  A+ AS+ +  + R SL
Sbjct  191  KLLMSTTKGLYSDAELQQCLAAAQTASQHVFRFYRESL  228



>ref|XP_001500390.2| PREDICTED: exosome complex component RRP46 [Equus caballus]
Length=263

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  56   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  115

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  116  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  175

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  176  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL  213



>ref|XP_008535841.1| PREDICTED: exosome complex component RRP46 [Equus przewalskii]
Length=263

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  56   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  115

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  116  GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  175

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  176  MRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL  213



>ref|XP_004598054.1| PREDICTED: exosome complex component RRP46 [Ochotona princeps]
Length=235

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 98/160 (61%), Gaps = 0/160 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFVCEQSLLSRPDGSASFQQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSREQLIRSTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
            ++ L   + C L     +VLDP   +E++ +A +     +
Sbjct  148  MRALFCGVTCALDSDGTLVLDPTVKQEKEARAVLTFALDS  187



>ref|XP_003270380.1| PREDICTED: exosome complex component RRP46 isoform 1 [Nomascus 
leucogenys]
 ref|XP_004091049.1| PREDICTED: exosome complex component RRP46 isoform 2 [Nomascus 
leucogenys]
Length=235

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK    
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIRLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGTLVLDPTSKQEKEARAVLTFAL  185



>ref|XP_004396380.1| PREDICTED: exosome complex component RRP46 [Odobenus rosmarus 
divergens]
Length=239

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  31   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  90

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV++ G+LL C +NA+C ALVDAG+
Sbjct  91   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSNAGSLLACCLNASCMALVDAGV  150

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  151  PMRALFCGVTCALNSDGTLVLDPTAKQEKEARAVLTFAL  189



>ref|XP_011381936.1| PREDICTED: exosome complex component RRP46 [Pteropus vampyrus]
Length=231

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T +LA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSILAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  181



>ref|XP_005589410.1| PREDICTED: exosome complex component RRP46 isoform X2 [Macaca 
fascicularis]
Length=209

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  52   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  111

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  112  PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  171

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQ  594
            P++ L   + C L     +VLDP   +E+
Sbjct  172  PMRALFCGVTCALDSDGTLVLDPTSKQEK  200



>ref|XP_002161086.1| PREDICTED: exosome complex component RRP46-like [Hydra vulgaris]
Length=221

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 116/219 (53%), Gaps = 17/219 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            +R + C+   L +  GS + S G+TKV++AVYGP       E  +KA I  I KPK G  
Sbjct  1    MREMECNLAYLEKPDGSVTLSHGQTKVISAVYGPVEVKMNKEITDKATIICILKPKIGMS  60

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              +EK  E IV +T +   + ++HP +   V++Q+V+D G+LL C INAAC +LV AG+P
Sbjct  61   AVKEKVMEKIVAKTCEQAIIASLHPRSAIQVVLQIVHDSGSLLSCLINAACLSLVHAGLP  120

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++++ V++CC +  +   ++DP   E Q  K  +   F                 E    
Sbjct  121  MRNMIVSVCCAVTNNDEYLVDPTIAEIQDCKCVLTFAF-----------------ESKNL  163

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSLI  807
             I++  T G   V+ Y  CL  A+A++  +  + R+S++
Sbjct  164  DIVSIFTSGLFTVEQYFQCLQLAKASAPDILNFQRQSVV  202



>gb|AAI22388.1| Exosome component 5 [Danio rerio]
 gb|AAI64315.1| Exosc5 protein [Danio rerio]
Length=218

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 124/223 (56%), Gaps = 17/223 (8%)
 Frame = +1

Query  136  RTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKP  315
            R+   LR     + +L+R  GS+++ QG+T +LA VYGP       E  ++A +EV+ +P
Sbjct  5    RSCPVLREYGSEQSLLSRPDGSSTFVQGDTSILAGVYGPAEVKVSKEIYDRATVEVLIQP  64

Query  316  KTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALV  495
            K G    +E+  E  V+ T ++  LLT+HP ++ +VI+QVV+DDG+LL C +NAAC AL+
Sbjct  65   KMGLPSVRERAREQCVRETCEAALLLTLHPRSSLTVILQVVHDDGSLLSCCLNAACMALM  124

Query  496  DAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGG  675
            DAG+P+  L  ++ C +++   ++ DP   +E+  +A +     ++              
Sbjct  125  DAGLPMSRLFCSVTCAISKEGQIITDPTARQEKVSRALLTFAIDSN--------------  170

Query  676  EPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
               E  ++ S T G   V +   C+  ++ ASE++ ++ R S+
Sbjct  171  ---ERNVLMSSTTGSFSVQELQQCIAISQKASEQIFQFYRDSV  210



>ref|XP_011598192.1| PREDICTED: exosome complex component RRP46, partial [Aquila chrysaetos 
canadensis]
Length=198

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 101/161 (63%), Gaps = 0/161 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP +C +G+L+R  GSA++ QG+T VL  +YGP       E P++A +EV+ +PK G  
Sbjct  21   LRPFSCEQGLLSRPDGSAAFLQGDTSVLVGLYGPAEVKVSKELPDRASLEVLLRPKVGLP  80

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  E+  E +++RT +++ L  +HP T  ++++QV++D G+LL C +NA C  ++DAG+P
Sbjct  81   GVIERSREQLLRRTCEAVVLGVLHPRTAITLVLQVLSDAGSLLSCCLNAVCMGMLDAGLP  140

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            L  L   + C +  +  ++LDP   +EQ+ +A +     ++
Sbjct  141  LSSLFCGVSCAIDPNGVIILDPTTQQEQEARAILTFAIDST  181



>ref|XP_003420841.1| PREDICTED: exosome complex component RRP46 [Loxodonta africana]
Length=235

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 0/152 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVLLRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKA  606
            ++ L   + C L     +VLDP   +E++ +A
Sbjct  148  MRALFCGVTCALDADGNLVLDPTVKQEKEARA  179



>gb|AAI67726.1| LOC100170617 protein [Xenopus (Silurana) tropicalis]
Length=226

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 116/215 (54%), Gaps = 17/215 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSA++ QG+T V+A VYGP       E   KA +EVI +PKTG  
Sbjct  19   LREYGCEQSLLSRPDGSATFLQGDTSVMAGVYGPAEIKVSREIHNKATLEVILRPKTGLP  78

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              QEK  E +++ T +S+ + ++HP T+ ++++Q+V+D G+LL C +NAAC  L+DAG+P
Sbjct  79   AIQEKNQEQLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLP  138

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C +     + LDP+  ++++ +A +                     E  E 
Sbjct  139  MRALFCGVTCAMDNDGTITLDPNFRQQKESRAVLTFAI-----------------ESTER  181

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
             ++     G     +   C+  A+ ASEKL ++ R
Sbjct  182  KVLMMSNRGVYSATELQQCIAAAQIASEKLFQFYR  216



>ref|XP_004694201.1| PREDICTED: exosome complex component RRP46 [Condylura cristata]
Length=235

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGNLMLDPTTKQEKEARAVLTFAL  185



>ref|XP_004710406.1| PREDICTED: exosome complex component RRP46 [Echinops telfairi]
Length=231

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV+ +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVLLRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MRALFCGVTCALDSDGNLVLDPTLKQEKEARAVLTFAL  181



>ref|XP_004441635.1| PREDICTED: exosome complex component RRP46 [Ceratotherium simum 
simum]
Length=231

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++Q+++D G+LL C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQIISDAGSLLACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MRALFCGVTCALYSDGTLVLDPTAKQEKEAQAVLTFAL  181



>ref|XP_005810607.1| PREDICTED: exosome complex component RRP46-like [Xiphophorus 
maculatus]
Length=219

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+  PK G  
Sbjct  11   LREFGCEQTLLSRPDGSASFVQGDTSVMAGVYGPAEVKISKEIYDRATLEVLVHPKVGLP  70

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G +E+  E  V+ T ++  LL++HP ++ ++++QV++DDGALL C +NAAC AL+DAG+ 
Sbjct  71   GVRERSQEQCVRETCEASLLLSLHPRSSLTLVLQVLHDDGALLSCCLNAACMALMDAGLS  130

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            +  L   + C ++    ++ DP   +E++ +A +     +                  E 
Sbjct  131  MSCLFCGVTCAISADGEIITDPTAAQEKESRALMTFAIDSK-----------------ER  173

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  174  RVMMSSTKGSFSVHELQQCVAASQKASEKIFQFYRDSV  211



>ref|XP_005890679.1| PREDICTED: exosome complex component RRP46 [Bos mutus]
 tpg|DAA19840.1| TPA: exosome component 5-like [Bos taurus]
Length=242

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 119/225 (53%), Gaps = 24/225 (11%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PKTG  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKISKEIFNKATLEVILRPKTGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGA-------LLPCAINAACAA  489
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+       LL C +NAAC A
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSKLNHCLWLLACCLNAACMA  147

Query  490  LVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQA  669
            LVDAG+P++ L   + C L     ++LDP   +E++ +A +                   
Sbjct  148  LVDAGVPMRALFCGVTCALDSDGTLMLDPTAKQEKEARAVLTFAL---------------  192

Query  670  GGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
              + +E  ++ S T G     +   CL  A+ AS  +  + R SL
Sbjct  193  --DSVERKLLMSTTKGLYSDTELQQCLAAAQTASTHVFRFYRESL  235



>ref|XP_004479958.1| PREDICTED: exosome complex component RRP46 [Dasypus novemcinctus]
Length=231

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 0/153 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T +LA VYGP       E   KA ++V+ +PK G 
Sbjct  23   SLRHFACEQNLLSRPDGSASFLQGDTSILAGVYGPAEVKVSREIFNKATLDVVLRPKIGL  82

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  83   PGVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  142

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKA  606
            P++ L   I C L     +VLDP   +E++ +A
Sbjct  143  PMRALFCGITCALDSDGSLVLDPTAKKEKEARA  175



>ref|XP_002939437.2| PREDICTED: exosome complex component RRP46, partial [Xenopus 
(Silurana) tropicalis]
Length=239

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 116/215 (54%), Gaps = 17/215 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSA++ QG+T V+A VYGP       E   KA +EVI +PKTG  
Sbjct  32   LREYGCEQSLLSRPDGSATFLQGDTSVMAGVYGPAEIKVSREIHNKATLEVILRPKTGLP  91

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              QEK  E +++ T +S+ + ++HP T+ ++++Q+V+D G+LL C +NAAC  L+DAG+P
Sbjct  92   AIQEKNQEQLIRETCESVIIGSLHPRTSITIVLQIVSDAGSLLSCCLNAACMGLMDAGLP  151

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            ++ L   + C +     + LDP+  ++++ +A +                     E  E 
Sbjct  152  MRALFCGVTCAMDNDGTITLDPNFRQQKESRAVLTFAI-----------------ESTER  194

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
             ++     G     +   C+  A+ ASEKL ++ R
Sbjct  195  KVLMMSNRGVYSATELQQCIAAAQIASEKLFQFYR  229



>ref|XP_006102702.1| PREDICTED: exosome complex component RRP46 [Myotis lucifugus]
Length=231

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 98/158 (62%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ ++++QV++D G+L+ C +NAAC ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITIVLQVISDAGSLMACCLNAACMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MQALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  181



>ref|XP_007552430.1| PREDICTED: exosome complex component RRP46 [Poecilia formosa]
Length=259

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+  PK G  
Sbjct  51   LREFGCEQTLLSRPDGSASFVQGDTSVMAGVYGPAEVKISKEIYDRATLEVLVHPKVGLP  110

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G +E+  E  V+ T ++  LL++HP ++ ++I+QV++DDGALL C +NAAC AL+DAG+ 
Sbjct  111  GVRERSQEQCVRETCEASLLLSLHPRSSLTLILQVLHDDGALLSCCLNAACMALMDAGLS  170

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            +  L   + C ++    ++ DP   +E++ +A +     +                  E 
Sbjct  171  MSCLFCGVTCAISADGEIITDPTAAQEKESRALMTFAIDSK-----------------ER  213

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  214  RVMMSSTKGSFSVHELQQCVAVSQKASEKIFQFYRDSV  251



>ref|XP_007458677.1| PREDICTED: exosome complex component RRP46 [Lipotes vexillifer]
Length=235

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV  +PK G  
Sbjct  28   LRNFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVTLRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGTLLLDPTAKQEKEARAVLTFAL  185



>ref|XP_008424727.1| PREDICTED: LOW QUALITY PROTEIN: exosome complex component RRP46 
[Poecilia reticulata]
Length=260

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 119/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GSAS+ QG+T V+A VYGP       E  ++A +EV+  PK G  
Sbjct  52   LREFGCEQTLLSRPDGSASFVQGDTSVMAGVYGPAEVKISKEIYDRATLEVLVHPKVGLP  111

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G +E+  E  V+ T ++  LL++HP ++ ++I+QV++DDGALL C +NAAC AL+DAG+ 
Sbjct  112  GVRERSQEQCVRETCEASLLLSLHPRSSLTLILQVLHDDGALLSCCLNAACMALMDAGLS  171

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            +  L   + C ++    ++ DP   +E++ +A +                        E 
Sbjct  172  MSCLFCGVTCAISADGEIITDPTAAQEKESRALMSFAIDGK-----------------ER  214

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  215  RVMMSSTKGSFSVHELQQCVAVSQKASEKIFQFYRDSV  252



>ref|XP_004271294.1| PREDICTED: exosome complex component RRP46 [Orcinus orca]
 ref|XP_004322523.1| PREDICTED: exosome complex component RRP46 [Tursiops truncatus]
Length=235

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV  +PK G  
Sbjct  28   LRNFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVTLRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGTLLLDPTAKQEKEARAVLTFAL  185



>ref|XP_007168080.1| PREDICTED: exosome complex component RRP46 [Balaenoptera acutorostrata 
scammoni]
Length=235

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV  +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVTLRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGTLLLDPTAKQEKEARAVLTFAL  185



>ref|XP_007128181.1| PREDICTED: exosome complex component RRP46 isoform X2 [Physeter 
catodon]
Length=235

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EV  +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVTLRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     ++LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSDGNLLLDPTAKQEKEARAVLTFAL  185



>ref|XP_010329358.1| PREDICTED: exosome complex component RRP46 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=213

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 0/149 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  28   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  87

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T ++  L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  88   PGVAEKSRERLIRNTCEAAVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACIALVDAGV  147

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQ  594
            P++ L   + C L     +VLDP   +E+
Sbjct  148  PMRALFCGVTCALDSDGSLVLDPTSKQEK  176



>ref|XP_008581518.1| PREDICTED: exosome complex component RRP46 [Galeopterus variegatus]
Length=258

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  51   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  110

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ +V++QV++D G+LL C +NAAC ALVD G+P
Sbjct  111  GVAEKSRERLIRNTCEAVVLGALHPRTSITVVLQVISDAGSLLACCLNAACMALVDTGVP  170

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  171  MRALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  208



>ref|XP_007536651.1| PREDICTED: exosome complex component RRP46 [Erinaceus europaeus]
Length=235

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  28   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  87

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ ++++QVV+D G+LL C +NAAC ALVDAG+P
Sbjct  88   GVAEKSRERLIRNTCEAVVLGALHPRTSITMVLQVVSDAGSLLACCLNAACMALVDAGLP  147

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     + LDP   +E++ +A +    
Sbjct  148  MRALFCGVTCALDSEGTLTLDPTAKQEKEARAVLTFAL  185



>ref|XP_008137779.1| PREDICTED: exosome complex component RRP46 [Eptesicus fuscus]
Length=231

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKVGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ ++++QV++D G+L+ C +NA C ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITIVLQVISDAGSLMACCLNATCMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MQALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  181



>ref|XP_008295409.1| PREDICTED: LOW QUALITY PROTEIN: exosome complex component RRP46 
[Stegastes partitus]
Length=235

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 120/218 (55%), Gaps = 17/218 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR   C + +L+R  GS+S+ QG+T V+A VYGP       E  ++A +EV+ +PK G  
Sbjct  27   LREFGCEQSLLSRPDGSSSFVQGDTSVMAGVYGPAEVKVSKEIYDRATLEVLVQPKVGLP  86

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
              +E+  E  V+ T ++  LL++HP +  ++++QV++DDG+LL C +NAAC AL+DAG+P
Sbjct  87   SVRERSQEQCVRETCEASLLLSLHPRSALTLVLQVLHDDGSLLSCCLNAACMALMDAGLP  146

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMEC  690
            +  L   + C +     ++ DP   +E++ +A +     ++                 E 
Sbjct  147  MSCLFCGVTCAINTEGEIITDPTAAQEKESRALMTFAIDST-----------------ER  189

Query  691  GIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             ++ S T G   V +   C+  ++ ASEK+ ++ R S+
Sbjct  190  RVMMSSTKGSFSVHELQQCIAVSQEASEKIFQFYRDSV  227



>ref|XP_005868826.1| PREDICTED: exosome complex component RRP46 [Myotis brandtii]
 gb|EPQ09294.1| Exosome complex component RRP46 [Myotis brandtii]
Length=231

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 97/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ ++++QV++D G+L+ C +NA C ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITIVLQVISDAGSLMACCLNATCMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E++ +A +    
Sbjct  144  MQALFCGVTCALDSDGTLVLDPTAKQEKEARAVLTFAL  181



>ref|XP_006750387.1| PREDICTED: transforming growth factor beta-1-like [Leptonychotes 
weddellii]
Length=390

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 0/159 (0%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
             LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G 
Sbjct  27   SLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGL  86

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
             G  EK  E +++ T +++ L T+HP T+ +V++QVV+D G+LL C +NAAC ALVDAG+
Sbjct  87   PGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGV  146

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            P++ L   + C L     +VLDP   +E++ +A +    
Sbjct  147  PMRALFCGVTCALNSDGTLVLDPTAKQEKEARAILTFAL  185



>ref|XP_006771927.1| PREDICTED: exosome complex component RRP46 [Myotis davidii]
Length=231

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 96/158 (61%), Gaps = 0/158 (0%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LR  AC + +L+R  GSAS+ QG+T VLA VYGP       E   KA +EVI +PK G  
Sbjct  24   LRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLP  83

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
            G  EK  E +++ T +++ L  +HP T+ ++++QV++D G+L+ C +NA C ALVDAG+P
Sbjct  84   GVAEKSRERLIRNTCEAVVLGALHPRTSITIVLQVISDAGSLMACCLNATCMALVDAGVP  143

Query  511  LKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVF  624
            ++ L   + C L     +VLDP   +E+  +A +    
Sbjct  144  MQALFCGVTCALDSDGTLVLDPTAKQEKDARAVLTFAL  181



>gb|ABO26648.1| exosome component 5 [Haliotis discus discus]
Length=211

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 117/217 (54%), Gaps = 17/217 (8%)
 Frame = +1

Query  145  NQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTG  324
              LRP+    GVL R  G+ +++QG+T +LAAVYGP       E  ++A +EVI+KPK+G
Sbjct  2    TDLRPMTSDLGVLTRPDGTVTFTQGDTGILAAVYGPGEVKIAREILDRATVEVIYKPKSG  61

Query  325  QIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAG  504
              G  E+  E  ++ T++++ L ++HP +  SV +Q + D G+LL C++NAAC AL+DA 
Sbjct  62   LPGCSERLHERYIRNTVETVILASLHPRSCISVTVQELQDSGSLLACSVNAACLALLDAC  121

Query  505  IPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPM  684
            + +K+L   +   +      VL PD  +E +  A V  V  N  +               
Sbjct  122  VNMKYLIAGVYVIIDREGNTVLVPDLKQEGEKVAGVTFVLENQTY---------------  166

Query  685  ECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
               ++T  + G L  + +  CL  A+AA++++  + R
Sbjct  167  --SVVTMSSRGSLTTEQFHRCLLHAQAAAKQIFSFYR  201



>ref|XP_003222900.2| PREDICTED: exosome complex component RRP46 [Anolis carolinensis]
Length=237

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 124/236 (53%), Gaps = 19/236 (8%)
 Frame = +1

Query  100  YLLVMEIDRR--DGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKN  273
            ++  ME +++  D      LR + C +G+L+R  GSASW QG+T VLA VYGP       
Sbjct  11   WIGAMETEQKKCDSGDLPSLRRIVCEQGLLSRPDGSASWMQGDTSVLAGVYGPSEVKVSK  70

Query  274  ENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGA  453
            E  +KA +EV+ +PK G  G  E+  E ++K+T +++ L T+HP ++ ++++QV+ D G+
Sbjct  71   EIYDKATLEVMLRPKVGLPGVYERSREQMIKKTCEAVVLGTLHPRSSITIVLQVITDAGS  130

Query  454  LLPCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNS  633
            LL   +NAAC  L+DAG+P+  L   + C L       LDP   +E++ +  +       
Sbjct  131  LLASCLNAACMGLMDAGLPMGSLFCGVTCALDADGNFTLDPTAKQEKEAQTVLTFAI---  187

Query  634  PHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRS  801
                          + +E  ++ S   G   V+    C+  ++ A++ + ++ R S
Sbjct  188  --------------DSIEKKVLMSSMKGTCSVEQLQQCVAASQRAADTIFQFYRDS  229



>gb|EPB89162.1| hypothetical protein HMPREF1544_04029 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=231

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 121/227 (53%), Gaps = 17/227 (7%)
 Frame = +1

Query  121  DRRDGRTAN-QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACI  297
            +R D RT N QLR  + S+ +LNRA GS+ +  G T V+ +V GP     ++E  ++A +
Sbjct  3    NRPDRRTDNTQLRAFSASQNILNRADGSSKFEFGSTSVICSVSGPMDVQIRDEKLDEATV  62

Query  298  EVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINA  477
            EV+ +P  G    +EK  E I++   + + L  + P T   ++IQ+  DDGA+L  ++NA
Sbjct  63   EVVVRPAKGVATTREKLMESILRTAFEPVILGGMLPRTLVQIVIQITKDDGAILAASVNA  122

Query  478  ACAALVDAGIPLKHLAVAICCCL-AESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPK  654
               AL+DAGIP+KH+A AI   + +++  +VLDP  +E +  K+     F N        
Sbjct  123  ITLALLDAGIPMKHMAAAITAMIDSKTNELVLDPTAVELENAKSVHTFAFDN--------  174

Query  655  ESLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                   +PM   ++ S + G    D+Y  C +    A EK+  +LR
Sbjct  175  ----VNTKPM---VLLSDSEGLFSEDEYFSCHDLCFEAVEKVQGFLR  214



>ref|XP_008650209.1| PREDICTED: exosome complex exonuclease RRP46 homolog [Zea mays]
Length=140

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 79/133 (59%), Gaps = 28/133 (21%)
 Frame = +1

Query  121  DRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
             R DG+  NQLR   C+  +L+RAHG A W+QG   VLA VYGPK GT +   PEKA IE
Sbjct  5    SRADGQNPNQLRLFTCTGNLLHRAHGCARWAQGGIVVLATVYGPKPGTVRGRTPEKASIE  64

Query  301  VIWKPKTGQI----------------------------GKQEKECEMIVKRTLQSICLLT  396
             +WKP+TGQI                            G+Q++E EM +KRTLQSICLLT
Sbjct  65   AVWKPRTGQIDTPLFPSSSFCPTAVRVTGSLKWRVVFVGRQDREYEMTLKRTLQSICLLT  124

Query  397  VHPNTTTSVIIQV  435
            VH N TTSV++QV
Sbjct  125  VHANATTSVVLQV  137



>ref|XP_002679009.1| predicted protein [Naegleria gruberi]
 gb|EFC46265.1| predicted protein [Naegleria gruberi]
Length=280

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 137/258 (53%), Gaps = 35/258 (14%)
 Frame = +1

Query  115  EIDRRDGR-TANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKA  291
            +I RRD R T+NQLR +    GVL +A GS  +SQG T V+ +V GP++  K  E  ++A
Sbjct  4    QILRRDQRKTSNQLRDMQVELGVLGKADGSVKFSQGNTTVICSVCGPESSMK--EKGDQA  61

Query  292  CIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAI  471
             I+V+++P+  +  ++EKE E+I+++TL+++ L  ++P T  ++ IQVV  DG LL  ++
Sbjct  62   IIDVMFQPRDKKASEEEKEYELIIRQTLENVILTNIYPRTVITISIQVVQYDGCLLSASL  121

Query  472  NAACAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKM-----------------  600
            NAA  AL+DAG+ +K   V+  C    S   +LDP ++E+                    
Sbjct  122  NAASLALLDAGVAMKTTLVSSSCSYLNSGDCLLDPTRIEQDFSSILHNDDSSSYIQYYKT  181

Query  601  ----------KAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCL  750
                      K F + VF ++P L  P ++        +  ++TS+T G L  +    C+
Sbjct  182  SSKGPKVIVPKGFAFFVFDSAP-LRNPSKT----DSDDDSFLVTSITEGLLTDEALRECI  236

Query  751  NRARAASEKLSEYLRRSL  804
            + A+  +  +   +R +L
Sbjct  237  SLAKEGALSVYSLIRLTL  254



>emb|CEG76184.1| hypothetical protein RMATCC62417_11114 [Rhizopus microsporus]
Length=226

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 121/228 (53%), Gaps = 16/228 (7%)
 Frame = +1

Query  124  RRDGRTAN-QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
            R D RT N QLR  + ++ VL+RA GSA +  G T V+ +V GP     ++E  ++A +E
Sbjct  3    RPDRRTENTQLRAFSATQNVLHRADGSARFDLGATSVICSVSGPMEVQLRDEKLDEATVE  62

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V+ +P +G    +EK  E  ++ T + I L  + P T   +++Q++ DDG+++  A+N  
Sbjct  63   VVVRPSSGIASTKEKLIENTLRTTFEPIILGGMMPRTLVQIVVQIIKDDGSVIAAAVNTI  122

Query  481  CAALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKES  660
              AL+DAGIPLK++A ++ C + ++  ++LDP   E +  K+     F N+P        
Sbjct  123  ALALLDAGIPLKYMAASVTCMIDKTNNIILDPTAAELENAKSVHTFAFDNTPRT------  176

Query  661  LQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                       ++ S + G    ++Y+ C +    A  ++  ++R ++
Sbjct  177  ---------TTVLLSDSSGVFSEEEYIECYDLCHQAVGQVHSFIRTAV  215



>ref|XP_007442684.1| PREDICTED: exosome complex component RRP46 [Python bivittatus]
Length=223

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 112/224 (50%), Gaps = 17/224 (8%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R D      LR + C +G L+R  GS SW QG+T VLA VYGP       E  +KA +EV
Sbjct  7    RFDSGDLPALRRIVCEQGPLSRPDGSVSWMQGDTSVLAGVYGPTEVKVSKEIYDKATLEV  66

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            + +PK G  G  EK  E ++K+T +++ L  +HP ++ +V++QV+ D G+LL   +NA C
Sbjct  67   LLRPKVGLPGVYEKSREQMIKKTCEAVILGNLHPRSSITVVLQVITDAGSLLSSCLNATC  126

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
              LVDAG+P+  L   + C L     ++LDP   +E+   A +                 
Sbjct  127  MGLVDAGLPMSSLFCGVTCALDADGNILLDPTMKQEKDAPAVLTFAI-------------  173

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                + +E  I+ S   G    +    C+  A+ A+E +  + R
Sbjct  174  ----DSIEKKILLSNLKGACSEEQLQQCIATAQRAAETIFRFYR  213



>ref|XP_005774369.1| hypothetical protein EMIHUDRAFT_240695 [Emiliania huxleyi CCMP1516]
 gb|EOD21940.1| hypothetical protein EMIHUDRAFT_240695 [Emiliania huxleyi CCMP1516]
Length=208

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 95/151 (63%), Gaps = 0/151 (0%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DGR  NQLR +A   G L+RA GSA +    T+VLAAV+GP    +  E P++A +EV
Sbjct  4    RADGRLPNQLRAMAAEPGALSRADGSARFQHDGTQVLAAVWGPGEVRRARERPDQATLEV  63

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            + +P +G  G  E+E E+++  TL    +L++HP T  S+++QVV+ DG++L  A++A  
Sbjct  64   LVRPASGLAGPLEREMELLLTATLSHAVVLSLHPRTLVSLVVQVVDHDGSVLAAALHACG  123

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDP  576
             AL+ AG+PL+ +     C +A    ++LDP
Sbjct  124  LALIHAGVPLRGMLGTCACAVAADGALLLDP  154



>ref|XP_001692824.1| exosome complex exonuclease [Chlamydomonas reinhardtii]
 gb|EDP03843.1| exosome complex exonuclease [Chlamydomonas reinhardtii]
Length=242

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 102/159 (64%), Gaps = 0/159 (0%)
 Frame = +1

Query  154  RPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIG  333
            R L C R VL+RA GSA W+Q  + VLAAVYGP+    + E+ E+A +EV++KP+ G  G
Sbjct  3    RTLVCERAVLDRADGSAKWTQEGSSVLAAVYGPRQAKLQKEDAERAVVEVVFKPRAGLQG  62

Query  334  KQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPL  513
             +++  E+ ++  L+ +  L + P T+  V++QV+ DDG  L CA+NAA AALVDAG+PL
Sbjct  63   HEDRSLELEIRGILEGVIPLGMFPRTSVMVVLQVLQDDGGALSCALNAAAAALVDAGVPL  122

Query  514  KHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPN  630
              +  ++ C L   + +VLDPD LEEQ   A     +P+
Sbjct  123  NSMFSSVSCVLTSDRRLVLDPDALEEQAAAARFCFTYPH  161



>gb|KFH68948.1| hypothetical protein MVEG_05750 [Mortierella verticillata NRRL 
6337]
Length=242

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 121/227 (53%), Gaps = 3/227 (1%)
 Frame = +1

Query  127  RDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVI  306
            R   + +QLRP   S+ +LNRA GSA +  G + VL +V GP     ++E  +KA +EV+
Sbjct  6    RTRTSPHQLRPFFSSQNLLNRADGSAQFDFGGSSVLCSVVGPAEVKIRDEQLDKATVEVV  65

Query  307  WKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACA  486
             +P  G    ++K  E  ++ TL+ I L  +HP T   +++Q + DDG +L  A NA   
Sbjct  66   ARPLVGLPSVKDKAREQNIRETLEPILLSGLHPRTLIQIVVQTMKDDGCILSTAFNATIL  125

Query  487  ALVDAGIPLKHLAVAICCCL-AESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
            AL+DAGIPLK +  ++ C + A S  ++LDP   E  + K+    VF N   +A  ++ +
Sbjct  126  ALLDAGIPLKSILGSVTCIIDANSNEILLDPTTEELAQAKSTHVFVFDNKSSIANSEDVM  185

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
                E +   ++ S + G    ++Y  C      A++ +  ++R ++
Sbjct  186  DQ--EELLANVLFSDSTGSFSEEEYFECSRVCFKAAQAVHGFIRTAV  230



>ref|XP_010901343.1| PREDICTED: exosome complex component RRP46 [Esox lucius]
Length=219

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 119/224 (53%), Gaps = 17/224 (8%)
 Frame = +1

Query  133  GRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWK  312
            G +   LR     + +L+R  GS+S+ QG+T VLA VYGP       E  ++A +EV+ +
Sbjct  5    GSSNPTLREFGSEQNLLSRPDGSSSFVQGDTSVLAGVYGPAEVKVSKEIYDRATLEVVIQ  64

Query  313  PKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAAL  492
             K G    +E+  E  V+ T ++  L T++P ++ ++I+QVV+DDG+LL C +NAAC AL
Sbjct  65   TKVGLPSVKERAREQCVRETCEAALLSTLNPRSSLTLILQVVHDDGSLLACFLNAACMAL  124

Query  493  VDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            +DAG+P+  L   + C +     ++ DP  ++E++ +A +                    
Sbjct  125  MDAGLPMSCLFAGVTCAIDGDGRIITDPSAVQEKESRALMTFAI----------------  168

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             +  E  ++ S T G   V +   C+  ++ AS+ + E+ R S+
Sbjct  169  -DSKERRVMMSSTKGSFTVHELHQCVAISQKASDNIFEFYRESV  211



>gb|AFW74802.1| hypothetical protein ZEAMMB73_831356 [Zea mays]
Length=421

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 78/132 (59%), Gaps = 28/132 (21%)
 Frame = +1

Query  121  DRRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
             R DG+  NQLR   C+  +L+RAHG A W+QG   VLA VYGPK GT +   PEKA IE
Sbjct  6    SRADGQNPNQLRLFTCTGNLLHRAHGCARWAQGGIVVLATVYGPKPGTVRGRTPEKASIE  65

Query  301  VIWKPKTGQI----------------------------GKQEKECEMIVKRTLQSICLLT  396
             +WKP+TGQI                            G+Q++E EM +KRTLQSICLLT
Sbjct  66   AVWKPRTGQIDTPLFPSSSFCPTAVRVTGSLKWRVVFVGRQDREYEMTLKRTLQSICLLT  125

Query  397  VHPNTTTSVIIQ  432
            VH N TTSV++Q
Sbjct  126  VHANATTSVVLQ  137



>gb|ESA19320.1| hypothetical protein GLOINDRAFT_344174 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX66254.1| Rrp46p [Rhizophagus irregularis DAOM 197198w]
Length=224

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 122/231 (53%), Gaps = 22/231 (10%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R D R+++ +RP+  +  +L+R  GSAS+S G+++VL  V GP     ++E  +KA I+V
Sbjct  4    RADKRSSSTIRPILITPCLLSR-DGSASFSFGKSRVLCTVNGPAEVKLRDEKLDKATIDV  62

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            + +P  G  G ++K  E I++ T +SI    +HP T   ++ QV+ DDG+++  AINA  
Sbjct  63   VVRPLVGAPGTKDKTHEYILRSTFESIVQSGLHPRTQIQIVSQVMVDDGSIIAAAINATT  122

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
             AL+DAGIP+K +  A+ C + +   ++LDP   E + +K+     F  +    L  ESL
Sbjct  123  MALIDAGIPMKDIVAAVSCVINKDDQILLDPTLQEMENIKSVHTFAFNKTTSSLLFCESL  182

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAAS----EKLSEYLRRSL  804
                     G+ T         D Y  C     AA+    +K+ E++   L
Sbjct  183  ---------GLFTD--------DQYFNCYELCNAAAGVIFDKMREFITNKL  216



>ref|XP_005061357.1| PREDICTED: exosome complex component RRP46-like [Ficedula albicollis]
Length=230

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 108/197 (55%), Gaps = 17/197 (9%)
 Frame = +1

Query  214  QGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQSICLL  393
            +G+T VLA +YGP       E P++A +EV+ +PK G  G  E+  E ++++T +++ L 
Sbjct  44   RGDTSVLAGLYGPAEAKVSKELPDRAALEVLLRPKVGLPGVLERSREQLLRQTCEAVVLG  103

Query  394  TVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKYVVLD  573
             +HP T  S+++QV++D G+LL C +NAAC AL+DAG+PL  L   + C L     ++LD
Sbjct  104  VLHPRTAISLVLQVLSDAGSLLSCCLNAACMALLDAGLPLAALFCGVTCALQPDGTILLD  163

Query  574  PDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYLLCLN  753
            P   +EQ+ +A +     +S                    ++ + T G   V++   CL 
Sbjct  164  PTARQEQEARAILTFAIASSDR-----------------KVLMATTKGSCSVEEMQQCLA  206

Query  754  RARAASEKLSEYLRRSL  804
             A+ A++ + ++ R S+
Sbjct  207  AAQRAADTIFQFYRDSV  223



>ref|XP_006616550.1| PREDICTED: exosome complex component RRP46-like [Apis dorsata]
Length=223

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 110/217 (51%), Gaps = 18/217 (8%)
 Frame = +1

Query  151  LRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQI  330
            LRP+ C    L+   GSA   QG T V+A +YGP     +    +KA IEV + P  G  
Sbjct  15   LRPMNCELNQLSMPDGSAMLMQGNTAVVAGIYGPIEAKPQKMIYDKASIEVSYIPVKGPA  74

Query  331  GKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIP  510
               ++  EM +K T ++  ++T HP T   + IQ + D G +L C INAAC AL++AGIP
Sbjct  75   KIDDRMTEMYIKETCEAAIIVTFHPATAICINIQEMEDSGGMLACTINAACLALINAGIP  134

Query  511  LKHLAVAICCCLAE-SKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            +K    A+ C + E +  ++LDPD ++ Q  KA     F                 + M+
Sbjct  135  MKFTIAAVNCMIQEGTNNIILDPDNIQLQDAKAEFTYAF-----------------DSMK  177

Query  688  CGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRR  798
              II S T G    +++L  +++ + AS+ + ++ R 
Sbjct  178  KDIICSYTAGCFTEEEFLETIDKCKQASQYVFDFYRN  214



>gb|EFX86237.1| hypothetical protein DAPPUDRAFT_193332 [Daphnia pulex]
Length=218

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 87/144 (60%), Gaps = 0/144 (0%)
 Frame = +1

Query  145  NQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTG  324
            N +R L C + VL+RA GS  +SQG T V+A+VYGP     + E  ++  IE+ +KPKTG
Sbjct  6    NSIRALKCEQSVLSRADGSVMFSQGNTVVMASVYGPLEAKIQKELSDRMYIELNYKPKTG  65

Query  325  QIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAG  504
              G  E+  E ++K T   I L  +HP T   + +Q + D G LL  +INA C AL+D+G
Sbjct  66   MPGVAERGKEKLIKTTCNHIILTNLHPRTAVCITVQEMQDGGTLLAASINAVCLALLDSG  125

Query  505  IPLKHLAVAICCCLAESKYVVLDP  576
            +PL+ L  A+ C + +   ++LDP
Sbjct  126  LPLQCLVAAVTCLVDKKDRIILDP  149



>emb|CDH57247.1| exosome complex component rrp46 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=229

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 117/226 (52%), Gaps = 17/226 (8%)
 Frame = +1

Query  124  RRDGRTAN-QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIE  300
            R D RT N QLR  + S+ VLN+A GSA++  GET V+ +V GP     ++E  ++A +E
Sbjct  2    RPDRRTENTQLRSFSSSQNVLNQADGSATFDLGETSVMVSVLGPVEVPLRDEKMDEATVE  61

Query  301  VIWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAA  480
            V+ +P  G    +EK  E  ++R ++ + L  + P T   +++Q++ DDG+ +  ++NA 
Sbjct  62   VVVRPSMGVPATKEKLMEQTLRRAIEPVILGGMMPRTLIQIVVQILKDDGSAIAASLNAM  121

Query  481  CAALVDAGIPLKHLAVAICCCLAE-SKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKE  657
              ALVDAG+P+K +  ++ C +   +  +V+DP   E +   +     F N    A P  
Sbjct  122  SLALVDAGVPMKFMIASMSCMIDRITNEIVMDPTTKELENASSVHTFAFDNLS--ATP--  177

Query  658  SLQAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLR  795
                        I+ S + G      Y  C ++   A EK+ ++LR
Sbjct  178  -----------NILLSDSRGDFSQKQYFECHDKCLNAVEKVHDFLR  212



>gb|EPZ31397.1| Exoribonuclease, phosphorolytic 1 domain-containing protein [Rozella 
allomycis CSF55]
Length=227

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 119/221 (54%), Gaps = 2/221 (1%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R D R  N +RPL   + +L R  GS    QG T VL +V GP    ++ E P +  ++V
Sbjct  2    RTDNRENNDIRPLKIIQNLLTRCDGSIQLEQGNTVVLVSVTGPVEAPRRVEEPTRLVLDV  61

Query  304  IWKPKTGQIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAAC  483
            ++KP +G    +EK+ E+ VK+TL+S   LT  P T  +V+IQ + +DGALL C INAA 
Sbjct  62   LFKPCSGLPSCREKKFEIFVKQTLESFIDLTSLPRTLITVVIQEIKNDGALLACCINAAT  121

Query  484  AALVDAGIPLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESL  663
             AL++AGI L +   +I   +++ ++ VLDP   EE+   +   +VF           SL
Sbjct  122  LALMEAGISLLNRCASITMAISQDEF-VLDPVLKEEEGADSLHTIVFSKYSEQEYSIISL  180

Query  664  QAGGEPMECGIITSVTHGKLEVDDYLLCLNRARAAS-EKLS  783
             + G      +  ++T  KL  +   L +++A  +  EK+S
Sbjct  181  DSTGIFNLDSLNETITRCKLAANAINLIMDKAMISKIEKMS  221



>gb|KFP06545.1| Exosome complex component RRP46, partial [Calypte anna]
Length=192

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 110/201 (55%), Gaps = 17/201 (8%)
 Frame = +1

Query  202  ASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIGKQEKECEMIVKRTLQS  381
            +S S GET VLA +YGP       E  ++A +EV+ +PK G  G  E+  E +++RT ++
Sbjct  3    SSPSPGETSVLAGLYGPAEVKSSKELADRAVLEVLLRPKVGLPGVLERSREQLLRRTCET  62

Query  382  ICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPLKHLAVAICCCLAESKY  561
            + L  +HP +  ++++QV++D+G+LL C +NAA  AL+DAG+PL  L   + C L     
Sbjct  63   VLLGVLHPRSAITLVLQVLSDNGSLLSCCLNAASMALLDAGLPLSSLFCGVTCALDPQGA  122

Query  562  VVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPMECGIITSVTHGKLEVDDYL  741
            +VLDP   +EQ+ +A +                     + +E  ++T  T G   +++  
Sbjct  123  IVLDPTAPQEQEARAVLTFAI-----------------DSVERKVVTVTTRGGCSMEEMQ  165

Query  742  LCLNRARAASEKLSEYLRRSL  804
             CL  A+ A++ + ++ R S+
Sbjct  166  QCLAAAQRAADTIFQFYRDSV  186



>ref|XP_008488170.1| PREDICTED: exosome complex component RRP46 [Diaphorina citri]
Length=157

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 94/148 (64%), Gaps = 0/148 (0%)
 Frame = +1

Query  145  NQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTG  324
            + LR L     +L+R+ GS  +SQG+T V+A++YGP     +    +KA +EVI++PK+G
Sbjct  2    DSLRELKSQLNILSRSDGSVIFSQGQTVVVASMYGPVEAKIQKTIIDKASVEVIFRPKSG  61

Query  325  QIGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAG  504
                Q++  E ++K T +S  L  +HP T+  + IQ + D G+LL C INAAC AL+++G
Sbjct  62   LSFVQDRLKESVIKSTCESALLTMLHPRTSVILTIQELQDQGSLLSCCINAACLALINSG  121

Query  505  IPLKHLAVAICCCLAESKYVVLDPDKLE  588
            I ++++  A+ C + +   V+LD ++++
Sbjct  122  ISMRYILAAVSCIINDKNEVILDANQIQ  149



>gb|AFW78644.1| hypothetical protein ZEAMMB73_813724 [Zea mays]
Length=548

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 77/131 (59%), Gaps = 28/131 (21%)
 Frame = +1

Query  124  RRDGRTANQLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEV  303
            R DG+  NQLR   C   +L+RAHG   W+QG   +L+AVYGPK GT +   PEKA IE 
Sbjct  6    RADGQNPNQLRLFTCIGNLLHRAHGCTRWAQGGIVMLSAVYGPKPGTVRGRTPEKASIEA  65

Query  304  IWKPKTGQI----------------------------GKQEKECEMIVKRTLQSICLLTV  399
            +WKP+TGQI                            G+QE+E EM +KR LQSICLLTV
Sbjct  66   VWKPRTGQIDTPLFPSSSFCPTAVRVIGSLKWRVVFAGRQEREYEMTLKRMLQSICLLTV  125

Query  400  HPNTTTSVIIQ  432
            H NTTTSV++Q
Sbjct  126  HANTTTSVVLQ  136



>ref|XP_002130542.1| PREDICTED: exosome complex component RRP46 isoform X1 [Ciona 
intestinalis]
Length=235

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 115/224 (51%), Gaps = 26/224 (12%)
 Frame = +1

Query  160  LACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQIGKQ  339
              C    L  A GSA +SQGET V+ AVYGP    +  +  +KA +EV ++PK G     
Sbjct  19   FQCEMNALKNADGSAFYSQGETSVMVAVYGPGDLKETKQEIDKALVEVDFRPKLGSPTVN  78

Query  340  EKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGIPLKH  519
            EK  E  V+   ++  +L +HP T  ++I+Q++ D G+LL CAINA C AL DAG+ +KH
Sbjct  79   EKYLERFVQGVCENAIMLALHPRTAFAIIVQIMQDQGSLLSCAINAVCVALQDAGVSMKH  138

Query  520  LAVAICCCL---AESKY------VVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAG  672
            L VA+   L   +ES+       ++++P   EE +  + +  VF                
Sbjct  139  LPVAVTVALRKESESELEDATDVLIINPTIKEESESFSILTFVF----------------  182

Query  673  GEPMECGIITSVTHGKLEVDDYLLCLNRARAASEKLSEYLRRSL  804
             + +   ++   + G L    +  CL  A+ A+E++ ++ R S+
Sbjct  183  -DSVNKNLLCMHSQGPLLPKQHERCLKAAKEATEEVLKFFRDSV  225



>ref|XP_005185686.1| PREDICTED: exosome complex component RRP46 [Musca domestica]
Length=243

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 117/221 (53%), Gaps = 25/221 (11%)
 Frame = +1

Query  148  QLRPLACSRGVLNRAHGSASWSQGETKVLAAVYGPKAGTKKNENPEKACIEVIWKPKTGQ  327
            ++R L C    L R  GSA ++QG T V+A++ GP     +N N +KA +E I++PK G 
Sbjct  19   KIRSLNCELNPLTRTDGSALFAQGGTCVMASILGPVEVKLQNLNIDKAYVECIYRPKAGL  78

Query  328  IGKQEKECEMIVKRTLQSICLLTVHPNTTTSVIIQVVNDDGALLPCAINAACAALVDAGI  507
               +++  E ++K T ++  L  +HP T  SV +Q ++D G L  CAINAAC AL+  GI
Sbjct  79   PTIRDRMRETVIKDTCEAALLSAMHPRTMVSVQVQELDDRGGLDACAINAACMALLIGGI  138

Query  508  PLKHLAVAICCCLAESKYVVLDPDKLEEQKMKAFVYLVFPNSPHLALPKESLQAGGEPME  687
            P+K    A+CC + ++  ++LDPD  +    +A    VF                 + +E
Sbjct  139  PMKFTVAAVCCIVDKNGELILDPDYGQINDSRANFTFVF-----------------DSLE  181

Query  688  CGIITSVTHGKLEV----DDYLLCLNRARAASEKLSEYLRR  798
              ++T  + G  ++    D YL+C    RAAS  + ++ R+
Sbjct  182  RDLVTVNSTGCFKMAQFNDAYLMC----RAASGVIFDFYRK  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3515757891489