BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6066

Length=1180
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADN92993.2|  lipoxygenase LOX1                                       681   0.0      Ipomoea nil [qian niu]
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    552   0.0      Nicotiana sylvestris
gb|AGL96414.1|  9-lipoxygenase                                          548   0.0      Nicotiana benthamiana
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    546   0.0      Nicotiana tomentosiformis
emb|CAA58859.1|  lipoxygenase                                           545   0.0      Nicotiana tabacum [American tobacco]
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               536   2e-180   Solanum tuberosum [potatoes]
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    533   5e-179   Populus euphratica
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    531   2e-178   Solanum lycopersicum
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             529   2e-177   Populus trichocarpa [western balsam poplar]
emb|CDP15504.1|  unnamed protein product                                528   3e-177   Coffea canephora [robusta coffee]
gb|ABF19102.2|  9-lipoxygenase                                          526   3e-176   Capsicum annuum
gb|KCW61797.1|  hypothetical protein EUGRSUZ_H04495                     511   4e-176   Eucalyptus grandis [rose gum]
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             525   4e-176   
emb|CBI36801.3|  unnamed protein product                                519   2e-175   Vitis vinifera
gb|ACO57136.1|  lipoxygenase 1                                          523   4e-175   Capsicum annuum
ref|NP_001268178.1|  lipoxygenase                                       522   8e-175   Vitis vinifera
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                     512   5e-174   Eucalyptus grandis [rose gum]
gb|AGU28274.1|  lipoxygenase 1                                          520   6e-174   Vitis vinifera
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 519   9e-174   
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    518   5e-173   Populus euphratica
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    517   6e-173   Solanum tuberosum [potatoes]
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             515   5e-172   Nicotiana tomentosiformis
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    514   9e-172   Eucalyptus grandis [rose gum]
gb|ACG56281.1|  lipoxygenase                                            514   1e-171   Olea europaea
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    512   5e-171   Eucalyptus grandis [rose gum]
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             511   1e-170   Nicotiana sylvestris
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    511   2e-170   Vitis vinifera
ref|NP_001234098.1|  lipoxygenase                                       511   2e-170   Solanum lycopersicum
emb|CBI36802.3|  unnamed protein product                                511   3e-170   Vitis vinifera
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    510   5e-170   Eucalyptus grandis [rose gum]
emb|CDP20618.1|  unnamed protein product                                508   2e-169   Coffea canephora [robusta coffee]
gb|AAP83135.1|  lipoxygenase                                            508   2e-169   Nicotiana attenuata
gb|AAP83134.1|  lipoxygenase                                            506   8e-169   Nicotiana attenuata
gb|ABW75772.2|  lipoxygenase                                            506   8e-169   Camellia sinensis [black tea]
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    506   2e-168   Eucalyptus grandis [rose gum]
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    505   4e-168   Pyrus x bretschneideri [bai li]
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    503   2e-167   Solanum tuberosum [potatoes]
emb|CAD10740.1|  lipoxygenase                                           501   1e-166   Corylus avellana [European hazelnut]
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 501   1e-166   
ref|XP_012089053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    499   9e-166   Jatropha curcas
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               497   4e-165   Malus domestica [apple tree]
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             497   4e-165   Prunus persica
emb|CAA64767.1|  lipoxygenase                                           482   1e-164   Solanum tuberosum [potatoes]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             496   2e-164   
emb|CAB94852.1|  lipoxygenase                                           495   3e-164   Prunus dulcis [sweet almond]
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    494   3e-164   Prunus mume [ume]
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        494   4e-164   Solanum tuberosum [potatoes]
ref|XP_002319014.2|  lipoxygenase family protein                        493   5e-164   
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    496   6e-164   Prunus mume [ume]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                   484   7e-164   Citrus sinensis [apfelsine]
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 493   9e-164   
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 493   1e-163   
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    493   1e-163   Fragaria vesca subsp. vesca
ref|XP_007030817.1|  Lipoxygenase 1                                     493   1e-163   
gb|AGI16382.1|  lipoxygenase                                            493   2e-163   Malus domestica [apple tree]
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        493   2e-163   Solanum lycopersicum
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                   484   3e-163   Citrus sinensis [apfelsine]
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg             484   3e-163   
gb|AFU51542.1|  lipoxygenase 3                                          492   4e-163   Capsicum annuum
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg             484   7e-163   
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               492   8e-163   
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    491   1e-162   Nelumbo nucifera [Indian lotus]
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    490   2e-162   Pyrus x bretschneideri [bai li]
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    490   2e-162   Sesamum indicum [beniseed]
gb|AGI16378.1|  lipoxygenase                                            490   2e-162   Malus domestica [apple tree]
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    490   3e-162   Solanum tuberosum [potatoes]
emb|CAA64764.1|  lipoxygenase                                           475   5e-162   Solanum tuberosum [potatoes]
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    489   7e-162   
gb|AGI16379.1|  lipoxygenase                                            488   1e-161   Malus domestica [apple tree]
gb|AGK82798.1|  lipoxygenase                                            488   1e-161   Malus domestica [apple tree]
gb|AGI16377.1|  lipoxygenase                                            488   2e-161   Malus domestica [apple tree]
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    487   2e-161   Solanum tuberosum [potatoes]
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    487   3e-161   
gb|AGI16380.1|  lipoxygenase                                            487   3e-161   Malus domestica [apple tree]
emb|CCD74473.1|  lipoxygenase 1                                         470   4e-161   Arabidopsis halleri subsp. halleri
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             486   5e-161   
emb|CAD10779.2|  lipoxygenase                                           486   5e-161   Prunus dulcis [sweet almond]
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    488   1e-160   
gb|AAG00881.1|AC064840_12  lipoxygenase - partial coding sequence       469   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             485   2e-160   Populus trichocarpa [western balsam poplar]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    487   4e-160   
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    483   1e-159   Glycine soja [wild soybean]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    483   1e-159   Glycine max [soybeans]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             483   2e-159   Citrus clementina [clementine]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    482   2e-159   Glycine soja [wild soybean]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   483   2e-159   Citrus sinensis [apfelsine]
gb|AAA74393.1|  lipoxygenase                                            482   2e-159   Solanum lycopersicum
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        482   2e-159   
gb|AHX56187.1|  lipoxygenase                                            483   2e-159   Diospyros kaki [Japanese persimmon]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    482   3e-159   Glycine max [soybeans]
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    482   4e-159   Populus euphratica
ref|NP_001275351.1|  5-lipoxygenase                                     481   1e-158   Solanum tuberosum [potatoes]
gb|AJT49215.1|  putative lipoxygenase-9                                 480   1e-158   Arachis hypogaea [goober]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          479   5e-158   Solanum tuberosum [potatoes]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    479   5e-158   Solanum tuberosum [potatoes]
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    479   8e-158   Nelumbo nucifera [Indian lotus]
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    477   1e-157   
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        477   2e-157   Solanum tuberosum [potatoes]
ref|XP_002512386.1|  lipoxygenase, putative                             476   5e-157   Ricinus communis
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             475   1e-156   Phaseolus vulgaris [French bean]
ref|XP_012069606.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    475   2e-156   
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    474   2e-156   Solanum tuberosum [potatoes]
gb|AEQ30071.1|  lipoxygenase                                            474   5e-156   Litchi chinensis [litchi]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    474   5e-156   Solanum tuberosum [potatoes]
ref|XP_002516771.1|  lipoxygenase, putative                             474   5e-156   
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                473   1e-155   Gossypium hirsutum [American cotton]
emb|CAA64765.1|  lipoxygenase                                           472   1e-155   Solanum tuberosum [potatoes]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    471   5e-155   Solanum tuberosum [potatoes]
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    464   6e-155   
gb|AAD09861.1|  lipoxygenase                                            470   1e-154   Persea americana
gb|ERN11692.1|  hypothetical protein AMTR_s00022p00225700               462   1e-154   Amborella trichopoda
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    471   1e-154   
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    471   1e-154   Pyrus x bretschneideri [bai li]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    470   2e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_175900.1|  lipoxygenase 1                                        469   2e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        469   3e-154   Camelina sativa [gold-of-pleasure]
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               469   5e-154   Malus domestica [apple tree]
gb|AGK82783.1|  lipoxygenase                                            469   5e-154   Malus domestica [apple tree]
dbj|BAH57745.1|  lipoxygenase                                           469   8e-154   Actinidia arguta
ref|XP_006838255.2|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    465   9e-154   
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    468   1e-153   Phoenix dactylifera
gb|KJB80989.1|  hypothetical protein B456_013G124500                    468   1e-153   Gossypium raimondii
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             467   1e-153   
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    466   5e-153   Elaeis guineensis
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                     459   5e-153   Eucalyptus grandis [rose gum]
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    466   7e-153   Fragaria vesca subsp. vesca
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             465   7e-153   Camelina sativa [gold-of-pleasure]
gb|AAO03558.1|  lipoxygenase 1                                          465   1e-152   Brassica napus [oilseed rape]
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        464   2e-152   Camelina sativa [gold-of-pleasure]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    464   2e-152   Cicer arietinum [garbanzo]
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        464   5e-152   Morus notabilis
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             462   1e-151   Brassica rapa
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             461   3e-151   Eutrema salsugineum [saltwater cress]
emb|CAE17327.1|  lipoxygenase                                           461   6e-151   Fragaria x ananassa
ref|XP_011625454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    459   1e-150   
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             458   4e-150   Capsella rubella
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    459   5e-150   Populus euphratica
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    457   1e-149   Arabis alpina [alpine rockcress]
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                457   1e-149   Erythranthe guttata [common monkey flower]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             456   2e-149   Phaseolus vulgaris [French bean]
gb|AGK82774.1|  lipoxygenase                                            457   4e-149   Malus domestica [apple tree]
gb|AGK82776.1|  lipoxygenase                                            457   4e-149   Malus domestica [apple tree]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        456   5e-149   Tarenaya hassleriana [spider flower]
gb|KJB80990.1|  hypothetical protein B456_013G124500                    455   6e-149   Gossypium raimondii
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    455   8e-149   
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    455   1e-148   Populus euphratica
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    456   1e-148   Eucalyptus grandis [rose gum]
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    454   3e-148   Populus euphratica
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    454   3e-148   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    451   3e-148   Eucalyptus grandis [rose gum]
gb|AGK82779.1|  lipoxygenase                                            456   4e-148   Malus domestica [apple tree]
gb|AAZ04411.1|  lipoxygenase                                            453   4e-148   Cynanchum gracillimum
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    453   5e-148   Arabis alpina [alpine rockcress]
emb|CDY43490.1|  BnaA01g21450D                                          462   6e-148   Brassica napus [oilseed rape]
gb|AGK82775.1|  lipoxygenase                                            453   9e-148   Malus domestica [apple tree]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    452   2e-147   Sesamum indicum [beniseed]
gb|AIC82456.1|  lipoxygenase                                            451   2e-147   Cocos nucifera
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    449   1e-146   Fragaria vesca subsp. vesca
gb|ABF60002.1|  lipoxygenase 2                                          449   2e-146   Actinidia deliciosa [Chinese gooseberry]
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    450   2e-146   
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    449   3e-146   Sesamum indicum [beniseed]
ref|XP_003591120.1|  Lipoxygenase                                       448   3e-146   Medicago truncatula
ref|XP_002311617.1|  lipoxygenase family protein                        448   5e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        447   7e-146   Tarenaya hassleriana [spider flower]
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             447   9e-146   
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                448   5e-145   Erythranthe guttata [common monkey flower]
ref|XP_006607065.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    431   7e-145   
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             443   5e-144   Citrus clementina [clementine]
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    442   9e-144   Nicotiana tomentosiformis
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    442   1e-143   Nicotiana tomentosiformis
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    442   1e-143   Nicotiana sylvestris
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    442   2e-143   Nicotiana sylvestris
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    442   2e-143   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    441   3e-143   Populus euphratica
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    439   8e-143   
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   440   9e-143   Citrus sinensis [apfelsine]
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    439   2e-142   Prunus mume [ume]
ref|XP_002315780.1|  lipoxygenase family protein                        439   2e-142   
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             439   2e-142   
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    438   3e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    439   3e-142   Prunus mume [ume]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    439   4e-142   Prunus mume [ume]
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    437   7e-142   Pyrus x bretschneideri [bai li]
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    437   1e-141   Populus euphratica
gb|KJB38135.1|  hypothetical protein B456_006G238200                    426   3e-141   Gossypium raimondii
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    435   8e-141   Solanum tuberosum [potatoes]
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    434   1e-140   Solanum tuberosum [potatoes]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    434   2e-140   Sesamum indicum [beniseed]
gb|KJB28315.1|  hypothetical protein B456_005G041900                    434   2e-140   Gossypium raimondii
gb|AEZ50136.1|  lipoxygenase                                            434   2e-140   
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    434   2e-140   Sesamum indicum [beniseed]
gb|KJB38136.1|  hypothetical protein B456_006G238200                    427   2e-140   Gossypium raimondii
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    434   2e-140   
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    433   3e-140   Solanum lycopersicum
gb|ABF19103.2|  9-lipoxygenase                                          433   4e-140   Capsicum annuum
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  432   4e-140   Medicago truncatula
ref|XP_011648826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    432   8e-140   Cucumis sativus [cucumbers]
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    431   1e-139   Cucumis sativus [cucumbers]
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    433   1e-139   
gb|AGI16415.1|  lipoxygenase                                            431   2e-139   Malus domestica [apple tree]
gb|AGI16414.1|  lipoxygenase                                            431   2e-139   Malus domestica [apple tree]
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               431   2e-139   Malus domestica [apple tree]
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              430   2e-139   Glycine soja [wild soybean]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    431   2e-139   
gb|AGI16416.1|  lipoxygenase                                            429   7e-139   Malus domestica [apple tree]
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               430   2e-138   Malus domestica [apple tree]
gb|AGI16413.1|  lipoxygenase                                            428   3e-138   Malus domestica [apple tree]
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   426   3e-138   Citrus sinensis [apfelsine]
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    422   4e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    427   5e-138   Cucumis sativus [cucumbers]
gb|ADL41189.1|  lipoxygenase                                            427   7e-138   Camellia sinensis [black tea]
gb|KJB38138.1|  hypothetical protein B456_006G238200                    426   2e-137   Gossypium raimondii
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    426   3e-137   Gossypium arboreum [tree cotton]
gb|KJB38137.1|  hypothetical protein B456_006G238200                    426   4e-137   Gossypium raimondii
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    426   6e-137   
emb|CDO99039.1|  unnamed protein product                                424   1e-136   Coffea canephora [robusta coffee]
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    426   1e-136   Pyrus x bretschneideri [bai li]
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                424   1e-136   Erythranthe guttata [common monkey flower]
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             423   1e-136   Phaseolus vulgaris [French bean]
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    423   1e-136   
ref|XP_003626279.1|  Chalcone synthase                                  433   4e-136   
gb|AHX56188.1|  lipoxygenase                                            422   5e-136   Diospyros kaki [Japanese persimmon]
emb|CDP20619.1|  unnamed protein product                                415   2e-135   Coffea canephora [robusta coffee]
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    422   2e-135   Fragaria vesca subsp. vesca
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    420   3e-135   Nicotiana sylvestris
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        420   3e-135   Cucumis melo [Oriental melon]
gb|KCW61804.1|  hypothetical protein EUGRSUZ_H04500                     412   5e-135   Eucalyptus grandis [rose gum]
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             419   7e-135   Prunus persica
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    416   9e-134   Sesamum indicum [beniseed]
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    416   1e-133   Sesamum indicum [beniseed]
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               414   1e-133   
emb|CDP20620.1|  unnamed protein product                                410   2e-132   Coffea canephora [robusta coffee]
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    414   3e-132   Pyrus x bretschneideri [bai li]
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    412   3e-132   Cucumis sativus [cucumbers]
ref|XP_003592410.1|  Lipoxygenase                                       411   5e-132   
gb|AEU04516.1|  lipoxygenase 1                                          411   5e-132   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    418   5e-132   
ref|XP_010025191.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    412   6e-132   
ref|XP_004230207.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    411   6e-132   Solanum lycopersicum
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    409   2e-131   
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    410   2e-131   Cucumis melo [Oriental melon]
gb|ACD43483.1|  lipoxygenase 1                                          410   2e-131   Olea europaea
emb|CDY46325.1|  BnaC01g31590D                                          410   2e-131   Brassica napus [oilseed rape]
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    410   2e-131   Glycine max [soybeans]
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              410   2e-131   Glycine soja [wild soybean]
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    410   4e-131   Brassica rapa
gb|AAD09202.1|  lipoxygenase                                            409   5e-131   Solanum tuberosum [potatoes]
ref|XP_006344625.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    409   7e-131   Solanum tuberosum [potatoes]
ref|XP_010530359.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    409   8e-131   Tarenaya hassleriana [spider flower]
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    409   9e-131   Arabis alpina [alpine rockcress]
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        408   9e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGH13205.1|  lipoxygenase                                            408   9e-131   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    409   9e-131   Cucumis melo [Oriental melon]
gb|AHI86055.1|  lipoxygenase                                            409   1e-130   Cucumis melo var. makuwa
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        408   2e-130   Phoenix dactylifera
ref|XP_006344624.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    405   2e-129   Solanum tuberosum [potatoes]
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    405   2e-129   Prunus mume [ume]
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    404   2e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    403   6e-129   Cicer arietinum [garbanzo]
ref|XP_007030814.1|  Lipoxygenase 1                                     402   8e-129   
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    403   1e-128   Elaeis guineensis
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    403   1e-128   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             403   2e-128   Eutrema salsugineum [saltwater cress]
gb|KJB26433.1|  hypothetical protein B456_004G241400                    397   2e-128   Gossypium raimondii
emb|CDY64191.1|  BnaA01g36630D                                          402   4e-128   Brassica napus [oilseed rape]
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    401   7e-128   Gossypium arboreum [tree cotton]
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          401   8e-128   Cucumis sativus [cucumbers]
gb|AEI71780.1|  bacterial-induced lipoxygenase                          400   2e-127   Gossypium hirsutum [American cotton]
gb|KJB26434.1|  hypothetical protein B456_004G241400                    399   3e-127   Gossypium raimondii
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    399   4e-127   Brassica rapa
emb|CDY38326.1|  BnaC05g30190D                                          399   6e-127   Brassica napus [oilseed rape]
gb|KJB26432.1|  hypothetical protein B456_004G241300                    395   6e-126   Gossypium raimondii
ref|NP_188879.2|  lipoxygenase 5                                        396   1e-125   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    395   1e-125   Gossypium arboreum [tree cotton]
gb|ADG03095.1|  lipoxygenase 3                                          395   1e-125   Glycine max [soybeans]
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        395   1e-125   Glycine soja [wild soybean]
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             397   1e-125   Prunus persica
gb|ABX60408.1|  lipoxygenase L-3                                        395   1e-125   Glycine max [soybeans]
dbj|BAB01777.1|  lipoxygenase                                           395   1e-125   Arabidopsis thaliana [mouse-ear cress]
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    395   1e-125   
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   395   1e-125   
emb|CAC19365.1|  lipoxygenase                                           394   3e-125   
gb|AGN75068.1|  lipoxygenase 2                                          393   4e-125   
gb|ACH91370.1|  lipoxygenase LOX-3                                      395   6e-125   
gb|ABV32552.1|  lipoxygenase                                            394   1e-124   
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    394   2e-124   
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    392   2e-124   
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    391   3e-124   
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    392   3e-124   
emb|CAA31664.1|  unnamed protein product                                390   5e-124   
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    390   6e-124   
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    388   4e-123   
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    388   8e-123   
prf||1502333A  lipoxygenase 3                                           387   1e-122
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    387   1e-122   
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    385   1e-122   
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    387   1e-122   
ref|NP_001105515.1|  lipoxygenase                                       386   2e-122   
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             386   3e-122   
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    385   3e-122   
ref|XP_003597558.1|  Lipoxygenase                                       385   6e-122   
gb|AAG61118.1|  lipoxygenase                                            385   8e-122   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    385   1e-121   
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    381   1e-121   
gb|EPS73035.1|  hypothetical protein M569_01717                         397   1e-121   
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    384   1e-121   
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               385   2e-121   
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         384   3e-121   
ref|XP_012089361.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    383   3e-121   
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    383   4e-121   
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    383   6e-121   
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    383   1e-120   
ref|XP_007030815.1|  Lipoxygenase 1                                     381   2e-120   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    381   4e-120   
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        380   5e-120   
emb|CAP59449.1|  lipoxygenase                                           380   1e-119   
ref|XP_003597559.1|  Seed lipoxygenase-3                                379   2e-119   
gb|EAY91529.1|  hypothetical protein OsI_13162                          377   5e-119   
ref|NP_001050993.1|  Os03g0700400                                       378   5e-119   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        378   5e-119   
ref|XP_003627173.1|  Seed lipoxygenase-3                                377   7e-119   
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        377   9e-119   
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    375   4e-118   
gb|ACV84249.1|  LOX1                                                    375   8e-118   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   374   1e-117   
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    374   1e-117   
gb|ADG03092.1|  lipoxygenase 2                                          374   1e-117   
gb|ABX60407.1|  lipoxygease L-2                                         374   1e-117   
emb|CBI26229.3|  unnamed protein product                                371   1e-117   
gb|EAY91532.1|  hypothetical protein OsI_13165                          374   1e-117   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    374   2e-117   
gb|ADG03091.1|  lipoxygenase 2                                          374   2e-117   
gb|AFK32352.1|  lipoxygenase-2                                          374   2e-117   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    374   2e-117   
gb|ABD47523.1|  dual positional specificity lipoxygenase                374   2e-117   
gb|EAY91797.1|  hypothetical protein OsI_13441                          374   2e-117   
ref|NP_001051212.1|  Os03g0738600                                       373   3e-117   
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050          373   3e-117   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    374   4e-117   
gb|EAZ28267.1|  hypothetical protein OsJ_12238                          377   6e-117   
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    372   1e-116   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    371   2e-116   
emb|CAA55318.1|  lipoxygenase                                           371   2e-116   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             371   2e-116   
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    370   4e-116   
ref|XP_002278007.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    370   4e-116   
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    370   6e-116   
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    368   2e-115   
gb|ADG03094.1|  mutant lipoxygenase 1                                   358   3e-115   
gb|AAY87056.1|  13-lipoxygenase                                         368   3e-115   
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             367   4e-115   
gb|AAY87057.1|  13-lipoxygenase                                         367   5e-115   
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    367   6e-115   
gb|ADR71858.1|  lipoxygenase-1                                          367   7e-115   
gb|AHG59316.1|  lipoxygenase                                            366   1e-114   
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    367   1e-114   
ref|NP_001292659.1|  linoleate 9S-lipoxygenase 6-like                   366   1e-114   
gb|ADR71859.1|  lipoxygenase-1                                          366   1e-114   
gb|AAC61785.1|  lipoxygenase 1                                          366   2e-114   
gb|AEB70991.1|  lipoxygenase 4                                          366   2e-114   
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    366   2e-114   
gb|AHG59315.1|  lipoxygenase                                            365   2e-114   
gb|ADR71856.1|  lipoxygenase-1                                          365   3e-114   
gb|ADR71857.1|  lipoxygenase-1                                          365   4e-114   
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              364   5e-114   
gb|AEB70990.1|  lipoxygenase 3                                          364   6e-114   
emb|CAA45738.1|  lipoxygenase                                           364   9e-114   
gb|ADP02185.1|  putative lipoxygenase                                   363   1e-113   
emb|CAA97845.1|  lipoxygenase                                           363   1e-113   
gb|EPS73037.1|  lipoxygenase                                            351   2e-113   
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        363   2e-113   
gb|ACS34909.1|  lipoxygenase 1                                          362   4e-113   
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        362   4e-113   
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1             361   8e-113   
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             361   1e-112   
ref|XP_002883361.1|  lipoxygenase                                       360   1e-112   
ref|XP_007030813.1|  Lipoxygenase 1                                     360   1e-112   
ref|XP_007030811.1|  Lipoxygenase 1                                     360   2e-112   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        359   4e-112   
gb|KHN11251.1|  Seed linoleate 9S-lipoxygenase-2                        359   5e-112   
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    359   7e-112   
gb|AEO13837.1|  lipoxygenase                                            358   2e-111   
ref|XP_011650109.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        355   3e-111   
gb|AFW67907.1|  hypothetical protein ZEAMMB73_739462                    348   5e-111   
gb|EPS66745.1|  lipoxygenase                                            350   5e-111   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        357   7e-111   
pdb|4WHA|A  Chain A, Lipoxygenase-1 (soybean) L546a/l754a Mutant        355   1e-110   
pdb|3PZW|A  Chain A, Soybean Lipoxygenase-1 - Re-Refinement             355   1e-110   
pdb|3BNE|A  Chain A, Lipoxygenase-1 (Soybean) I553a Mutant              355   1e-110   
pdb|3BNB|A  Chain A, Lipoxygenase-1 (Soybean) I553l Mutant              355   1e-110   
pdb|3BND|A  Chain A, Lipoxygenase-1 (Soybean), I553v Mutant             355   1e-110   
ref|NP_001236153.1|  seed linoleate 13S-lipoxygenase-1                  355   2e-110   
pdb|3BNC|A  Chain A, Lipoxygenase-1 (Soybean) I553g Mutant              355   2e-110   
gb|ADG03093.1|  lipoxygenase 1                                          355   2e-110   
pdb|1FGR|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697e Mutant     355   2e-110   
pdb|1FGQ|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495e Mutant     355   2e-110   
pdb|1FGM|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694h Mutant     355   2e-110   
pdb|1Y4K|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, N694g Mutant     355   2e-110   
pdb|1FGO|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q495a Mutant     355   2e-110   
pdb|1FGT|A  Chain A, Lipoxygenase-1 (Soybean) At 100k, Q697n Mutant     355   2e-110   
ref|XP_010651467.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    340   3e-110   
gb|KHN11253.1|  Seed linoleate 9S-lipoxygenase-2                        354   4e-110   
ref|XP_002521992.1|  lipoxygenase, putative                             354   5e-110   
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    356   5e-110   
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    355   1e-109   
tpg|DAA56392.1|  TPA: lipoxygenase1                                     353   1e-109   
ref|NP_001292637.1|  linoleate 9S-lipoxygenase 6-like                   353   1e-109   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          353   1e-109   
ref|XP_011648827.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        353   2e-109   
gb|AEL03787.1|  lipoxygenase                                            353   2e-109   
gb|KHN32712.1|  Linoleate 9S-lipoxygenase-4                             348   3e-109   
ref|XP_011648829.1|  PREDICTED: linoleate 9S-lipoxygenase 6             351   8e-109   
gb|ACL53478.1|  unknown                                                 351   1e-108   
ref|NP_001105003.1|  lipoxygenase                                       350   2e-108   
ref|XP_007150488.1|  hypothetical protein PHAVU_005G1568000g            337   2e-108   
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    350   2e-108   
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        350   2e-108   
gb|KHN32711.1|  Linoleate 9S-lipoxygenase-4                             350   2e-108   
ref|XP_003546741.1|  PREDICTED: linoleate 9S-lipoxygenase-4-like ...    350   2e-108   
gb|ACG43480.1|  lipoxygenase 2                                          350   3e-108   
emb|CAA53730.1|  lipoxygenase                                           349   4e-108   
ref|NP_001237323.1|  lipoxygenase-9                                     349   4e-108   
gb|ABQ10187.1|  lipoxygenase                                            349   5e-108   
ref|NP_001105975.1|  lipoxygenase                                       349   6e-108   
gb|ACL53637.1|  unknown                                                 349   7e-108   
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    348   8e-108   
gb|ABX60409.1|  lipoxygease L-4                                         347   1e-107   
gb|ACU81176.1|  13S-lipoxygenase                                        348   1e-107   
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        348   2e-107   
ref|NP_001238203.1|  lipoxygenase L-5                                   347   3e-107   
gb|EMT25349.1|  Lipoxygenase 2                                          347   3e-107   
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450          347   5e-107   
gb|ABB82552.1|  13S-lipoxygenase                                        346   7e-107   
gb|AGS94394.3|  lipoxygenase                                            346   8e-107   
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               346   9e-107   
ref|XP_003627174.1|  Lipoxygenase                                       345   1e-106   
emb|CAG44503.1|  lipoxygenase LOXN3                                     345   1e-106   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          345   2e-106   
emb|CAG44501.1|  lipoxygenase LOXN3                                     345   2e-106   
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    344   2e-106   
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        344   3e-106   
ref|NP_001235250.1|  lipoxygenase                                       344   3e-106   
tpg|DAA56391.1|  TPA: lipoxygenase1                                     344   4e-106   
ref|XP_003612346.1|  Seed lipoxygenase                                  335   5e-106   
ref|XP_003559938.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        342   1e-105   
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like          342   2e-105   
gb|ACS34908.1|  lipoxygenase 2                                          342   2e-105   
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             342   2e-105   
gb|EMT18292.1|  Putative lipoxygenase 3                                 341   4e-105   
dbj|BAJ91632.1|  predicted protein                                      341   6e-105   
ref|XP_006359922.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    340   6e-105   
ref|NP_001238692.1|  lipoxygenase                                       340   9e-105   
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like          340   1e-104   
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             340   1e-104   
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     340   1e-104   
ref|XP_003627310.1|  Lipoxygenase                                       340   1e-104   
gb|ACN29156.1|  unknown                                                 340   2e-104   
ref|XP_003627181.1|  Lipoxygenase                                       340   2e-104   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    339   2e-104   
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             339   3e-104   
gb|AHH24969.2|  lipoxygenase                                            340   3e-104   
ref|NP_001105974.1|  lipoxygenase                                       339   3e-104   
dbj|BAJ97226.1|  predicted protein                                      338   5e-104   
emb|CBI16430.3|  unnamed protein product                                322   6e-104   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             337   2e-103   
gb|ADZ31265.1|  lipoxygenase 3                                          337   2e-103   
ref|XP_004512262.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     337   3e-103   
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             336   3e-103   
gb|AES95304.2|  seed linoleate 9S-lipoxygenase                          335   3e-103   
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    344   4e-103   
gb|ABF98393.1|  Lipoxygenase 3, putative, expressed                     326   4e-103   
gb|AAF15296.2|AF204210_1  lipoxygenase                                  335   6e-103   
ref|NP_001105973.1|  lipoxygenase                                       335   6e-103   
dbj|BAJ87153.1|  predicted protein                                      335   7e-103   
ref|XP_004510411.1|  PREDICTED: linoleate 9S-lipoxygenase-like          335   8e-103   
ref|XP_003612345.1|  Seed lipoxygenase                                  335   1e-102   
ref|XP_004247367.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    334   1e-102   
ref|XP_004982082.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    335   1e-102   
ref|NP_001237338.1|  lipoxygenase-10                                    334   2e-102   
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               334   3e-102   
ref|XP_003627187.1|  Lipoxygenase                                       334   3e-102   
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    333   3e-102   
gb|AIL90390.1|  lipoxygenase                                            333   4e-102   
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          333   7e-102   
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    333   8e-102   
gb|AAF60270.1|  lipoxygenase 1                                          332   9e-102   
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          332   1e-101   
ref|NP_001292695.1|  linoleate 9S-lipoxygenase 6-like                   332   1e-101   
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          332   2e-101   
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              331   2e-101   
sp|P38414.1|LOX1_LENCU  RecName: Full=Linoleate 9S-lipoxygenase; ...    331   4e-101   
gb|KEH18418.1|  seed linoleate 9S-lipoxygenase                          325   4e-101   
ref|XP_003627196.1|  Lipoxygenase                                       329   1e-100   
ref|NP_001050990.1|  Os03g0699700                                       329   1e-100   
gb|EAY91521.1|  hypothetical protein OsI_13155                          329   2e-100   
gb|AAB70865.1|  lipoxygenase 2                                          329   2e-100   
gb|AAG42354.1|  lipoxygenase                                            328   3e-100   
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             328   4e-100   
ref|NP_001235189.1|  lipoxygenase                                       328   4e-100   
gb|KEH35160.1|  seed linoleate 9S-lipoxygenase                          328   4e-100   



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/349 (95%), Positives = 336/349 (96%), Gaps = 0/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN
Sbjct  4     GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  63

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVP AFIIKNNHPNEFYLKTL
Sbjct  64    GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPGAFIIKNNHPNEFYLKTL  123

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTP  LK YR+EEL++LRGT
Sbjct  124   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPDLLKTYREEELLNLRGT  183

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTGE KEWDRVYDYAYYNDLGDPD+GAEYAR ILGGNSEYPYPRRGRTG  PTK DPNSE
Sbjct  184   GTGERKEWDRVYDYAYYNDLGDPDRGAEYARTILGGNSEYPYPRRGRTGSEPTKHDPNSE  243

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SRIPLL SLDIYVPRDEKFGHLKLADFL YALKSV QFLL EFESLFDSTPTEFDSFQD+
Sbjct  244   SRIPLLISLDIYVPRDEKFGHLKLADFLAYALKSVGQFLLSEFESLFDSTPTEFDSFQDM  303

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ
Sbjct  304   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  352



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/353 (74%), Positives = 309/353 (88%), Gaps = 4/353 (1%)
 Frame = +2

Query  95    GKLAEALSPT---KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD  265
             GK+ +A++     KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD
Sbjct  4     GKIVDAITGKDDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHAD  63

Query  266   LGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFY  442
               NGL+GKRSKAAYL++W+  NT +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+
Sbjct  64    PANGLQGKRSKAAYLENWLTNNTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFF  123

Query  443   LKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVH  622
             LK+LTLEDVPNHG+VHF C SWVYPA KY   RIFF+NQAYLPS+TP PL+K R+ ELV 
Sbjct  124   LKSLTLEDVPNHGKVHFVCNSWVYPAKKYKSPRIFFANQAYLPSETPEPLRKCRENELVT  183

Query  623   LRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTD  802
             LRG GTG+L+EWDRVYDYAYYNDLGDPDKG E +RP+LGG+SEYPYPRRGRTGR PTKTD
Sbjct  184   LRGDGTGKLEEWDRVYDYAYYNDLGDPDKGKELSRPVLGGSSEYPYPRRGRTGREPTKTD  243

Query  803   PNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDS  982
             PNSESRIPLL SLDIYVPRDE+FGH+KL+DFLT+ALKS+ Q LLPEF++LFDSTP EFDS
Sbjct  244   PNSESRIPLLMSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDS  303

Query  983   FQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             F+D+L LYEGGIKLPQGPLL AI D+IPLE+LKEL+RSDGEGLFK+PTPQVIQ
Sbjct  304   FEDVLKLYEGGIKLPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQ  356



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/352 (73%), Positives = 307/352 (87%), Gaps = 4/352 (1%)
 Frame = +2

Query  98    KLAEALSPT---KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL  268
             K+ +A+S     KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV  D 
Sbjct  5     KIVDAISGKDDGKKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVHVDP  64

Query  269   GNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYL  445
              NGL+GKRSKAAYL++W+   T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+L
Sbjct  65    ANGLQGKRSKAAYLENWLTNKTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFL  124

Query  446   KTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHL  625
             K+LTLEDVPNHG+VHF C SWVYPA+KY   RIFF+NQAYLPS+TP PL+K R+ ELV L
Sbjct  125   KSLTLEDVPNHGKVHFVCNSWVYPANKYKSPRIFFANQAYLPSETPEPLRKCRENELVTL  184

Query  626   RGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDP  805
             RG GTG+L+EWDRVYDYAYYNDLGDPDKG E +RP+LGG+SEYPYPRRGRTGR PTK+DP
Sbjct  185   RGDGTGKLEEWDRVYDYAYYNDLGDPDKGKELSRPVLGGSSEYPYPRRGRTGREPTKSDP  244

Query  806   NSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSF  985
             NSESRIPLL SLDIYVPRDE+FGH+KL+DFLT+ALKS+ Q LLPEF++LFDSTP EFDSF
Sbjct  245   NSESRIPLLMSLDIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFQALFDSTPNEFDSF  304

Query  986   QDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +D+L LYEGGIKLPQGPLL AI DNIPLE+LKEL+RSDGEGLFK+PTPQVIQ
Sbjct  305   EDVLKLYEGGIKLPQGPLLKAITDNIPLEILKELLRSDGEGLFKYPTPQVIQ  356



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/340 (75%), Positives = 303/340 (89%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRSKAA
Sbjct  17    KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  305   YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77    YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPEAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA+KY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  137   KVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPETLRKYRENELVTLRGDGTGKLEEWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG + +RP+LGG+SEYPYPRRGRTGR PTKTDPNSESRIPLL SL
Sbjct  197   RVYDYAYYNDLGDPDKGQDLSRPVLGGSSEYPYPRRGRTGRKPTKTDPNSESRIPLLMSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+KL+DFLT+ALKS+ Q LLPEF++LFDSTP EFD F+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDRFEDVLKLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPLL AI D+IPLE+LKEL+RSDGEGLFK+PTPQVIQ
Sbjct  317   LPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQ  356



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/340 (75%), Positives = 303/340 (89%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK+KG VVLM+KNVLDF D NAS++D + +FLG++VSLEL+SSV AD  NGL+GKRSKAA
Sbjct  17    KKVKGTVVLMKKNVLDFTDINASVLDGVLEFLGRRVSLELISSVNADPANGLQGKRSKAA  76

Query  305   YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+  +T +A+GESAF++ F+W  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  77    YLENWLTNSTPIAAGESAFRVTFDWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA+KY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  137   KVHFVCNSWVYPANKYKSDRIFFANQAYLPSETPDTLRKYRENELVTLRGDGTGKLEEWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG + +RP+LGG+SEYPYPRRGRTGR PTKTDPNSESRIPLL SL
Sbjct  197   RVYDYAYYNDLGDPDKGQDLSRPVLGGSSEYPYPRRGRTGRKPTKTDPNSESRIPLLMSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+KL+DFLT+ALKS+ Q LLPEF++LFDST  EFDSF+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHIKLSDFLTFALKSIVQLLLPEFKALFDSTHNEFDSFEDVLKLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPLL AI D+IPLE+LKEL+RSDGEGLFK+PTPQVIQ
Sbjct  317   LPQGPLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQ  356



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   536 bits (1382),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 250/353 (71%), Positives = 296/353 (84%), Gaps = 5/353 (1%)
 Frame = +2

Query  98    KLAEALSPT-----KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA  262
             K+ EA+S       KK+KG +VLM+KNVLDFND NAS++D + +FLG++VSL+L+S V A
Sbjct  5     KIVEAISGRSEDNGKKVKGTIVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISVVHA  64

Query  263   DLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFY  442
             D GN L+GKRS  AYL+ W+   T L +GESAF + F+W ED GVP AFII N H NEFY
Sbjct  65    DPGNSLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDEDIGVPGAFIINNFHFNEFY  124

Query  443   LKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVH  622
             LK+LTLEDVPNHG VHF C SWVYPA KY  ERIFF+NQAYLP +TP PL+ YR++ELV+
Sbjct  125   LKSLTLEDVPNHGNVHFVCNSWVYPAKKYKSERIFFANQAYLPGETPEPLRNYREKELVN  184

Query  623   LRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTD  802
             LRG G G+L+EWDRVYDYA YNDLGDP+KG +YAR ILGG++EYPYPRRGRTGR PTK D
Sbjct  185   LRGNGNGKLEEWDRVYDYALYNDLGDPEKGKQYARTILGGSAEYPYPRRGRTGRKPTKAD  244

Query  803   PNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDS  982
             P SESRIPLL SLDIYVPRDE+FGH+KL+DFLTYALKS+ QFL+PEF++LFDSTP EFDS
Sbjct  245   PKSESRIPLLMSLDIYVPRDERFGHIKLSDFLTYALKSIVQFLIPEFQALFDSTPDEFDS  304

Query  983   FQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             F+D+L LYEGGIKLPQGP L A+ D+IPLE+LKE+IR+DGEG FKFPTPQVIQ
Sbjct  305   FEDVLKLYEGGIKLPQGPFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVIQ  357



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   533 bits (1373),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 247/341 (72%), Positives = 289/341 (85%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSK  298
              KKIKG VVLM+KNVLDFNDFNAS++D + + LG  VSL+LVS+V +D   N LKGK  +
Sbjct  21    VKKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGHGVSLQLVSAVNSDPSENDLKGKLGE  80

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  81    PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  140

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SWVYP  +YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  141   GRVHFVCNSWVYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  200

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLGDPDKGA+YARP+LGG+SEYPYPRRGRTGRAPTK+DPN+ESR PLL S
Sbjct  201   DRVYDYAYYNDLGDPDKGAKYARPVLGGSSEYPYPRRGRTGRAPTKSDPNTESRQPLLMS  260

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK+ADFL YALKSVAQF+ PE E+L DSTP EFDSF D+L+LYEGGI
Sbjct  261   LDIYVPRDERFGHLKMADFLAYALKSVAQFIRPELEALCDSTPNEFDSFDDVLDLYEGGI  320

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP GPLL  +  NIP+EMLKE+IR+DGEGLF+FP PQVIQ
Sbjct  321   KLPDGPLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQ  361



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   531 bits (1369),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 245/352 (70%), Positives = 296/352 (84%), Gaps = 4/352 (1%)
 Frame = +2

Query  98    KLAEALS----PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD  265
             K+ E +S      KK+KG VVLM+KNVLDFND NAS++D + +FLG++VSL+L+S+V AD
Sbjct  5     KIVEVISGKSENVKKVKGTVVLMKKNVLDFNDVNASLLDGVLEFLGKRVSLQLISAVHAD  64

Query  266   LGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYL  445
              GN L+GKRS  AYL+ W+   T L +GESAF + F+W +D GVP AFII N H NEFYL
Sbjct  65    PGNTLQGKRSNPAYLEKWLTTGTSLVAGESAFDVTFDWDDDIGVPGAFIINNFHFNEFYL  124

Query  446   KTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHL  625
             K+LTLEDVPNHG VHF C SWVYPA +Y  ERIFF+NQAYLP +TP PL+ YR++ELV+L
Sbjct  125   KSLTLEDVPNHGSVHFVCNSWVYPAKRYKSERIFFANQAYLPGETPEPLRNYREKELVNL  184

Query  626   RGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDP  805
             RG G G+L+EWDRVYDYA YNDLGDP+KG +YAR ILGG++E+PYPRRGRTGR PTK DP
Sbjct  185   RGDGNGKLEEWDRVYDYALYNDLGDPEKGKQYARTILGGSAEFPYPRRGRTGRKPTKADP  244

Query  806   NSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSF  985
              SESRIPLL SLDIYVPRDE+FGH+KL+DFLTYALKS+ QFL+PEF++LFDSTP EFDSF
Sbjct  245   KSESRIPLLMSLDIYVPRDERFGHIKLSDFLTYALKSIVQFLIPEFQALFDSTPDEFDSF  304

Query  986   QDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +D++ LYEGGIKLPQGP L A+ D+IPLE+LKE+IR+DGEG FKFPTPQV+Q
Sbjct  305   EDVMKLYEGGIKLPQGPFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVLQ  356



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   529 bits (1362),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 290/341 (85%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSK  298
              KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ+VSL+LVS+V +D   N LKGK  +
Sbjct  21    VKKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQRVSLQLVSAVNSDPSENDLKGKLGE  80

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  81    PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  140

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SW+YP ++YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  141   GRVHFVCNSWIYPTTRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  200

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLGDPDKGA+YARP+LGG+SEYPYPRRGRTGRAP K+DPN+ESR PLL S
Sbjct  201   DRVYDYAYYNDLGDPDKGAKYARPVLGGSSEYPYPRRGRTGRAPAKSDPNTESRQPLLMS  260

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FGHLK++DFL YALKSVAQF+ PE E+L DSTP EFDSF D+L+LYEGG 
Sbjct  261   LNIYVPRDERFGHLKMSDFLAYALKSVAQFIRPELEALCDSTPNEFDSFDDVLDLYEGGF  320

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP GPLL  +  NIP+EMLKE+I +DGEGLF+FP PQVIQ
Sbjct  321   KLPDGPLLENLTKNIPVEMLKEIIPTDGEGLFRFPKPQVIQ  361



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   528 bits (1360),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/349 (71%), Positives = 290/349 (83%), Gaps = 2/349 (1%)
 Frame = +2

Query  98    KLAEALSPT-KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             K+ +ALS   KKIKG VVLM+KNVLD NDFNAS +D + + LGQKVSL+L+S+V  D G 
Sbjct  4     KIVDALSGNNKKIKGTVVLMKKNVLDLNDFNASFLDGIHELLGQKVSLQLISAVNVDQGT  63

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
              LKGK  KAAYL+ W+  NT LA+GE+A  I F+W ED G+P AFIIKNNHP +FYLKTL
Sbjct  64    -LKGKLGKAAYLEDWITTNTFLAAGETAADITFDWDEDQGIPGAFIIKNNHPTQFYLKTL  122

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLE+VP HG VHF C SWVYPA+KY  +R+FFSNQAYLPS TP PL++YR EELV+LRG 
Sbjct  123   TLEEVPGHGRVHFVCNSWVYPAAKYKKDRVFFSNQAYLPSDTPEPLRQYRAEELVNLRGD  182

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTGELKEWDRVYDYAYYNDLGDPDKG EYAR  LGG+ E+PYPRRGRTGR P+KTDP  E
Sbjct  183   GTGELKEWDRVYDYAYYNDLGDPDKGKEYARQNLGGSQEFPYPRRGRTGRPPSKTDPTVE  242

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+PLLTSLDIYVPRDE+FGHLK++DFL Y LKSVAQ L P  +SLFDSTP EFDS +D+
Sbjct  243   SRLPLLTSLDIYVPRDERFGHLKMSDFLGYGLKSVAQILYPALKSLFDSTPNEFDSLEDV  302

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGIKLP+GPLL +I DNIP E+LKE++R+DGE + KFPTPQ+IQ
Sbjct  303   LKLYEGGIKLPKGPLLQSITDNIPFELLKEILRTDGEAILKFPTPQIIQ  351



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   526 bits (1354),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 246/340 (72%), Positives = 294/340 (86%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +K+KG+VVLM+KNVLDF D  AS++D + +FLGQ+VS EL+S+   D  NGL+GKRSK A
Sbjct  17    EKVKGRVVLMKKNVLDFTDVTASVLDGVLEFLGQRVSFELISTSLHD-ENGLEGKRSKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+HW+   T +A+GESAF + F+W  E+ GVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76    YLEHWLTNITPIAAGESAFSVTFDWDHEELGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPASKY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136   KIHFVCDSWVYPASKYKSDRIFFANQAYLPSETPEALRKYRENELVTLRGDGTGKLEEWD  195

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG PD G EYARP+LGG+SEYPYPRRGRTGR PTKTDPN+ESRIPLL SL
Sbjct  196   RVYDYAYYNDLGYPDNGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNTESRIPLLMSL  255

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+KL+DFLT+ALKS+ Q LLPEF++LFDSTP EFDSF D+L LYEGGIK
Sbjct  256   DIYVPRDERFGHVKLSDFLTFALKSIVQLLLPEFKALFDSTPNEFDSFADVLKLYEGGIK  315

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPLL AI D IPLE+L+EL+++DGEGLFK+PTPQVIQ
Sbjct  316   LPQGPLLKAITDGIPLEILRELLQTDGEGLFKYPTPQVIQ  355



>gb|KCW61797.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=443

 Score =   511 bits (1315),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 288/340 (85%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21    SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81    AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141   QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDK  +YARP+LGG++EYPYPRRGRTGR PTKTDPN+ESR+P+L SL
Sbjct  201   RVYDYAYYNDLGNPDKDPKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTESRVPVLMSL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFL YALK+VAQ L PE ESL+DSTPTEFDSF+D+L LYEGGIK
Sbjct  261   DIYVPRDERFGHLKMSDFLAYALKAVAQLLKPELESLYDSTPTEFDSFKDVLKLYEGGIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL ++ ++IPLEM+KEL+R+DGEGL ++P PQVI+
Sbjct  321   LPS-PLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIK  359



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   525 bits (1352),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 287/341 (84%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSK  298
              KKIKG VVLM+KNVLDFNDFNAS++D + +FLGQ VSL+LVS+V +D   N LKGK  +
Sbjct  2     VKKIKGTVVLMKKNVLDFNDFNASVLDRVHEFLGQGVSLQLVSAVNSDPSENDLKGKLGE  61

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+ W+   T L +GESAFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLEDVP  
Sbjct  62    PAYLEEWITTITSLTAGESAFKVTFDWDEEIGVPGAFLIRNNHHSEFYLKTVTLEDVPGQ  121

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SW+YP  +YNY+R+FF+NQ YLP +TPAPL+KYR+EELV LRG G GELKEW
Sbjct  122   GRVHFVCNSWIYPTKRYNYDRVFFTNQNYLPHETPAPLRKYREEELVKLRGDGKGELKEW  181

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLGDPDKGA+Y RP+LGG+SEYPYPRRGRTGR P K+DPN+ESR+PLL S
Sbjct  182   DRVYDYAYYNDLGDPDKGAKYVRPVLGGSSEYPYPRRGRTGREPAKSDPNTESRLPLLMS  241

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FGHLKLADFL YALKSVAQF+ PE E+L DSTP EFDSF  +L+LYEGG 
Sbjct  242   LNIYVPRDERFGHLKLADFLAYALKSVAQFIKPELEALRDSTPNEFDSFAAVLDLYEGGF  301

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP GPLL  +  NIP+EMLKE+IR+DGEGLF+FP PQVIQ
Sbjct  302   KLPDGPLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQ  342



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   519 bits (1337),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 284/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16    KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76    YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136   IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PD+  +YARP+LGG++EYPYPRRGRTGR P++ DP +ESR+PL+ SL+
Sbjct  196   VYDYAYYNDLGKPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPKTESRLPLVMSLN  255

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D TP EFDSFQD+L+LYEGGIK+
Sbjct  256   IYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGGIKV  315

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  316   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  354



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   523 bits (1346),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 288/340 (85%), Gaps = 0/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK+KG VVLM+KN LDFND NAS +D + +FLG++VSL+L+SSV  D  NGL+GKRSK A
Sbjct  18    KKMKGTVVLMKKNALDFNDVNASFLDGVLEFLGKRVSLQLISSVHGDPANGLQGKRSKPA  77

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++W+   T L +GESAF + F+W ED GVP AFII N H NEF+LK+LTLEDVPNHG+
Sbjct  78    YLENWLTTRTPLVAGESAFDVTFDWDEDIGVPGAFIINNLHFNEFFLKSLTLEDVPNHGK  137

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y  ERIFF+NQAYLP +TP PL++YR++ELV LRG G G+L+EWDR
Sbjct  138   IHFVCNSWVYPAKRYKSERIFFANQAYLPHETPEPLREYREKELVTLRGDGNGKLEEWDR  197

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLGDP++G  YAR ILGG++E+PYPRRGRTGR  TK DP SESRIPLL SLD
Sbjct  198   VYDYAFYNDLGDPERGEAYARTILGGSAEFPYPRRGRTGRKSTKADPKSESRIPLLMSLD  257

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGH+KL+DF TYALKS+ QFL+PEF++LFDSTP EFDSF+D+L LYEGGIKL
Sbjct  258   IYVPRDERFGHIKLSDFPTYALKSIVQFLIPEFQALFDSTPGEFDSFEDVLRLYEGGIKL  317

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             PQGP L A+ D+IPL +LKE+IR+DGEG FKFPTPQVIQ 
Sbjct  318   PQGPFLKALTDSIPLSILKEIIRTDGEGKFKFPTPQVIQA  357



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   522 bits (1344),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 238/339 (70%), Positives = 286/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16    KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76    YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136   IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD+  +YARP+LGG++EYPYPRRGRTGR P++ DPN+ESR+PL+ SL+
Sbjct  196   VYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVMSLN  255

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D TP EFDSFQD+L+LYEGGIK+
Sbjct  256   IYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGGIKV  315

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  316   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  354



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score =   512 bits (1318),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 288/340 (85%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21    SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81    AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141   QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDK  +YARP+LGG++EYPYPRRGRTGR PTKTDPN+ESR+P+L SL
Sbjct  201   RVYDYAYYNDLGNPDKDPKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTESRVPVLMSL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFL YALK+VAQ L PE ESL+DSTPTEFDSF+D+L LYEGGIK
Sbjct  261   DIYVPRDERFGHLKMSDFLAYALKAVAQLLKPELESLYDSTPTEFDSFKDVLKLYEGGIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL ++ ++IPLEM+KEL+R+DGEGL ++P PQVI+
Sbjct  321   LPS-PLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIK  359



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   520 bits (1338),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 285/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16    KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76    YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGCGR  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136   IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD+  +YARP+LGG++EYPYPRRGRTGR P++ DP +ESR+PL+ SL+
Sbjct  196   VYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPKTESRLPLVMSLN  255

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D TP EFDSFQD+L+LYEGGIK+
Sbjct  256   IYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGGIKV  315

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  316   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  354



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   519 bits (1337),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 284/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  16    KKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLVSAVHGDPANGLQGKLGKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  76    YLEDWITTITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR  ELV+LRG GTGELKEWDR
Sbjct  136   IHFVCNSWVYPAKHYKTDRVFFTNQTYLPSETPGPLRKYRKGELVNLRGDGTGELKEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PD+  +YARP+LGG++EYPYPRRGRTGR P++ DP +ESR+PL+ SL+
Sbjct  196   VYDYAYYNDLGKPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPKTESRLPLVMSLN  255

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D TP EFDSFQD+L+LYEGGIK+
Sbjct  256   IYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITPNEFDSFQDVLDLYEGGIKV  315

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  316   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  354



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   518 bits (1333),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 287/349 (82%), Gaps = 1/349 (0%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-N  274
             KL       KKIKG VVLM+KNVL FNDF+ASI+D + + LGQ+VSL+L+S+V +D   N
Sbjct  18    KLKRGDGECKKIKGTVVLMKKNVLSFNDFHASILDRVHELLGQRVSLQLISAVNSDRSEN  77

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
              LKGK  + AYL+ WV   T L +GE+AFK+ F+W E+ GVP AF+I+NNH NEFYL+T+
Sbjct  78    DLKGKLGEPAYLEEWVTTVTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLNEFYLRTV  137

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLE VP HG VHF C SW+YPA +YN +R+FF+NQ +LP +TPAPL+KYR+EELVHLRG 
Sbjct  138   TLEGVPGHGRVHFVCNSWIYPAKRYNKDRVFFTNQTFLPHETPAPLRKYREEELVHLRGN  197

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G GELKEWDRVYDYAYYNDLGDPDKG EY RP+LGG+SEYPYPRRGRTGRA T++DPN+E
Sbjct  198   GEGELKEWDRVYDYAYYNDLGDPDKGPEYVRPVLGGSSEYPYPRRGRTGRAATESDPNTE  257

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR PLL SL+IYVPRDE+FGHLK+ADFL YALKS+AQF+ PE E+L DSTP EFDSF D+
Sbjct  258   SRQPLLMSLNIYVPRDERFGHLKMADFLAYALKSIAQFVKPELEALCDSTPNEFDSFDDV  317

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGG +LP+GPLL  +  NIPLEMLKE+ R+DGE LF+FP PQVIQ
Sbjct  318   LKLYEGGFELPEGPLLDNLRKNIPLEMLKEIFRTDGENLFQFPKPQVIQ  366



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   517 bits (1332),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 243/340 (71%), Positives = 289/340 (85%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK+KG VVLM+KNVLDF D NASIVD + DFLG++VS +L+S+   D  NGL+GK SK A
Sbjct  17    KKVKGTVVLMKKNVLDFTDVNASIVDGVLDFLGRRVSFQLISNSVHD-ANGLEGKLSKPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T + +GES F + FEW  E+FGVP AFIIKN H +EF+LK+LTLEDVPNHG
Sbjct  76    YLENWITNITPVVAGESTFSVTFEWDDEEFGVPGAFIIKNLHFSEFFLKSLTLEDVPNHG  135

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPASKY   RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136   KIHFVCNSWVYPASKYKSNRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEEWD  195

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG EYARP+LGG+SEYPYPRRGRTGR PTKTDPN+ESRIPLL SL
Sbjct  196   RVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGRKPTKTDPNTESRIPLLMSL  255

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K++DFLT+ALKS++Q LLPEF++LFDSTP EFDSF D+L +YEGGIK
Sbjct  256   DIYVPRDERFGHVKMSDFLTFALKSISQLLLPEFKALFDSTPNEFDSFADVLKIYEGGIK  315

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQG    AI D IPLE+LK+L+ +DGEGL K+PTPQVIQ
Sbjct  316   LPQGTSFKAIVDAIPLEILKQLLSTDGEGLLKYPTPQVIQ  355



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   515 bits (1326),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 285/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17    SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +GESA+ + F+W E+FGVP AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77    AYLEKWLTTITPLTAGESAYSVTFDWEEEFGVPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPASKY  +RIFF N+ YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WD
Sbjct  137   KVHFVCNSWVYPASKYKSDRIFFVNKTYLPSETPAPLRKYRENELLTLRGGGTGKLEAWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA+YNDLGDPD+GA++ RPILGG+S+YPYPRRGRTGRAPT+TDP SESRIPLL SL
Sbjct  197   RVYDYAFYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLLSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLKL+DFLTYALKS+ QF+LPE  +LFDSTP EFDSF+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  A+   IPLEM+KEL+R+DGEG+ KFPTP VI+
Sbjct  317   LPQGPLFKALISAIPLEMVKELLRTDGEGIMKFPTPLVIK  356



>ref|XP_010025194.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=871

 Score =   514 bits (1325),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 287/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+K VLDFNDFNAS++DN+ + LG+KVSL LVS V  D  N L+GK  K 
Sbjct  27    SKKVKGTVVLMKKYVLDFNDFNASVLDNVDELLGKKVSLRLVSVVHGDPENCLRGKLGKP  86

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A+L+ W+   T L +G+SAFK+ F W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87    AHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA++Y  +R+FFSN+ YLPSQTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  147   RVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTGELQEWD  206

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG++YARP+LGG+SEYPYPRRGRTGR PT+TDPN+ESR+PLL SL
Sbjct  207   RVYDYAYYNDLGDPDKGSKYARPVLGGSSEYPYPRRGRTGRPPTETDPNTESRLPLLMSL  266

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             + YVPRDE+FGHLK++DFL YALK+V QFL PE ES+FDSTP EFDSFQD+LNLYEGGIK
Sbjct  267   NTYVPRDERFGHLKMSDFLAYALKAVGQFLKPELESIFDSTPNEFDSFQDVLNLYEGGIK  326

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL ++ +NIPLEMLK L R+DGEGL ++P PQVI+
Sbjct  327   LPNCPLLESLKENIPLEMLKILFRTDGEGLLEYPMPQVIK  366



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   514 bits (1323),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 242/341 (71%), Positives = 285/341 (84%), Gaps = 2/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKGKVVLM+KNVLDFNDF  S++D + + LGQKVSL+L+SS+  D  N LKGK  +AA
Sbjct  19    KKIKGKVVLMKKNVLDFNDFGGSVLDRVHELLGQKVSLQLISSINGDPENKLKGKLGRAA  78

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVP-NH  478
             YL+ W+   T L  G+SAF + F+W E+  G+P AFII+N H  EFYLKTLTLEDVP +H
Sbjct  79    YLEDWITTFTSLTPGDSAFHVTFDWEEEEIGIPGAFIIQNFHHTEFYLKTLTLEDVPGHH  138

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G +HF C SWVYPA KY  +R+FF+N+ YLPS+TP PL KYR+EELV+LRG G+G+L+EW
Sbjct  139   GPIHFVCNSWVYPAEKYKTDRVFFTNKTYLPSETPEPLVKYREEELVNLRGNGSGQLEEW  198

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLGDPDKG++YARP+LGG+ EYPYPRRGRTGR PTKTDPNSESRIPLLTS
Sbjct  199   DRVYDYAYYNDLGDPDKGSDYARPVLGGSVEYPYPRRGRTGRPPTKTDPNSESRIPLLTS  258

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIY+PRDE+FGHLK++DFL YALKSV QFLLPEFE L DS   EFDSF+DIL +YEGG 
Sbjct  259   LDIYIPRDERFGHLKMSDFLAYALKSVVQFLLPEFEDLCDSIHNEFDSFEDILQIYEGGF  318

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP+GPLL  I +NIP EMLK L+RSDGEGLFKFP PQVI+
Sbjct  319   KLPEGPLLKNIFENIPFEMLKVLLRSDGEGLFKFPLPQVIK  359



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   512 bits (1319),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 288/340 (85%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+KNVLDFNDFNAS++D + +  GQK+SL+LVS+V  D   GL+GK  K 
Sbjct  21    SKKVKGTVVLMKKNVLDFNDFNASVLDRVHELFGQKISLQLVSAVHGDPEKGLRGKLGKP  80

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SAFK+ F+W E+ GVP A I++N H ++FYLKT+TLEDVP  G
Sbjct  81    AYLEDWITTITPLTAGDSAFKVTFDWDEEVGVPGAIIVQNKHHSQFYLKTVTLEDVPGEG  140

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141   QVHFVCNSWVYPADQYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDK  +YARP+LGG++EYPYPRRGRTGR PTKTDPN+ESR+P+L SL
Sbjct  201   RVYDYAYYNDLGNPDKDPKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTESRVPVLMSL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFL YALK+VAQ L PE ESL+DSTPTEFDSF+D+L LYEGGIK
Sbjct  261   DIYVPRDERFGHLKMSDFLAYALKAVAQLLKPELESLYDSTPTEFDSFKDVLKLYEGGIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL ++ ++IPLEM+KEL+R+DGEGL ++P PQVI+
Sbjct  321   LP-SPLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIK  359



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   511 bits (1316),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 287/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   S+VD + +FLGQKVSL+L+SS   D  N L+GK S  
Sbjct  17    SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFLGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77    AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL+KYR+ EL+ LRG GTG+L+ WD
Sbjct  137   KVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLRKYRENELLTLRGDGTGKLEAWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA+YNDLGDPD+GA++ RPILGG+S+YPYPRRGRTGR PT+TDP SESRIPLL SL
Sbjct  197   RVYDYAFYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRPPTRTDPESESRIPLLLSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLKL+DFLTYALKS+ QF+LPE  +LFDSTP EFDSF+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  A+  +IPLEM+KEL+R+DGEG+ KFPTP VI+
Sbjct  317   LPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIK  356



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   511 bits (1317),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 284/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  32    KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  91

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  92    YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  151

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDR
Sbjct  152   IHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDR  211

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD+  +YARP+LGG++EYPYPRRGRTGR P++ DPN+ESR+PL+ SL+
Sbjct  212   VYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVMSLN  271

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             +YVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D T  EFDSFQD+L+LYEGGIK+
Sbjct  272   MYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITHNEFDSFQDVLDLYEGGIKV  331

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  332   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  370



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   511 bits (1315),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 288/340 (85%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17    EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T + +GES F + F+W +D FGVP AFIIKN H +EF+LK+LTLE VPNHG
Sbjct  76    YLENWITNITPVVAGESTFSVTFDWDDDEFGVPGAFIIKNLHFSEFFLKSLTLEHVPNHG  135

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPASKY  +RIFF+NQAYLPS+TP  L+KYR+ ELV LRG GTG+L+EWD
Sbjct  136   KVHFVCNSWVYPASKYKSDRIFFANQAYLPSETPELLRKYRENELVALRGDGTGKLEEWD  195

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG EYARP+LGG+S+YPYPRRGRTGR PTKTDPN+ESRIPLL SL
Sbjct  196   RVYDYAYYNDLGDPDKGQEYARPVLGGSSQYPYPRRGRTGRKPTKTDPNTESRIPLLMSL  255

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K++DFLT+ALKS++Q LLPEF++LFDSTP EFDSF D+L +YEGGIK
Sbjct  256   DIYVPRDERFGHVKMSDFLTFALKSISQLLLPEFKALFDSTPNEFDSFADVLKIYEGGIK  315

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  AI D IPLE+LK+L+ +DGEGL K+PTPQVIQ
Sbjct  316   LPQGPLFKAIVDAIPLEILKQLLSTDGEGLLKYPTPQVIQ  355



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   511 bits (1317),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 231/339 (68%), Positives = 284/339 (84%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G +VLM+KNVLDFNDFNA + D + +  GQ VSL+LVS+V  D  NGL+GK  K A
Sbjct  57    KKIEGTIVLMKKNVLDFNDFNAPVRDRVHELFGQGVSLQLVSAVHGDPANGLQGKIGKPA  116

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W++  T L +GESAFK+ F+W E+ G P AFII+NNH +EFYL+TLTLEDVP  G 
Sbjct  117   YLEDWIITITSLTAGESAFKVTFDWDEEIGEPGAFIIRNNHHSEFYLRTLTLEDVPGRGR  176

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA  Y  +R+FF+NQ YLPS+TP PL+KYR+ ELV+LRG GTG+LKEWDR
Sbjct  177   IHFVCNSWVYPAQHYKTDRVFFTNQTYLPSETPGPLRKYREGELVNLRGDGTGKLKEWDR  236

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD+  +YARP+LGG++EYPYPRRGRTGR P++ DPN+ESR+PL+ SL+
Sbjct  237   VYDYAYYNDLGNPDRDLKYARPVLGGSAEYPYPRRGRTGRPPSEKDPNTESRLPLVMSLN  296

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             +YVPRDE+FGHLK++DFL YALKS+ QFLLPEFE+L D T  EFDSFQD+L+LYEGGIK+
Sbjct  297   MYVPRDERFGHLKMSDFLAYALKSIVQFLLPEFEALCDITHNEFDSFQDVLDLYEGGIKV  356

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+GPLL  I DNIPLEMLKEL+R+DGE LFKFP PQVI+
Sbjct  357   PEGPLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIK  395



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   510 bits (1313),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 230/340 (68%), Positives = 287/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+ G VVLM+K VLDFNDFNAS++D + + LG+KVSL LVS+V +D  NGL+GK  K 
Sbjct  27    SKKVIGTVVLMKKYVLDFNDFNASVLDTIHELLGEKVSLRLVSAVHSDPENGLQGKLGKP  86

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SAFK+ F+W ++ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87    AYLEKWITTITPLTAGDSAFKVTFDWDKEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA +Y  +R+FFSN+ YLP +TPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  147   RVHFVCNSWVYPADRYKKDRVFFSNKTYLPRETPAPLVKYREEELVNLRGDGTGELQEWD  206

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG +YARP+LGG++EYPYPRRGRTGR P++TDPN+ESR+PLL SL
Sbjct  207   RVYDYAYYNDLGDPDKGTKYARPVLGGSAEYPYPRRGRTGRPPSETDPNTESRLPLLMSL  266

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             + YVPRDE+FGHLK++DFL YA+K+V QFL PE ES+ DSTP EFD FQD+LNLYEGGIK
Sbjct  267   NTYVPRDERFGHLKMSDFLAYAVKAVGQFLKPELESICDSTPNEFDYFQDVLNLYEGGIK  326

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP GPLL ++ ++IPLEMLKEL+R+DGEGL ++P PQVI+
Sbjct  327   LPDGPLLESLKEHIPLEMLKELVRTDGEGLLEYPMPQVIK  366



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   508 bits (1308),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 282/349 (81%), Gaps = 2/349 (1%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             GK  EA    KKIKG VVLM+KNVLDF DFNASI D + + LG+KVSL+LVSSV  D   
Sbjct  6     GKHGEA--NKKKIKGTVVLMKKNVLDFTDFNASIADEVHELLGKKVSLQLVSSVNGDPEK  63

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             G +GK    AYL+ W+  N  L  GES F I F+W E+  VP AFIIKN+H +EF+LKT+
Sbjct  64    GQQGKLGSPAYLEGWITTNHRLTVGESVFNITFDWEEEVEVPGAFIIKNHHHSEFFLKTV  123

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVP HG +HF C SWVYPA KYN  RIFFSNQAYLPS TP PL++YR+EEL+ LRG 
Sbjct  124   TLEDVPGHGRIHFVCNSWVYPAKKYNQNRIFFSNQAYLPSDTPEPLRRYREEELLTLRGD  183

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTGEL+EWDRVYDYAYYNDL DPDKG++Y RP+LGG++EYPYPRRGRTGR PTKTDPN+E
Sbjct  184   GTGELQEWDRVYDYAYYNDLADPDKGSDYERPVLGGSTEYPYPRRGRTGRPPTKTDPNAE  243

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+L+SL+IYVPRDE+FGHLK++DFL +ALKS+ Q L+PEFE+L D TP EFDS +D 
Sbjct  244   SRLPILSSLNIYVPRDERFGHLKMSDFLAFALKSIVQLLVPEFEALCDRTPDEFDSIEDT  303

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGIKLP GPLL  I DNIPLE+LK+L++SDGE   K+PTPQVI+
Sbjct  304   LKLYEGGIKLPDGPLLKNIVDNIPLELLKQLLQSDGEEFLKYPTPQVIK  352



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   508 bits (1308),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 233/340 (69%), Positives = 285/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   S+VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17    SKKVKGIVVMMKKNALDFTDIAGSVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNL  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77    AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WD
Sbjct  137   TVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEAWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA YNDLGDPD+GA++ RPILGG+S+YPYPRRGRTGRAPT+TDP SESRIPLL SL
Sbjct  197   RVYDYALYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLLSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLKL+DFLTYALKS+ QF+LPE  +LFDSTP EFDSF+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  A+  +IPLEM+KEL+R+DGEG+ KFPTP VI+
Sbjct  317   LPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIK  356



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   506 bits (1304),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 285/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   ++VD + +F+GQKVSL+L+SS   D  N L+GK S  
Sbjct  17    SKKVKGIVVMMKKNALDFTDIAGAVVDGVLEFVGQKVSLQLISSAHGDPANDLQGKHSNP  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL++W+   T L +GESA+ + F+W E+FG+P AFIIKN H  EF+LK++TLEDVPNHG
Sbjct  77    AYLENWLTTITPLTAGESAYGVTFDWDEEFGLPGAFIIKNLHFTEFFLKSVTLEDVPNHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA+KY  +RIFF+N+ YLPS+TPAPL KYR+ EL+ LRG GTG+L+ WD
Sbjct  137   TVHFVCNSWVYPANKYKSDRIFFANKTYLPSETPAPLLKYRENELLTLRGDGTGKLEAWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA YNDLGDPD+GA++ RPILGG+S+YPYPRRGRTGRAPT+TDP SESRIPLL SL
Sbjct  197   RVYDYALYNDLGDPDQGAQHVRPILGGSSDYPYPRRGRTGRAPTRTDPESESRIPLLLSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLKL+DFLTYALKS+ QF+LPE  +LFDSTP EFDSF+D+L LYEGGIK
Sbjct  257   DIYVPRDERFGHLKLSDFLTYALKSMVQFILPELHALFDSTPNEFDSFEDVLRLYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  A+  +IPLEM+KEL+R+DGEG+ KFPTP VI+
Sbjct  317   LPQGPLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIK  356



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   506 bits (1304),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 282/340 (83%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKA  301
             KKIKG VVLM+KNVLDFNDFNASI+D + + LGQKVSL+L+S+V ADL   GLKGK  K 
Sbjct  17    KKIKGTVVLMKKNVLDFNDFNASILDRVHELLGQKVSLQLISAVNADLTVKGLKGKLGKP  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SA+ + F+W E+ GVP AFII+N H +EFYLK+LTL+ VP HG
Sbjct  77    AYLEDWITTITPLTAGDSAYDVTFDWDEEIGVPGAFIIRNFHHSEFYLKSLTLDHVPGHG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA  Y  +R+FFSNQ YL S+TPAPL +YR +ELV+LRG G G+L+EWD
Sbjct  137   RVHFVCNSWVYPAKNYKTDRVFFSNQTYLLSETPAPLIEYRKQELVNLRGDGKGKLEEWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG++YARPILGG++EYPYPRRGRTGR PTKTDP SESR+ LL S 
Sbjct  197   RVYDYAYYNDLGDPDKGSKYARPILGGSTEYPYPRRGRTGRPPTKTDPESESRLALLMSF  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLK++DFL YALKSV QFL+PE  +L D TP EFDSFQDIL +YEGGIK
Sbjct  257   NIYVPRDERFGHLKMSDFLAYALKSVVQFLVPELGALCDKTPNEFDSFQDILKIYEGGIK  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+GPLL  I +NIPLEMLKEL+R+DGEG  KFP PQVI+
Sbjct  317   LPEGPLLDKIKENIPLEMLKELVRTDGEGYLKFPMPQVIK  356



>ref|XP_010025193.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61802.1| hypothetical protein EUGRSUZ_H04499 [Eucalyptus grandis]
Length=871

 Score =   506 bits (1303),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 229/340 (67%), Positives = 284/340 (84%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+K VLDFNDFNAS++DN+++ LG+KVSL LVS+V  D   GL+GK  K 
Sbjct  27    SKKVKGTVVLMKKYVLDFNDFNASVLDNVAELLGKKVSLRLVSAVHGDPEKGLRGKLGKP  86

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T LA+G+SAFK+ F+W E+ GVP A I++NNH ++FYLKT+TLEDVP  G
Sbjct  87    AYLEEWITTITPLAAGDSAFKVTFDWDEEVGVPGAIIVQNNHHSQFYLKTITLEDVPGEG  146

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA++Y  +R+FFSN+ YLPSQTPAPL KYR+EELV+LRG GT EL+EWD
Sbjct  147   RVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRGDGTAELQEWD  206

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDK  +YARP+LGG++EYPYPRRGRT R PT+TDP +ESR+PLL SL
Sbjct  207   RVYDYAYYNDLGDPDKDPKYARPVLGGSAEYPYPRRGRTSRPPTETDPTTESRLPLLMSL  266

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             ++YVPRDE+ GHLK++DF+ Y LK+V QFL PE ES+ DS P EFDSFQD+LNLYEGGIK
Sbjct  267   NVYVPRDERLGHLKMSDFVAYTLKAVGQFLKPELESICDSMPNEFDSFQDVLNLYEGGIK  326

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL ++ +NIPLEMLK L+R+DGEGL ++P PQVI+
Sbjct  327   LPDSPLLESLKENIPLEMLKILVRTDGEGLLEYPMPQVIK  366



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   505 bits (1300),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 236/339 (70%), Positives = 283/339 (83%), Gaps = 2/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  304
             KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V+AD   NGLKGK  K A
Sbjct  20    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVRADDSENGLKGKLGKPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80    YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGH  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EW+R
Sbjct  140   VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLQKYREEELVHLRGDGKGELQEWER  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PDKGA+Y RP+LGG+SEYPYPRRGRTGR PTKTDPNSES +PL+ SLD
Sbjct  200   VYDYAYYNDLGKPDKGAKYVRPVLGGSSEYPYPRRGRTGRPPTKTDPNSESSLPLIQSLD  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL YALKS+AQF+ PE ESLFD TP+EFDSF+D+L LYEGGI L
Sbjct  260   IYVPRDERFGHLKLSDFLIYALKSIAQFIKPELESLFDQTPSEFDSFEDVLKLYEGGIPL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+DG  L KFPTPQVI+
Sbjct  320   PEG-LLKDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIK  357



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   503 bits (1296),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/354 (67%), Positives = 292/354 (82%), Gaps = 5/354 (1%)
 Frame = +2

Query  95    GKLAEAL---SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQA  262
             G++ +A+   +  K +KG+++LM+K  LDF D NAS+ D + DFLG+KVS++L+S S+  
Sbjct  4     GEIVDAIIGNTDGKNVKGRIILMKKIFLDFTDINASVGDEVVDFLGEKVSIQLISGSIHD  63

Query  263   DLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEF  439
             D  NG++GKRS  AYL+ W+   T + +GES F + F+W  ++FGVP AFII N H NEF
Sbjct  64    DPENGVEGKRSNPAYLEDWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIINNFHLNEF  123

Query  440   YLKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELV  619
             +LK+LTLEDVPN G +HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV
Sbjct  124   FLKSLTLEDVPNRGNIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPEPLRKYRENELV  183

Query  620   HLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKT  799
              LRG GTG+L+EWDRVYDYAYYNDLGDPDKG EYARPILGG+SEYPYPRRGRTGR PTKT
Sbjct  184   TLRGDGTGKLEEWDRVYDYAYYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGRKPTKT  243

Query  800   DPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFD  979
             DPNSE+RIPLL SLDIYVPRDE+FGHLK++DFLT++LK   Q L P F++LFD+TP EFD
Sbjct  244   DPNSENRIPLLMSLDIYVPRDERFGHLKMSDFLTFSLKFTVQSLFPAFKALFDNTPNEFD  303

Query  980   SFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             SF+D+L LYEGGIKLPQGPLL A+ D+IPLE+LK++  SDGEGLFKFPTPQVIQ
Sbjct  304   SFEDVLELYEGGIKLPQGPLLKALIDSIPLEILKDVFHSDGEGLFKFPTPQVIQ  357



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   501 bits (1291),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 232/345 (67%), Positives = 286/345 (83%), Gaps = 2/345 (1%)
 Frame = +2

Query  110   ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKG  286
             A    +KI+G VVLM+KNVLDFNDFNAS++D + + LGQKVSL+L+S+V AD   NGL+G
Sbjct  25    AAEKCRKIEGSVVLMKKNVLDFNDFNASVLDRVHELLGQKVSLQLISAVNADPSANGLQG  84

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K    AYL+HW+   T L +GESAFK+ F+W ED  +P AF+I+NNH +EFYLK+LTLED
Sbjct  85    KLGNLAYLEHWISTITPLIAGESAFKVTFDWDEDIAIPGAFLIRNNHHSEFYLKSLTLED  144

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  646
             VP  G +HF C SWVYPA +Y  +R+FFSN+ +LP++TP PL KYR+EELV+LRG GTGE
Sbjct  145   VPGQGRIHFVCNSWVYPADQYKKDRVFFSNKTFLPNETPGPLLKYREEELVNLRGDGTGE  204

Query  647   LKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIP  826
             L+EWDRVYDYAYYNDLG+PDKG +Y RP+LGG+SEYPYPRRGRTGR P++TDPNSESR+ 
Sbjct  205   LQEWDRVYDYAYYNDLGNPDKGPKYVRPVLGGSSEYPYPRRGRTGRPPSETDPNSESRMK  264

Query  827   LLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLY  1006
             LL SL+IYVPRDE+FGHLK++DFL YALK+VAQFL PE ESLFDSTP+EFDS QD+L LY
Sbjct  265   LLKSLNIYVPRDERFGHLKMSDFLAYALKAVAQFLKPELESLFDSTPSEFDSIQDVLKLY  324

Query  1007  EGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             EGG+KLP G LL  I ++IP EMLKE+  ++GEGL K+P PQVI+
Sbjct  325   EGGVKLPDG-LLQNIREDIPAEMLKEIFPTEGEGLLKYPMPQVIK  368



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   501 bits (1290),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 281/340 (83%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +K+KG VVLM+KNVLDF D  ASIVD   +FLG++VS +L+S+   D  NGL+GK S  A
Sbjct  17    EKVKGTVVLMKKNVLDFTDVTASIVDGALEFLGRRVSFQLISNSVHD-ANGLEGKLSNPA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  76    YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  135

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  136   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  195

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG EYARP+LGG+SEYPYPRRGRTGR PTKTDPN ESRIPL    
Sbjct  196   RVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFMGS  255

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFLT  LKS+AQ  LP F++LFD+TP EFDSF+D+L LYEGG+K
Sbjct  256   DIYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGGVK  315

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+GPLL AI D IPLE+LK++  SDGEGLFKFPTPQVIQ
Sbjct  316   LPEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQ  355



>ref|XP_012089053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Jatropha curcas]
 gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   499 bits (1285),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 230/340 (68%), Positives = 276/340 (81%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
              KKI G VVLM+KNVLDFNDF+AS++D + +  G  VSL+L+SSV ++  NGL+GK  + 
Sbjct  26    CKKITGSVVLMKKNVLDFNDFHASLLDRVHELFGHGVSLQLISSVTSESENGLQGKVGEP  85

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+     L  G+SAFK+ F+W+E+ G+P AFIIKNNH +EFYLKTLTLEDVP  G
Sbjct  86    AYLEDWITTIAPLTPGDSAFKVTFDWNEEIGIPGAFIIKNNHHSEFYLKTLTLEDVPGQG  145

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              +HF C SWVYPA  Y  +RIFF+N+ +LP +TP PL+KYR+EEL +LRG G GEL+EWD
Sbjct  146   RIHFVCNSWVYPAKHYKKDRIFFANKTFLPHETPMPLRKYREEELENLRGDGKGELQEWD  205

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDP KG +Y RPILGG+SEYPYPRRGRTGRAP ++DPN ESR+ LL SL
Sbjct  206   RVYDYAYYNDLGDPKKGPKYVRPILGGSSEYPYPRRGRTGRAPAESDPNYESRLSLLMSL  265

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLK++DFL YALKS+AQFL PE E+LFDSTP EFDSF DIL LYEGGIK
Sbjct  266   NIYVPRDERFGHLKMSDFLAYALKSIAQFLKPELEALFDSTPNEFDSFDDILKLYEGGIK  325

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP GPLL  +  NIP EMLKE+ R+DGE LFKFP PQVI+
Sbjct  326   LPDGPLLDNVMKNIPFEMLKEIFRTDGERLFKFPMPQVIK  365



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   497 bits (1280),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 233/339 (69%), Positives = 280/339 (83%), Gaps = 2/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAA  304
             KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD   NGLKGK  + A
Sbjct  20    KINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHADDSENGLKGKLGQPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  80    YLEDWITTITPLTAGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP  KY  +R+FF N+ YLPS+TP PL+KY +EELVHLRG G GEL+EW+R
Sbjct  140   VHFVCNSWVYPTEKYTKDRVFFVNKTYLPSETPLPLRKYIEEELVHLRGDGKGELQEWER  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PDKGA+Y RPILGG+SEYPYPRRGRTGR PTKTDPNSES +PL+ SL+
Sbjct  200   VYDYAYYNDLGKPDKGAKYVRPILGGSSEYPYPRRGRTGRPPTKTDPNSESSLPLIQSLN  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL YALKS+AQF+ PE ESLFD TP+EFDSF+D+  LYEGGI L
Sbjct  260   IYVPRDERFGHLKLSDFLIYALKSIAQFIKPELESLFDQTPSEFDSFEDVFKLYEGGIPL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+DG  L KFPTPQVI+
Sbjct  320   PEG-LLKDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIK  357



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   497 bits (1279),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 230/340 (68%), Positives = 276/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + 
Sbjct  19    SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79    AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139   RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDKG +YARP LGG+SEYPYPRRGRTGR PTKTD NSESRIPLL SL
Sbjct  199   RVYDYAYYNDLGNPDKGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLMSL  258

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP EFDS +D+L LYEGGI 
Sbjct  259   NIYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSLEDVLKLYEGGIP  318

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  319   LPEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  357



>emb|CAA64767.1| lipoxygenase [Solanum tuberosum]
Length=454

 Score =   482 bits (1240),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 223/350 (64%), Positives = 279/350 (80%), Gaps = 1/350 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G L      +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ D  N
Sbjct  7     GGLIGGHHDSKKVKGTVVMMKKNALDFTDLAGSLTDKMFEVLGQKVSFQLISSVQGDPTN  66

Query  275   GLKGKRSKAAYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKT  451
             GL+GK+S  AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+
Sbjct  67    GLQGKQSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKS  126

Query  452   LTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG  631
             LTLEDVPNHG+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG
Sbjct  127   LTLEDVPNHGKVHFVCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYRENELLTLRG  186

Query  632   TGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNS  811
              GTG+ + WDR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP S
Sbjct  187   DGTGKREAWDRIYDYDIYNDLGNPDEGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKS  246

Query  812   ESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQD  991
             ESRIPL+ SLDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D
Sbjct  247   ESRIPLILSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFED  306

Query  992   ILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +L LYEGGIKLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  307   VLRLYEGGIKLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   496 bits (1276),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 228/339 (67%), Positives = 276/339 (81%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  N  KGK  + A
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENRFKGKLGEPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80    YLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREGR  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PDKG++YARP LGG+SEYPYPRRGRTGR PTKTDPNSESRIPL+ SL+
Sbjct  200   VYDYAYYNDLGNPDKGSKYARPTLGGSSEYPYPRRGRTGRPPTKTDPNSESRIPLIMSLN  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             +YVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP EFDSF+D+L LY GGI L
Sbjct  260   VYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  320   PEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  357



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   495 bits (1274),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 229/340 (67%), Positives = 276/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             ++KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + 
Sbjct  19    SRKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79    AYLEDWITTITPLTIGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139   RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDKG +YARP LGG+SEYPYPRRGRTGR PTKTD NSESRIPLL SL
Sbjct  199   RVYDYAYYNDLGNPDKGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLMSL  258

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP EFDS +D+L LY+GGI 
Sbjct  259   NIYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSLEDVLKLYKGGIP  318

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  319   LPEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  357



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =   494 bits (1272),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 277/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             ++KIKG +VLM+KNVLDFNDFNAS++D + + LGQ+VSL+L+S+   D  NG KGK  + 
Sbjct  19    SRKIKGTLVLMKKNVLDFNDFNASVLDGVHELLGQRVSLQLISADHGDSENGFKGKLGEP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  79    AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  139   RVHFVCNSWVYPAEKYTKDRVFFLNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PD G +YARP LGG+SEYPYPRRGRTGR PTKTD NSESRIPLL SL
Sbjct  199   RVYDYAYYNDLGNPDMGPKYARPTLGGSSEYPYPRRGRTGRPPTKTDSNSESRIPLLLSL  258

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP+EFDS +D+L LYEGGI 
Sbjct  259   NIYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPSEFDSLEDVLKLYEGGIP  318

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  319   LPEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  357



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   494 bits (1273),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 287/341 (84%), Gaps = 5/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKA  301
             +K+KG+V+LM+KNVLDF D +AS+VD ++D LGQKVS++L+S SV AD   GL+GKRSK 
Sbjct  17    EKVKGRVILMKKNVLDFTDISASVVDGVADLLGQKVSIQLISGSVNAD---GLEGKRSKP  73

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL+ W+   T + +GES F + F+W  ++FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  74    AYLESWLTHITPIIAGESTFSVTFDWDHKEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNH  133

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G +HF C SWVYP+ +Y  +RIFF+NQAYLPS+TP PL+ YR+ ELV LRG GTG+L+EW
Sbjct  134   GNIHFVCNSWVYPSFRYKSDRIFFANQAYLPSETPEPLRNYRENELVVLRGDGTGKLEEW  193

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYA YNDLGDPDKG EYARPILGG+SEYPYPRRGRTGR PT+TDPN ESR PLL +
Sbjct  194   DRVYDYACYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGREPTRTDPNCESRNPLLMT  253

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGH+K +DFLT++LKS+ Q LLP F++L D+TP EFDSF D+LNLYEGGI
Sbjct  254   LDIYVPRDERFGHVKNSDFLTFSLKSILQTLLPAFKALLDNTPNEFDSFADVLNLYEGGI  313

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP+GPLL  I D+IP E+LK+++++DG+GL K+P P+VIQ
Sbjct  314   KLPEGPLLKTITDSIPSEILKDILQTDGQGLLKYPIPRVIQ  354



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   493 bits (1270),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 275/331 (83%), Gaps = 1/331 (0%)
 Frame = +2

Query  152   MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAAYLDHWVLK  328
             M+KNVL FNDF+AS++D + + LGQ+VSL+L+S+V +D   N LKGK  + AYL+ WV  
Sbjct  1     MKKNVLGFNDFHASVLDRVHELLGQRVSLQLISAVNSDRSDNDLKGKLGEPAYLEEWVTT  60

Query  329   NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  508
              T L +GE+AFK+ F+W E+ GVP AF+I+NNH +EFYLKT+TLE VP HG VHF C SW
Sbjct  61    VTPLTAGEAAFKVTFDWDEEIGVPGAFLIRNNHLSEFYLKTVTLEGVPGHGRVHFVCNSW  120

Query  509   VYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYN  688
             +Y A +YN +R+FF+NQ ++P +TP PL+KYR+EELVHLRG G GELKEWDRVYDYAYYN
Sbjct  121   IYHAKRYNKDRVFFTNQTFMPHETPTPLRKYREEELVHLRGNGEGELKEWDRVYDYAYYN  180

Query  689   DLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEK  868
             DLGDPDKG +Y RP+LGG+SEYPYPRRGRTGRA T++DPN+ESR PLL SL+IYVPRDE+
Sbjct  181   DLGDPDKGPKYVRPVLGGSSEYPYPRRGRTGRAATESDPNTESRQPLLMSLNIYVPRDER  240

Query  869   FGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTA  1048
             FGHLK+ADFL YALKS+AQF+ PE E+L DSTP EFDSF D+L LYEGG +LP+GPLL  
Sbjct  241   FGHLKMADFLAYALKSIAQFVKPELEALCDSTPNEFDSFDDVLKLYEGGFELPEGPLLDN  300

Query  1049  IADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +  NIPLEMLKE+ R+DGE LFKFP PQVIQ
Sbjct  301   LRKNIPLEMLKEIFRTDGENLFKFPKPQVIQ  331



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   496 bits (1276),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 278/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             ++KIKG VVL++KNVLDFND NAS++D + + LGQ+VSL+L+S+   D  NG KGK  + 
Sbjct  72    SRKIKGTVVLIKKNVLDFNDINASVLDRVHELLGQRVSLQLISADHGDSENGFKGKLGEP  131

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L  G+SA+K+ F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G
Sbjct  132   AYLEDWITTITPLTVGDSAYKVTFDWEEEIGVPGAILIKNNHHSEFFLKTITLEDVPREG  191

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWD
Sbjct  192   RVHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWD  251

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDKG++YARP LGG+SEYPYPRRGRTGR PTKTDPN+ESRIPLL SL
Sbjct  252   RVYDYAYYNDLGNPDKGSKYARPSLGGSSEYPYPRRGRTGRPPTKTDPNTESRIPLLMSL  311

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP EFDSF+D+L LY GGI 
Sbjct  312   NIYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIP  371

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  372   LPEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  410



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score =   484 bits (1245),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   493 bits (1270),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 280/340 (82%), Gaps = 5/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11    KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFDD----RGKLSNPA  66

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  67    YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  126

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  127   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  186

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG EYARP+LGG+SEYPYPRRGRTGR PTKTDPN ESRIPL    
Sbjct  187   RVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFMGS  246

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFLT  LKS+AQ  LP F++LFD+TP EFDSF+D+L LYEGG+K
Sbjct  247   DIYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGGVK  306

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+GPLL AI D IPLE+LK++  SDGEGLFKFPTPQVIQ
Sbjct  307   LPEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQ  346



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   493 bits (1269),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 231/340 (68%), Positives = 280/340 (82%), Gaps = 4/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             K++KGKVVLM+KNVLDF    A++VD++++ LG+KVS +L+SS   D     +GK S  A
Sbjct  11    KRVKGKVVLMKKNVLDFTGIMAAVVDDVAELLGEKVSFQLISSSVFD---DREGKLSNPA  67

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSE-DFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T + +GES F + F+W   +FGVP AFIIKN H NEF+LK+LTLEDVPNHG
Sbjct  68    YLENWITNITPIIAGESTFSVTFDWDRNEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNHG  127

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ EL  LRG GTG+L+EWD
Sbjct  128   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELETLRGDGTGKLEEWD  187

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLGDPDKG EYARP+LGG+SEYPYPRRGRTGR PTKTDPN ESRIPL    
Sbjct  188   RVYDYAYYNDLGDPDKGEEYARPVLGGSSEYPYPRRGRTGREPTKTDPNCESRIPLFMGS  247

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFLT  LKS+AQ  LP F++LFD+TP EFDSF+D+L LYEGG+K
Sbjct  248   DIYVPRDERFGHLKMSDFLTVYLKSIAQSFLPAFKALFDNTPNEFDSFEDVLKLYEGGVK  307

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+GPLL AI D IPLE+LK++  SDGEGLFKFPTPQVIQ
Sbjct  308   LPEGPLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQ  347



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 280/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             TK+I G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V AD  NGLKGK  K 
Sbjct  19    TKQITGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVNADSDNGLKGKLGKP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +G+SA+K+ F+W ++ GVP A +IKNNH ++FYLKT+TLE+VP  G
Sbjct  79    AYLEDWISTITPLTAGDSAYKVTFDWDDEIGVPGAILIKNNHHSQFYLKTITLENVPGEG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA K   +RIFF N+ YL S TP PL++YR EELVHLRG G GEL+E+D
Sbjct  139   TVHFVCNSWVYPAEKNTKDRIFFVNKTYLLSDTPLPLQQYRKEELVHLRGDGKGELQEYD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDKG++YAR  LGG SEYPYPRRGRTGRAPT++DP+SESRIPLL SL
Sbjct  199   RVYDYAYYNDLGNPDKGSDYARQTLGGTSEYPYPRRGRTGRAPTESDPSSESRIPLLMSL  258

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+L LYEGGI+
Sbjct  259   DIYVPRDERFGHLKMSDFLAYALKSIAQFIRPELEALFDPTPNEFDSFEDVLKLYEGGIE  318

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +P+G  L  I DNIPLEM+KE+ R+DG    KFPTPQVI+
Sbjct  319   VPEG-FLKDIGDNIPLEMIKEIFRTDGAQFLKFPTPQVIK  357



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 274/345 (79%), Gaps = 0/345 (0%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E  S + KIKG VVLM+KNVLDFNDF AS++D + + LG++VSL+L+S+ + D  NGL+G
Sbjct  17    EMESSSGKIKGTVVLMKKNVLDFNDFQASVLDGVHELLGKRVSLQLISAEKGDAANGLQG  76

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K  K AYLD+W L +    +GES F + F+W E+ G P   +IKNNH +EFYLKT++LE 
Sbjct  77    KLGKPAYLDNWTLTDASPVAGESKFSVNFDWDEEIGTPGGLLIKNNHHSEFYLKTVSLEH  136

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  646
             VP+HG VHF C SWVYP  KY  +RIFFSN+ YLP + P PL+KYR+EEL  LRG G GE
Sbjct  137   VPDHGPVHFVCNSWVYPGKKYEKDRIFFSNKTYLPHEMPEPLRKYREEELRALRGNGEGE  196

Query  647   LKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIP  826
             L+EWDRVYDYAYYNDLG+PDKG EYARP+LGG+++YPYPRRGRTGR P KTDPN+ESRIP
Sbjct  197   LQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSAQYPYPRRGRTGRPPAKTDPNTESRIP  256

Query  827   LLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLY  1006
             LL SL+IYVPRDE+FGHLKL+DFL YALKSV QF++PE E L D T  EFDSF+D+ +LY
Sbjct  257   LLMSLNIYVPRDERFGHLKLSDFLAYALKSVVQFIVPELEDLTDRTRNEFDSFKDVDDLY  316

Query  1007  EGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              GG+KLP GPLL  I  NIPLEMLKE+ R+DGE L KFP PQVIQ
Sbjct  317   YGGVKLPSGPLLDNIIKNIPLEMLKEIFRTDGEQLLKFPVPQVIQ  361



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 281/349 (81%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VPN G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPNEGRVHFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G  +L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKRKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I DNIP EMLKE+ R+DG    +FPTP+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDNIPAEMLKEIFRTDGAQFLRFPTPEVIK  358



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   493 bits (1268),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 283/349 (81%), Gaps = 0/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G L      +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  N
Sbjct  7     GGLIGGHHDSKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPAN  66

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GL+GK S  AYL++++L  T LA+GE+AF + F+W+E+FGVP AF+IKN H NEF+LK+L
Sbjct  67    GLQGKHSNPAYLENFLLTLTPLAAGETAFGVTFDWNEEFGVPGAFVIKNMHINEFFLKSL  126

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVPNHG+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ ELV LRG 
Sbjct  127   TLEDVPNHGKVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELVTLRGD  186

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTG+ + WDR+YDY  YNDLG+PD+G E  R  LGG+++YPYPRRGRTGR PT+TDP SE
Sbjct  187   GTGKREAWDRIYDYDVYNDLGNPDQGKENVRTTLGGSADYPYPRRGRTGRPPTRTDPKSE  246

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SRIPL+ SLDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+
Sbjct  247   SRIPLILSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDV  306

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGIKLPQGPL  A+ D IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  307   LRLYEGGIKLPQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIK  355



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score =   484 bits (1247),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score =   484 bits (1247),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   492 bits (1266),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 279/340 (82%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   S+ D L + LGQKVSL+L+SSVQ D  NGL+GK S  
Sbjct  15    SKKVKGTVVMMKKNALDFTDLAGSLTDKLFEALGQKVSLQLISSVQGDPANGLQGKHSNP  74

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL++++   T L +GESAF + F+W+E+FGVP AF IKN+H NEF+LK+L LEDVPNHG
Sbjct  75    AYLENFLFTPTRLTAGESAFGVTFDWNEEFGVPGAFTIKNSHINEFFLKSLILEDVPNHG  134

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP PL+KYR+ EL  LRG GTG+L+ W+
Sbjct  135   KVHFVCNSWVYPSFRYKTDRIFFANQPYLPSETPEPLRKYRESELKTLRGDGTGKLEAWN  194

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY  YNDLG+PD+G E+ R  LGG+++YPYPRRGRT R PT+TDP SESRIPLL SL
Sbjct  195   RVYDYDVYNDLGNPDQGPEHVRTTLGGSADYPYPRRGRTSRPPTRTDPKSESRIPLLLSL  254

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLKL+DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGIK
Sbjct  255   DIYVPRDERFGHLKLSDFLTYALKSLVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIK  314

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LPQGPL  A+ D IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  315   LPQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIK  354



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score =   484 bits (1247),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   492 bits (1266),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 278/340 (82%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             K IKG VVLM+KNVLDFNDF+ASI+D + + LGQ+VSL+L+S+V AD  NGLKG   KAA
Sbjct  21    KIIKGSVVLMKKNVLDFNDFHASILDRVHELLGQRVSLQLISAVNADRANGLKGMLGKAA  80

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+     L  G+SAFK+ FEW ++ GVP AF+I+NNH +EFYLKTLTLEDVP  G 
Sbjct  81    YLEDWITTIAPLTPGDSAFKVSFEWEDEIGVPGAFLIRNNHHSEFYLKTLTLEDVPGEGR  140

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYPASKY  +R+FFSN+ Y PS+TP+ L KYR+EEL  LRG G GELKEWDR
Sbjct  141   VHFVCNSWVYPASKYQTDRVFFSNKTYFPSETPSSLIKYREEELEILRGNGKGELKEWDR  200

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD G EYARP+LGG++EYPYPRRGRTGR PTKTDP +ESR+ +L SL+
Sbjct  201   VYDYAYYNDLGNPDDGQEYARPVLGGSTEYPYPRRGRTGRPPTKTDPKTESRLGILMSLN  260

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL +ALKSVAQ + PE ES+FD TP+EFDSFQD++++YEGGIKL
Sbjct  261   IYVPRDERFGHLKLSDFLAFALKSVAQVITPELESVFDKTPSEFDSFQDVMDIYEGGIKL  320

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P+  LL  I + IP E+LKE+ R+DG  L K+P PQV++G
Sbjct  321   PED-LLKHIREKIPAELLKEIFRTDGAQLLKYPLPQVVKG  359



>ref|XP_010256003.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256004.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
 ref|XP_010256005.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nelumbo nucifera]
Length=874

 Score =   491 bits (1264),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 228/348 (66%), Positives = 279/348 (80%), Gaps = 1/348 (0%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             KL + +    KI+G VVLM+KN+LDFND +AS++D   + LG+ V+L+L+SSV AD  NG
Sbjct  17    KLNDEMGGKTKIRGTVVLMKKNLLDFNDLHASVLDRFDELLGEGVALQLISSVNADPVNG  76

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  457
             ++GK  KAAYL+ W+   T L +G S+FK+ F+W  D GVP AFIIKN H +EF+LKT+T
Sbjct  77    MRGKVGKAAYLEEWITTVTPLTAGASSFKVTFDWDADIGVPGAFIIKNFHHSEFFLKTVT  136

Query  458   LEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG  637
             LEDVP  G +HF C SW+YPA +Y  +R+FF+NQ+YLP++TP PL+KYR+EELV+LRG G
Sbjct  137   LEDVPGVGRLHFLCNSWIYPAKRYKNDRVFFTNQSYLPAKTPEPLRKYREEELVNLRGDG  196

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
             T EL+EWDRVYDYAYYNDLGDPDKG EYARPILGG++EYPYPRRGRTGR PT TDPNSES
Sbjct  197   TEELQEWDRVYDYAYYNDLGDPDKGPEYARPILGGSTEYPYPRRGRTGRKPTMTDPNSES  256

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
             R+P L SLDIYVPRDE+FGHLK++DFL YALKS+ QFLLPE ++L D TP EFD+FQD+ 
Sbjct  257   RLPPLPSLDIYVPRDERFGHLKMSDFLAYALKSLVQFLLPELKALCDKTPNEFDTFQDVF  316

Query  998   NLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             NLYEGG +LP G     + D IP EMLKEL R+DGE L KFP PQVIQ
Sbjct  317   NLYEGGTQLPSGA-FDRLKDAIPFEMLKELFRTDGEQLLKFPLPQVIQ  363



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   490 bits (1262),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 281/349 (81%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKGK  K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGKLGKQAYLEDWISTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G  +L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKRKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFEDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I DNIP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDNIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   490 bits (1262),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/338 (68%), Positives = 275/338 (81%), Gaps = 1/338 (0%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             IKG+VVLM+KNVLDFND  AS++D   + +G KVSL+L+SSV  D  N +KGK  KAAYL
Sbjct  25    IKGRVVLMKKNVLDFNDLAASVLDRFHELVGHKVSLQLISSVNTDSENRVKGKVGKAAYL  84

Query  311   DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH-GEV  487
             + W+   T L  G+SAF + F+W E+ GVP AFII N H +EFYLKTLTLE VP H G +
Sbjct  85    EKWITTFTSLTPGDSAFDVSFDWEEEVGVPGAFIINNLHHSEFYLKTLTLEHVPGHSGPL  144

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SW+YPA KY   R+FF+N++YLPS+TPAPL  YR+EELV+LRG G+G+L+EWDRV
Sbjct  145   HFVCNSWIYPADKYKTHRVFFTNKSYLPSETPAPLLPYREEELVNLRGDGSGQLEEWDRV  204

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLGDPDKG + ARP+LGG+SEYPYPRRGRTGR PTKTDPNSESRIPLL SL+I
Sbjct  205   YDYAYYNDLGDPDKGQDLARPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRIPLLMSLNI  264

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL Y LKS+ QFLLPEF+ L +S   EFDSF+D   +YEGG KLP
Sbjct  265   YVPRDERFGHLKMSDFLGYGLKSIFQFLLPEFKDLCESISNEFDSFEDACGIYEGGFKLP  324

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              GPLL +I DNIPLE+LK+L+ SDGEGLFKFP P+VIQ
Sbjct  325   DGPLLKSIYDNIPLELLKQLLPSDGEGLFKFPMPKVIQ  362



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   490 bits (1262),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 281/349 (81%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAEKYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G G+L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKGKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   490 bits (1261),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 282/349 (81%), Gaps = 0/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G L      +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  N
Sbjct  7     GGLIGGHHDSKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPAN  66

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GL+GK S  AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+L
Sbjct  67    GLQGKHSNPAYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSL  126

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVPNHG+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG 
Sbjct  127   TLEDVPNHGKVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGD  186

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTG+ + WDR+YDY  YNDLG+PD+G E  R  LGG+++YPYPRRGRTGR PT+TDP SE
Sbjct  187   GTGKREAWDRIYDYDVYNDLGNPDQGKENVRTTLGGSADYPYPRRGRTGRPPTRTDPKSE  246

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SRIPL+ SLDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+
Sbjct  247   SRIPLILSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDV  306

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI+LPQGPL  A+ D IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  307   LRLYEGGIRLPQGPLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIK  355



>emb|CAA64764.1| lipoxygenase [Solanum tuberosum]
Length=447

 Score =   475 bits (1222),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 274/341 (80%), Gaps = 4/341 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQA   NGL+GK S  
Sbjct  12    SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQA---NGLQGKHSNP  68

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  69    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  128

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  129   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  188

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  189   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  248

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  249   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  308

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  309   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  349



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   489 bits (1258),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 280/339 (83%), Gaps = 1/339 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S    +  +GL+GK S  AY
Sbjct  18    KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISG-SVNYADGLEGKLSNPAY  76

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T + +GES F + F+W ++FGVP AFIIKN H NEF+LK+LTLEDVPN+G++
Sbjct  77    LESWLTDITPITAGESTFSVTFDWDDEFGVPGAFIIKNFHLNEFFLKSLTLEDVPNYGKI  136

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWDRV
Sbjct  137   HFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWDRV  196

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA YNDLGDPDKG EYARPILGG+SEYPYPRRGRTGR PTK DPN ESR PL  SLDI
Sbjct  197   YDYACYNDLGDPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMSLDI  256

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGH+K +DFLT +LKS  Q LLP F++L D+TP EF+SF D+LNLYEGGIKLP
Sbjct  257   YVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGIKLP  316

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             +GP L AI DNI  E+LK+++++DG+GL K+PTPQVIQG
Sbjct  317   EGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQG  355



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   488 bits (1256),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 280/349 (80%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA  Y  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G G+L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKGKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   488 bits (1256),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 280/349 (80%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTFTPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA  Y  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAENYTKDRVFFANKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G G+L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKGKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   488 bits (1255),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 280/349 (80%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFKI F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTITPLTAGESAFKITFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGHVHFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G  +L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKRKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   487 bits (1254),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 281/349 (81%), Gaps = 0/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G L      +KK+KG VV+M+KN LDF D   S+ D + + LGQKVS +L+SSVQ+D  N
Sbjct  4     GGLIGGHHDSKKVKGTVVMMKKNALDFTDLAGSLTDKIFEALGQKVSFQLISSVQSDPAN  63

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GL+GK S  AYL++++   T LA+GE+AF + F+W+E+FGVP AFIIKN H NEF+LK+L
Sbjct  64    GLQGKHSNPAYLENFLFTLTPLAAGETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSL  123

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVPNHG+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG 
Sbjct  124   TLEDVPNHGKVHFVCNSWVYPSFRYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGD  183

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTG+ + WDR+YDY  YNDLG+PD+G +  R  LGG+++YPYPRRGRTGR PT+TDP SE
Sbjct  184   GTGKREAWDRIYDYDVYNDLGNPDQGEQNVRTTLGGSADYPYPRRGRTGRPPTRTDPKSE  243

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SRIPL+ SLDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+
Sbjct  244   SRIPLILSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDV  303

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGIKLPQGPL  A+   IPLEM+KEL+R+DGEG+ +FPTP VI+
Sbjct  304   LRLYEGGIKLPQGPLFKALTAAIPLEMMKELLRTDGEGILRFPTPLVIK  352



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   487 bits (1254),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 280/349 (80%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G  +L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKRKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   487 bits (1254),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 280/349 (80%), Gaps = 1/349 (0%)
 Frame = +2

Query  95    GKLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN  274
             G+  +  S   KI G VVLM+KNVLDFNDFNAS++D + + +GQ+VSL+L+S+V  D  N
Sbjct  11    GQQQDGESNIGKINGTVVLMKKNVLDFNDFNASVLDRVHELVGQRVSLQLISAVHGDPDN  70

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GLKG   K AYL+ W+   T L +GESAFK+ F+W E+ GVP AFII+NNH +EF+LKT+
Sbjct  71    GLKGNLGKQAYLEDWITTITPLTAGESAFKVTFDWEEEVGVPGAFIIQNNHHSEFFLKTV  130

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL++VP+ G VHF C SWVYPA KY  +R+FF+N+ YLPS+ P PL+KY +EELV LRG 
Sbjct  131   TLDNVPDEGRVHFVCNSWVYPAEKYTKDRVFFTNKTYLPSEVPLPLRKYIEEELVELRGD  190

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             G  +L+EWDRVYDYAYYNDLGDPDKG+EY RPI+GG++EYPYPRRGRTGR P +TDPN+E
Sbjct  191   GKRKLEEWDRVYDYAYYNDLGDPDKGSEYVRPIMGGSTEYPYPRRGRTGRPPKETDPNTE  250

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+P+++SL IYVPRDE+FGHLK++DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+
Sbjct  251   SRLPIVSSLSIYVPRDERFGHLKMSDFLAYALKSIAQFIRPEIEALFDKTPNEFDSFKDV  310

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L LYEGGI LP+G L   I D+IP EMLKE+ R+DG    +FP P+VI+
Sbjct  311   LQLYEGGIPLPEG-LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIK  358



>emb|CCD74473.1| lipoxygenase 1, partial [Arabidopsis halleri subsp. halleri]
Length=381

 Score =   470 bits (1209),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/353 (63%), Positives = 273/353 (77%), Gaps = 7/353 (2%)
 Frame = +2

Query  95    GKLAEALS----PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA  262
             G+L + L+     TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   
Sbjct  3     GELVDLLTGGGNETKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVT  62

Query  263   DLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFY  442
             D  NG KGK  KAA+L+ W+   T L +GESAFK+ F++  DFG P AF+IKN+H +EF+
Sbjct  63    DSENGSKGKLGKAAHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIKNSHFSEFF  122

Query  443   LKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVH  622
             L++LTLEDVP HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV 
Sbjct  123   LRSLTLEDVPGHGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVS  182

Query  623   LRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTD  802
             LRGTG GELKEWDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK D
Sbjct  183   LRGTGEGELKEWDRVYDYAYYNDLGAPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKED  239

Query  803   PNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDS  982
             P +ESR+P+ +SLDIYVPRDE+FGHLK++DFL YALK++AQF+ P  E++FD TP EFDS
Sbjct  240   PQTESRLPITSSLDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDS  299

Query  983   FQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             F+D+L +YE GI LP   L+ +I  NIPLEMLKE+ R+DG+   KFP PQVI+
Sbjct  300   FEDVLKIYEEGIDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIK  352



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 226/339 (67%), Positives = 273/339 (81%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ D   G +GK    A
Sbjct  15    KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGDPEKGFQGKLGNPA  74

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  75    YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  134

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  135   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  194

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PDKG +YARP LGG+S+YPYPRRGRTGR  T+TD NSESR+PLL SL+
Sbjct  195   VYDYAYYNDLGNPDKGPKYARPTLGGSSKYPYPRRGRTGRPATETDSNSESRLPLLMSLN  254

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL YALKS+AQF+ PE E+LFD TP EFDSF+D+L LYEGGI L
Sbjct  255   IYVPRDERFGHLKLSDFLAYALKSIAQFIRPELEALFDKTPNEFDSFEDVLKLYEGGIPL  314

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+D   L +FP PQVI+
Sbjct  315   PEG-LLKDIGDNIPAEMLKEIFRTDSAQLLRFPMPQVIK  352



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 273/339 (81%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDFNDFNAS++D + + LGQ VSL+L+S+   D  NG KGK  + A
Sbjct  20    RKIKGTVVLMKKNVLDFNDFNASVLDRVHELLGQGVSLQLISADHGDSENGFKGKLGEPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L  G+SA+ + F+W E+ GVP A +IKNNH +EF+LKT+TLEDVP  G 
Sbjct  80    YLEDWITTITPLTVGDSAYNVTFDWEEEIGVPGAILIKNNHHSEFFLKTVTLEDVPREGR  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  140   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLRKYREEELVHLRGDGKGELQEWDR  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PDKG++YARP LGG+S YPYP RGRTGR  TKTDPNSESRIPL+ SL+
Sbjct  200   VYDYAYYNDLGNPDKGSKYARPTLGGSSGYPYPPRGRTGRPATKTDPNSESRIPLIMSLN  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             +YVPRDE+FGHLKL+DFL YALKS+ QF+ PE E+LFD TP EFDSF+D+L LY GGI L
Sbjct  260   VYVPRDERFGHLKLSDFLAYALKSIVQFIRPELEALFDKTPNEFDSFEDVLKLYIGGIPL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+DG  L +FP PQVI+
Sbjct  320   PEG-LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIE  357



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   488 bits (1257),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/339 (67%), Positives = 275/339 (81%), Gaps = 2/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSKAA  304
             KI G VVLM+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + A
Sbjct  121   KINGTVVLMKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPA  180

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G 
Sbjct  181   YLEDWITTITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGR  240

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VH  C SWVYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  241   VHIVCNSWVYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDR  300

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PD+GA+Y RP+LGG+SEYPYPRRGRTGR PT+TDPNSES +PL+ SL+
Sbjct  301   VYDYAYYNDLGKPDEGAKYVRPVLGGSSEYPYPRRGRTGRPPTRTDPNSESNLPLIQSLN  360

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL YALKS AQF+ PE ESLFD TP+EFDSF+D+L LYEGGI L
Sbjct  361   IYVPRDERFGHLKLSDFLVYALKSTAQFITPELESLFDQTPSEFDSFEDVLKLYEGGIPL  420

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I D IP EMLKE+ R+DG  L KFP PQVI+
Sbjct  421   PEG-LLKDIGDKIPAEMLKEIFRTDGAQLLKFPKPQVIK  458



>gb|AAG00881.1|AC064840_12 lipoxygenase - partial coding sequence [Arabidopsis thaliana]
Length=391

 Score =   469 bits (1206),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 267/342 (78%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  
Sbjct  16    TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLG  75

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP 
Sbjct  76    KAAHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPG  135

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  136   HGRVHYICNSWIYPAKHYTTDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKE  195

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +
Sbjct  196   WDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITS  252

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SLDIYVPRDE+FGHLK++DFL YALK++AQF+ P  E++FD TP EFDSF+D+L +YE G
Sbjct  253   SLDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEG  312

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEMLKE+ R+DG+   KFP PQVI+
Sbjct  313   IDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIK  354



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   485 bits (1248),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 277/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL-GNGLKGKRSKAA  304
             KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  K A
Sbjct  20    KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGTAKSDPPENGLKEKLGKPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
              L++W+     L +GE+ FK+ F+W E+ G+P A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80    NLENWITTIDPLIAGETEFKVTFDWDEEIGIPVALLIRNNHHSEFYLKTVTLEDVPGQGR  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SW+YPA +YNY+R+FF+N+ +LP   PAPL+KYR+EELV LRG G GELKEWDR
Sbjct  140   VHFVCNSWIYPAKRYNYDRVFFTNKTHLPQDAPAPLRKYREEELVKLRGDGKGELKEWDR  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLGDPD+GA+Y RP+LGG+SEYPYPRRGRTGRA T++DPNSESR+P+LTSL+
Sbjct  200   VYDYAYYNDLGDPDEGAKYVRPVLGGSSEYPYPRRGRTGRAATESDPNSESRLPILTSLN  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHL++ADFL YALK VAQ + P  E LFDSTP EFDSF D+  LYEGGI+L
Sbjct  260   IYVPRDERFGHLRMADFLGYALKLVAQVVKPGLEGLFDSTPNEFDSFDDVFKLYEGGIEL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P GPL+  I + IPL+MLKE+ R+DGE LF+FP PQVI+G
Sbjct  320   PHGPLVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIEG  359



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   487 bits (1253),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 274/339 (81%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+KNVLD NDF AS++D + + LG+ VSL L+SSV+ +   G +GK  K A
Sbjct  105   KKIKGRVVLMKKNVLDLNDFKASVLDRVHELLGKAVSLRLISSVKGEPEKGFQGKLGKPA  164

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L +GESAFK+ F+W ++ GVP AF+I NNH  EF+LKT+TLEDVP  G 
Sbjct  165   YLEDWITTITPLTAGESAFKVTFDWEDEIGVPGAFLIINNHHTEFFLKTVTLEDVPGEGR  224

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYPA KY  +R+FF N+ +LPS+TP PL+KYR+EELVHLRG G GEL+EWDR
Sbjct  225   VHFVCNSWVYPAEKYTKDRVFFVNKTFLPSETPLPLQKYREEELVHLRGDGKGELQEWDR  284

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PDKG +YARP+LGG+S+YPYPRRGRTGR  T+TD NSESR+PLL SL+
Sbjct  285   VYDYAYYNDLGNPDKGPKYARPMLGGSSKYPYPRRGRTGRPATETDSNSESRLPLLMSLN  344

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLKL+DFL YALKS++QF+ PE E+LFD TP EFDSF+D+L LYEGGI L
Sbjct  345   IYVPRDERFGHLKLSDFLAYALKSISQFIRPELEALFDKTPNEFDSFEDVLKLYEGGIPL  404

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+G LL  I DNIP EMLKE+ R+D   L  FP PQVI+
Sbjct  405   PEG-LLKDIGDNIPAEMLKEIFRTDSAQLLSFPMPQVIK  442



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   483 bits (1243),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 281/350 (80%), Gaps = 4/350 (1%)
 Frame = +2

Query  101   LAEALSPTKKI-KGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             +  ALS +  I +G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG
Sbjct  5     IVNALSTSMHIIRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNG  64

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKT  451
             +KGK  K AYL+ W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+
Sbjct  65    MKGKLGKPAYLEDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKS  124

Query  452   LTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG  631
             LTLE+VP HG +HF C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG
Sbjct  125   LTLENVPGHGVIHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRG  184

Query  632   TGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNS  811
              G G L+EWDRVYDYAYYNDLGDPDKGA+YARP+LGG+ EYPYPRRGRTGR PTK+D NS
Sbjct  185   DGKGTLQEWDRVYDYAYYNDLGDPDKGAQYARPVLGGSIEYPYPRRGRTGRPPTKSDANS  244

Query  812   ESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQD  991
             ESR+    SLDIYVPRDEKFGHLKL+DFL  ALKS+AQ + PE ESLFDS P EFDSF+D
Sbjct  245   ESRLNFAMSLDIYVPRDEKFGHLKLSDFLANALKSIAQIVKPELESLFDSIPEEFDSFED  304

Query  992   ILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +  LYEGGIK+P+  +L  I D IP EMLKE++R+DGE   KFP PQVI+
Sbjct  305   VFKLYEGGIKVPES-ILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIK  353



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   483 bits (1242),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/350 (65%), Positives = 281/350 (80%), Gaps = 4/350 (1%)
 Frame = +2

Query  101   LAEALSPTKKI-KGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             +  ALS +  I +G V++ +KNVLDFND +AS++D L +F+G++VSL+L+S+VQAD GNG
Sbjct  5     IVNALSTSMHIIRGTVIVTKKNVLDFNDLSASLLDRLHEFVGKRVSLQLISAVQADPGNG  64

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWS--EDFGVPAAFIIKNNHPNEFYLKT  451
             +KGK  K AYL+ W+   T L +GESAF++ F+W+  ED G P AF+++NNH +EFYLK+
Sbjct  65    MKGKLGKPAYLEDWITTITPLTAGESAFRVAFDWNGDEDIGTPGAFLVRNNHHSEFYLKS  124

Query  452   LTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG  631
             LTLE+VP HG +HF C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG
Sbjct  125   LTLENVPGHGVIHFICNSWVYPAHKYKTDRIFFSNKTYLPSETPVPLLKYREEELENLRG  184

Query  632   TGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNS  811
              G G L+EWDRVYDYAYYNDLGDPDKGA+YARP+LGG+ EYPYPRRGRTGR PTK+D NS
Sbjct  185   DGKGTLQEWDRVYDYAYYNDLGDPDKGAQYARPVLGGSIEYPYPRRGRTGRPPTKSDANS  244

Query  812   ESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQD  991
             ESR+    SLDIYVPRDEKFGHLKL+DFL  ALKS+AQ + PE ESLFDS P EFDSF+D
Sbjct  245   ESRLNFAMSLDIYVPRDEKFGHLKLSDFLANALKSIAQIVKPELESLFDSIPEEFDSFED  304

Query  992   ILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +  LYEGGIK+P+  +L  I D IP EMLKE++R+DGE   KFP PQVI+
Sbjct  305   VFKLYEGGIKVPES-ILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIK  353



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   483 bits (1244),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 274/342 (80%), Gaps = 3/342 (1%)
 Frame = +2

Query  119   PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  292
             P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19    PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  293   SKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  472
              K AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79    GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  473   NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELK  652
               G + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+
Sbjct  139   GQGVIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQ  198

Query  653   EWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLL  832
             EWDRVYDYA YNDLG+PDKG ++ARP LGG+ +YPYPRRGRT R P K+DP  ESR+ + 
Sbjct  199   EWDRVYDYALYNDLGNPDKGPQHARPTLGGSKDYPYPRRGRTSRPPAKSDPKCESRLNIA  258

Query  833   TSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEG  1012
             +SLDIYVPRDE+FGHLK+ADFL YALKS+ Q L PEFESLFDSTP EFD F+D+L LYEG
Sbjct  259   SSLDIYVPRDERFGHLKMADFLAYALKSIVQVLKPEFESLFDSTPNEFDKFEDVLKLYEG  318

Query  1013  GIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             GI++P+G +LT + DNIP EMLKE+ RSDG+ L KFP PQVI
Sbjct  319   GIEVPEG-ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVI  359



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   483 bits (1243),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 266/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND  AS +D L + LG+ VS++L+S+V AD  N L+G+  K AY
Sbjct  36    KIKGTVVLMKKNVLDFNDMKASFLDRLHELLGKGVSMQLISAVNADPANELRGRLGKVAY  95

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYLKT+TLEDVP HG +
Sbjct  96    LEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYLKTVTLEDVPGHGRI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+LRG G GELKEWDRV
Sbjct  156   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNLRGNGKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDPNSE R+PL+ SLDI
Sbjct  216   YDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDPNSERRLPLI-SLDI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF D+LNLYEGGIKLP
Sbjct  275   YVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSFDDVLNLYEGGIKLP  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  335   NSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  372



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 280/341 (82%), Gaps = 5/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKAA  304
             K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18    KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75    YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWD
Sbjct  135   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWD  194

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA YNDLG+PDKG EYARPILGG+SEYPYPRRGRTGR PTK DPN ESR PL  SL
Sbjct  195   RVYDYACYNDLGEPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMSL  254

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K +DFLT +LKS  Q LLP F++L D+TP EF+SF D+LNLYEGGIK
Sbjct  255   DIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGIK  314

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             LP+GP L AI DNI  E+LK+++++DG+GL K+PTPQVIQG
Sbjct  315   LPEGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQG  355



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/341 (67%), Positives = 280/341 (82%), Gaps = 5/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS-SVQADLGNGLKGKRSKAA  304
             K+KG+V+LM+KNVLDF +  AS+VD +SD LGQKVS++L+S SV  D   GL+GK S  A
Sbjct  18    KVKGRVILMKKNVLDFINIGASVVDGISDLLGQKVSIQLISGSVNYD---GLEGKLSNPA  74

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ W+   T + +GES F + F+W  D FGVP AFIIKN H NEF+LK+LTLEDVPN+G
Sbjct  75    YLESWLTDITPITAGESTFSVTFDWDRDEFGVPGAFIIKNLHLNEFFLKSLTLEDVPNYG  134

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++HF C SWVYPA +Y  +RIFF+NQAYLPS+TP PL+KYR+ ELV LRG GTG+L+EWD
Sbjct  135   KIHFVCNSWVYPAFRYKSDRIFFANQAYLPSETPQPLRKYRENELVALRGDGTGKLEEWD  194

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA YNDLG+PDKG EYARPILGG+SEYPYPRRGRTGR PTK DPN ESR PL  SL
Sbjct  195   RVYDYACYNDLGEPDKGEEYARPILGGSSEYPYPRRGRTGREPTKADPNCESRNPLPMSL  254

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K +DFLT +LKS  Q LLP F++L D+TP EF+SF D+LNLYEGGIK
Sbjct  255   DIYVPRDERFGHVKKSDFLTSSLKSSLQTLLPAFKALCDNTPNEFNSFADVLNLYEGGIK  314

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             LP+GP L AI DNI  E+LK+++++DG+GL K+PTPQVIQG
Sbjct  315   LPEGPWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQG  355



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   483 bits (1242),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 277/342 (81%), Gaps = 5/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD---LGNGLKGKRS  295
             KKIKG+VVL RK+ LDF  F+ SI+DN+ + LGQKVSL+L+S+V  D    G GL+GK  
Sbjct  28    KKIKGRVVLTRKSELDF--FSDSILDNVHELLGQKVSLQLISAVNGDPPAAGKGLRGKLG  85

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAAYL+ W+   T+   G+SAF + F+W ++ G+P AF+I+N H  EFYLKTLTL DVP 
Sbjct  86    KAAYLEDWITTITLPGHGDSAFDVAFDWEDEVGLPGAFLIRNLHHTEFYLKTLTLHDVPG  145

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG +HF C SWVYPA +Y  +R+FF+NQ YLP +TPAPL  YR+EELV LRG G+GEL+E
Sbjct  146   HGRLHFVCNSWVYPAHRYKTDRVFFANQTYLPLETPAPLIPYREEELVSLRGDGSGELEE  205

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLGDPDKG+ YARP+LGG+ E+PYPRRGRTGR  TK+DP SESR+PLL 
Sbjct  206   WDRVYDYAYYNDLGDPDKGSNYARPVLGGSDEFPYPRRGRTGRPLTKSDPESESRLPLLM  265

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFL YALKS+AQFL+PEFE+L D TP EFDS QD L +YEGG
Sbjct  266   SLNIYVPRDERFGHLKMSDFLAYALKSLAQFLVPEFEALCDITPNEFDSIQDTLKIYEGG  325

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP+GPLL +I  NIP E+LK+L+R+DGEG F FP PQVI+
Sbjct  326   IKLPEGPLLDSIRKNIPSELLKQLLRTDGEGYFSFPMPQVIK  367



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   482 bits (1240),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 274/342 (80%), Gaps = 3/342 (1%)
 Frame = +2

Query  119   PTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG--LKGKR  292
             P  ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVSSV  D GNG  LKGK 
Sbjct  19    PGHRVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSSVNVDPGNGNGLKGKL  78

Query  293   SKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  472
              K AYL+ W+     L +GE+AFK+ FEW E+ G P AFII+NNH +EFYLK+LTLEDVP
Sbjct  79    GKPAYLEDWITTIAPLTAGEAAFKVTFEWDEEIGTPGAFIIRNNHHSEFYLKSLTLEDVP  138

Query  473   NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELK  652
               G + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+
Sbjct  139   GQGVIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQ  198

Query  653   EWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLL  832
             EWDRVYDYA YNDLG+PDKG ++ARP LGG+ +YPYPRRGRT R P K+DP  ESR+ + 
Sbjct  199   EWDRVYDYALYNDLGNPDKGPQHARPTLGGSKDYPYPRRGRTSRPPAKSDPKCESRLNIA  258

Query  833   TSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEG  1012
             +SLDIYVPRDE+FGHLK+ADFL YALKS+ Q L PEFESLFDSTP EFD F+D+L LYEG
Sbjct  259   SSLDIYVPRDERFGHLKMADFLAYALKSIVQVLKPEFESLFDSTPNEFDKFEDVLKLYEG  318

Query  1013  GIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             GI++P+G +LT + DNIP EMLKE+ RSDG+ L KFP PQVI
Sbjct  319   GIEVPEG-ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVI  359



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =   482 bits (1240),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 277/340 (81%), Gaps = 1/340 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADL-GNGLKGKRSKAA  304
             KIKG VVLM+KNVL+FNDF+AS++D   + LGQ VSL+++ + ++D   NGLK K  K A
Sbjct  20    KIKGTVVLMKKNVLEFNDFHASVLDRGHELLGQGVSLQVIGAAKSDPPENGLKEKLGKPA  79

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
              L++W+     L +GE+AFK+ F+W E+ GVP A +I+NNH +EFYLKT+TLEDVP  G 
Sbjct  80    NLENWITTIDPLIAGETAFKVTFDWDEEIGVPVALLIRNNHHSEFYLKTVTLEDVPGEGR  139

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SW+YPA +Y+Y+R+FF+N+ +LP  +PAPL+KYR+ ELV LRG G GELKEWDR
Sbjct  140   VHFVCNSWIYPAKRYDYDRVFFTNKTHLPQDSPAPLRKYREAELVKLRGDGKGELKEWDR  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLGDPD+G +YARP+LGG+SEYPYPRRGRTGRA T++DPNSESR+PLLTSL+
Sbjct  200   VYDYAYYNDLGDPDEGTKYARPVLGGSSEYPYPRRGRTGRAATESDPNSESRLPLLTSLN  259

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHL++ADFL YALK VAQ + P  E LFDSTP EFDSF D+  +YEGGI+L
Sbjct  260   IYVPRDERFGHLRMADFLGYALKLVAQVVKPGLEGLFDSTPNEFDSFDDVFKIYEGGIEL  319

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P G L+  I + IPL+MLKE+ R+DGE LF+FP PQVIQG
Sbjct  320   PHGSLVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIQG  359



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   481 bits (1237),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/341 (66%), Positives = 275/341 (81%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M+KN LDF D   S+ D   D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  19    SKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  78

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  79    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  138

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+ +Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  139   GKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYRENELLTLRGDGTGKREAW  198

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPLL S
Sbjct  199   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLLLS  258

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  259   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  318

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM+KEL+R+DGEG+ +FPTP VI+
Sbjct  319   KLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIK  359



>gb|AJT49215.1| putative lipoxygenase-9 [Arachis hypogaea]
Length=860

 Score =   480 bits (1236),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 282/340 (83%), Gaps = 3/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSKA  301
             + +KG VVLM+KNVLDFNDF+AS++D L +FLG++VSL+L+S+V AD  GNGLKGK  KA
Sbjct  20    QTVKGTVVLMKKNVLDFNDFSASLLDRLHEFLGKRVSLQLISAVNADNHGNGLKGKLGKA  79

Query  302   AYLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL+ W+   T L +GE+AF + F+W +E+ G P AF+I+NNH +EFYLK+LTLEDVP+H
Sbjct  80    AYLEDWITTFTPLTAGEAAFTVTFDWDNEEIGTPGAFLIRNNHHSEFYLKSLTLEDVPSH  139

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G +HF C SWVYPASKY  +R+FFSN+ YLP++TP  L KYR+EEL +LRG G G+L+EW
Sbjct  140   GVIHFPCNSWVYPASKYQNDRVFFSNKTYLPAETPISLLKYREEELENLRGDGKGQLQEW  199

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDY  YNDLG+PDKG ++ARP+LGG++EYPYPRRGRTGRAP K+DP  ESR+ L  S
Sbjct  200   DRVYDYEVYNDLGNPDKGPQHARPVLGGSTEYPYPRRGRTGRAPAKSDPKYESRLNLALS  259

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FGHLKLADFL+YALKS+ Q L PEFES+FD TP EFDSF+D+L LYEGG+
Sbjct  260   LNIYVPRDERFGHLKLADFLSYALKSIVQVLKPEFESIFDKTPNEFDSFEDVLELYEGGL  319

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             ++P+G ++  I DN+PLEMLKE+ R+DGE   KFP PQVI
Sbjct  320   EVPEG-VIKVIRDNVPLEMLKEIFRTDGERFLKFPLPQVI  358



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 274/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  256   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   479 bits (1232),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 274/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  256   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>ref|XP_010277584.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nelumbo 
nucifera]
Length=883

 Score =   479 bits (1232),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 219/333 (66%), Positives = 277/333 (83%), Gaps = 2/333 (1%)
 Frame = +2

Query  143   VVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDHWV  322
             VVLM+KNVLDFND +AS++D + + +G+ V+L+L+SSV  D  NGL+GK  K AYL+ W+
Sbjct  43    VVLMKKNVLDFNDLHASVLDRVHELVGKGVALQLISSVNTDPANGLRGKLGKEAYLEEWI  102

Query  323   LKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACF  502
                T L++GES+F I F+W E  GVP AFII+N H ++F+LKT+TLEDVP  G VHF C 
Sbjct  103   TTITPLSAGESSFNITFDWDEGIGVPGAFIIRNFHHSQFFLKTVTLEDVPGVGRVHFICN  162

Query  503   SWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAY  682
             SWVYP   Y Y+R+FFSNQ YLP+ TP PL+KYR+EE+V+LRG GTGEL+EWDRVYDYAY
Sbjct  163   SWVYPTKHYKYDRVFFSNQTYLPANTPEPLRKYREEEIVNLRGDGTGELQEWDRVYDYAY  222

Query  683   YNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRD  862
             YNDLG+PDKG + ARP+LGG+++YPYPRRGRTGR PT+TDP +ESR+PLL SLDIYVPRD
Sbjct  223   YNDLGNPDKGPDSARPVLGGSTQYPYPRRGRTGRKPTQTDPKTESRLPLL-SLDIYVPRD  281

Query  863   EKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLL  1042
             E+FGHLK++DFL YALKS+ QFLLPE ++  D+TP EFD+FQD+L+LYEGGI+LP+G +L
Sbjct  282   ERFGHLKMSDFLAYALKSLVQFLLPELKAFCDNTPNEFDTFQDVLDLYEGGIQLPKG-VL  340

Query  1043  TAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              ++ + IPLEMLKEL+R+DGE L KFP PQVIQ
Sbjct  341   DSVKEAIPLEMLKELVRTDGEQLLKFPMPQVIQ  373



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   477 bits (1228),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 269/331 (81%), Gaps = 2/331 (1%)
 Frame = +2

Query  152   MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLKGKRSKAAYLDHWVLK  328
             M+KNVLDFND NAS++D + + +GQ VSL+L+S+V AD   NG KGK  + AYL+ W+  
Sbjct  1     MKKNVLDFNDLNASVLDGVYELVGQGVSLQLISAVHADDSKNGWKGKLGQPAYLEDWITT  60

Query  329   NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSW  508
              T L +GESAFK+ F++ E+ GVP AF+IKNNH +EF+LKT+TLE+VP  G VH  C SW
Sbjct  61    ITPLTTGESAFKVTFDYEEEVGVPGAFLIKNNHHSEFFLKTVTLENVPGEGRVHIVCNSW  120

Query  509   VYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYN  688
             VYP  KY  +R+FF N+ YLPS+TP PL+KYR+EELVHLRG G GEL+EWDRVYDYAYYN
Sbjct  121   VYPTEKYTTDRVFFVNKTYLPSETPLPLRKYREEELVHLRGNGKGELQEWDRVYDYAYYN  180

Query  689   DLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEK  868
             DLG PD+GA+Y RP+LGG+SEYPYPRRGRTGR PT+TDPNSES +PL+ SL+IYVPRDE+
Sbjct  181   DLGKPDEGAKYVRPVLGGSSEYPYPRRGRTGRPPTRTDPNSESNLPLIQSLNIYVPRDER  240

Query  869   FGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTA  1048
             FGHLKL+DFL YALKS AQF+ PE ESLFD TP+EFDSF+D+L LYEGGI LP+G LL  
Sbjct  241   FGHLKLSDFLVYALKSTAQFITPELESLFDQTPSEFDSFEDVLKLYEGGIPLPEG-LLKD  299

Query  1049  IADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I D IP EMLKE+ R+DG  L KFP PQVI+
Sbjct  300   IGDKIPAEMLKEIFRTDGAQLLKFPKPQVIK  330



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   477 bits (1228),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/341 (65%), Positives = 273/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KN LDF D   S+ D   +FLGQ VS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKLKGTVVMMNKNALDFTDLAGSLTDKAFEFLGQTVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNTHINEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+ +Y  +RIFF NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSFRYKSDRIFFVNQPYLPSKTPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDEGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  256   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   476 bits (1226),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 222/340 (65%), Positives = 272/340 (80%), Gaps = 0/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
              KKIKG VVLM+KNVLDFNDFNAS +D + +  G  VSL+L+SSV ++  NGL+GK  + 
Sbjct  26    CKKIKGTVVLMKKNVLDFNDFNASFLDGIHELAGHGVSLQLISSVNSEPENGLQGKVGEP  85

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A L+ W+   T    G+SAF++ F+W ++ G+P AFII+NNH +EFYLKTLTLEDVP  G
Sbjct  86    ALLEDWITTFTPATPGDSAFRVTFDWDDEIGIPGAFIIRNNHHSEFYLKTLTLEDVPGQG  145

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              +HF C SWVYPA +Y  +R+FF+N+AYLP +TP PL+KYR+EELV LRG G  ELKEWD
Sbjct  146   RIHFVCNSWVYPAKRYKKDRVFFTNKAYLPHETPMPLRKYREEELVSLRGDGKAELKEWD  205

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYA YNDL DPDKG +Y RP+LGG+ +YPYPRRGRTGR P ++DP  ESR+ LL SL
Sbjct  206   RVYDYACYNDLADPDKGPKYDRPVLGGSDDYPYPRRGRTGRKPLESDPKYESRLSLLLSL  265

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+FGHLK+ADFL YALKS+AQF+ PE E++FD TP EFDSF D+L LYEGG+K
Sbjct  266   NIYVPRDERFGHLKMADFLAYALKSIAQFIKPELEAVFDKTPNEFDSFDDVLKLYEGGLK  325

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+GPLL  I  NIPLEMLKE+ R+DGE LFKFP PQVI+
Sbjct  326   LPEGPLLDNIIKNIPLEMLKEIFRTDGERLFKFPMPQVIK  365



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   475 bits (1223),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 222/339 (65%), Positives = 272/339 (80%), Gaps = 3/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG--NGLKGKRSKA  301
             ++KG VVLM+KNVLDFNDF+AS +D L +F+G++VSL+LVS+V  D G  NGLKGK  K 
Sbjct  18    RVKGTVVLMKKNVLDFNDFSASFLDRLHEFVGKRVSLQLVSAVNVDSGDSNGLKGKLGKP  77

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A+L+ W+     L  GE+AFK+ FEW E+   P AFII+NNH +EFYLK+LTLEDVP  G
Sbjct  78    AHLEDWITTIAPLTVGETAFKVTFEWDEEIRTPGAFIIRNNHHSEFYLKSLTLEDVPGQG  137

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              + F C SWVYPA KY  +RIFFSN+ YLPS+TP PL KYR+EEL +LRG G G+L+EWD
Sbjct  138   VIRFICNSWVYPADKYEKDRIFFSNKTYLPSETPMPLLKYREEELENLRGNGKGQLQEWD  197

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY  YNDLG+PDKG ++ARPILGG+ EYPYPRRGRTGR PTK+DP  E+R+ + +SL
Sbjct  198   RVYDYDLYNDLGNPDKGPQHARPILGGSKEYPYPRRGRTGRPPTKSDPKCETRLNIASSL  257

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK+ADFL YALKS+ Q L PE ESLFD+TP EFDSF+D+  LYEGGI+
Sbjct  258   DIYVPRDERFGHLKMADFLAYALKSIVQVLKPELESLFDNTPNEFDSFEDVFKLYEGGIE  317

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             +P+G +LT + DNIP EMLKE+ RSDG+ L KFP PQVI
Sbjct  318   VPEG-ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVI  355



>ref|XP_012069606.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Jatropha curcas]
 gb|KDP40158.1| hypothetical protein JCGZ_02156 [Jatropha curcas]
Length=867

 Score =   475 bits (1222),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/339 (65%), Positives = 265/339 (78%), Gaps = 1/339 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKGKVVLM+KNVLDFND  AS  D + +  G+ VS++L+S+V  D  N L+GK  K A+
Sbjct  21    KIKGKVVLMKKNVLDFNDVTASCFDRIHELFGKGVSIQLISAVNPDPENDLRGKHGKVAF  80

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ WV K T +A+ E+ F I F+W E   VP AFII+N+H ++ YLKT+TLEDVP HG V
Sbjct  81    LESWVKKITPMAAQETEFNITFDWDESMAVPGAFIIRNHHHSQLYLKTVTLEDVPGHGRV  140

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYPA +Y Y+R+FFSN+ YLP QTP  L+KYR+EEL++LRG G GELKEWDRV
Sbjct  141   HFVCNSWVYPAHRYKYDRVFFSNKTYLPCQTPESLRKYREEELINLRGNGKGELKEWDRV  200

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG PDKG EYARP+LGG  +YPYPRRGRTGR PTKTDP+SESR+PLL SLDI
Sbjct  201   YDYAYYNDLGSPDKGKEYARPVLGGPGKYPYPRRGRTGRKPTKTDPDSESRLPLL-SLDI  259

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK +DFL YALKS+ Q LLPE +SL D T  EFDSF+D+L LYEGG+KLP
Sbjct  260   YVPRDERFGHLKFSDFLAYALKSLVQVLLPEVKSLCDKTINEFDSFEDVLKLYEGGLKLP  319

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
                L + I  +IP EMLKEL+R+DGE   KFP P VI+ 
Sbjct  320   NAALTSKIRKSIPWEMLKELVRNDGERFLKFPMPDVIKA  358



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   474 bits (1221),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 220/341 (65%), Positives = 272/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
              DIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  256   TDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   474 bits (1220),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 225/350 (64%), Positives = 283/350 (81%), Gaps = 3/350 (1%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGN  274
             KL    S ++KI+G VVLM+KNVLDFNDF+AS++D + + LG+ VSL+LVS+V AD   N
Sbjct  19    KLKMGGSQSRKIQGTVVLMKKNVLDFNDFHASLLDRVHELLGKGVSLQLVSAVHADSQAN  78

Query  275   GLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTL  454
             GL GK  + AYL  W+ K T LA+GESAFK+ F+  E+ GVP AFI+KNNH +EFYLKTL
Sbjct  79    GLGGKVGEPAYLKDWITKITPLAAGESAFKVTFDADEEIGVPGAFIVKNNHHSEFYLKTL  138

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TL+DVP HG +HF C SWVYPA  Y Y+R+FF+NQ YLPS+ P PL+ YR++EL++LRG 
Sbjct  139   TLDDVPRHGRMHFVCNSWVYPAKYYKYDRVFFTNQTYLPSEMPPPLRYYREQELLNLRGD  198

Query  635   GTGE-LKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNS  811
             G+ E L E+DRVYDYAYYNDLG+PDKGA+YARP+LGG++EYPYPRRGRTGR PTK+DPN+
Sbjct  199   GSDEELNEYDRVYDYAYYNDLGNPDKGAKYARPVLGGSAEYPYPRRGRTGRPPTKSDPNT  258

Query  812   ESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQD  991
             ESR+P+ +SL+IYVPRDE+FGHLK++DFL YALKS+AQF+ P  ES+ DSTP EFDSF D
Sbjct  259   ESRLPVTSSLNIYVPRDERFGHLKMSDFLAYALKSIAQFIKPALESI-DSTPNEFDSFDD  317

Query  992   ILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +  LYEGG+ LP   LL  I  NIPLE+LKE+ ++DG  LF++P PQVIQ
Sbjct  318   VQKLYEGGLDLPDSHLLDDIRKNIPLELLKEIFQTDGARLFEYPMPQVIQ  367



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   474 bits (1219),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 219/341 (64%), Positives = 273/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP  +SRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKVKSRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGI
Sbjct  256   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGI  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   KLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>ref|XP_002516771.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF45385.1| lipoxygenase, putative [Ricinus communis]
Length=868

 Score =   474 bits (1219),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 218/338 (64%), Positives = 267/338 (79%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++L+S+V  D  N L+GK  K AY
Sbjct  22    KIKGTVVLMKKNVLDFSDIKASFLDRVHELLGKGVSMQLISAVHHDPANKLRGKLGKVAY  81

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ WV   T + + ++ F I F+W E  GVP AFII+N+H ++ YLKT+TL+DVP HG V
Sbjct  82    LEKWVRSITPITAVDTVFNITFDWDESMGVPGAFIIRNHHHSQLYLKTVTLDDVPGHGRV  141

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYPA  YNY+R+FFSN+ YLP QTP PL+KYR+EEL++LRG G G+L+EWDRV
Sbjct  142   HFVCNSWVYPAHCYNYDRVFFSNKTYLPCQTPKPLRKYREEELINLRGNGKGKLEEWDRV  201

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG PDKG EYARP+LGG+ +YPYPRRGRTGR PTKTDPNSESR+PLL +LDI
Sbjct  202   YDYAYYNDLGSPDKGKEYARPVLGGSEQYPYPRRGRTGRKPTKTDPNSESRLPLL-NLDI  260

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGH+K +DFL YALKSV Q L+PE +SL D T  EFDSF+D+L LYEGGIKLP
Sbjct  261   YVPRDERFGHIKFSDFLAYALKSVVQVLVPEIKSLCDKTINEFDSFEDVLKLYEGGIKLP  320

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              G   T + + IP EMLKEL+R+DGE   KFP P VI+
Sbjct  321   SGTKATKLRNRIPWEMLKELVRNDGERFLKFPMPDVIK  358



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   473 bits (1217),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 266/339 (78%), Gaps = 0/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+GK  K A
Sbjct  22    EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQGKLGKEA  81

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE VP HG 
Sbjct  82    YLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEHVPGHGR  141

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
              HF C SWVYP  KY+  R+FF+N+ YLP   P PL +YR++EL+ LRG G GEL+EWDR
Sbjct  142   FHFVCNSWVYPDKKYDNPRVFFTNKTYLPHDMPKPLLQYREQELMALRGNGQGELQEWDR  201

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PDKG EYARP+LGG+++YPYPRRGRTGR PTK+DP +ESRIPLL SL+
Sbjct  202   VYDYAYYNDLGNPDKGPEYARPVLGGSAKYPYPRRGRTGRPPTKSDPKTESRIPLLMSLN  261

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ QF++PE + L D T  EFDS +D+L LY GG+KL
Sbjct  262   IYVPRDERFGHLKMSDFLAYALKSIVQFIVPELQDLTDKTHNEFDSLEDVLELYYGGVKL  321

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P GPLL  I +NIPLEMLKE+ R+DG  L KFP PQVIQ
Sbjct  322   PSGPLLDNIINNIPLEMLKEIFRTDGAQLLKFPVPQVIQ  360



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   472 bits (1215),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 270/339 (80%), Gaps = 1/339 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VV+M KNVLDF D  +S+   + D LGQKVS +L+SSVQ D  NGL+GK S  AY
Sbjct  1     KVKGTVVMMNKNVLDFTDLASSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNPAY  60

Query  308   LDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             L++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H  EF+LK+LTLEDVPNHG+
Sbjct  61    LENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHITEFFLKSLTLEDVPNHGK  120

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP+  Y  +RIFF+NQ YLPS TP  L+KYR+ EL+ LRG GTG+ + WDR
Sbjct  121   VHFVCNSWVYPSLNYKSDRIFFANQPYLPSDTPELLRKYRENELLTLRGDGTGKREAWDR  180

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             +YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S D
Sbjct  181   IYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILSTD  240

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEGGIKL
Sbjct  241   IYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGGIKL  300

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             PQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  301   PQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  339



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   471 bits (1212),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 219/341 (64%), Positives = 272/341 (80%), Gaps = 1/341 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VV+M KNVLDF D   S+   + D LGQKVS +L+SSVQ D  NGL+GK S  
Sbjct  16    SKKVKGTVVMMNKNVLDFTDLAGSLTGKIFDVLGQKVSFQLISSVQGDPTNGLQGKHSNP  75

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             AYL++ +   T L +G E+AF + F+W+E+FGVP AFIIKN H NEF+LK+LTLEDVPNH
Sbjct  76    AYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNMHINEFFLKSLTLEDVPNH  135

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G+VHF C SWVYP+  Y  +RIFF+NQ YLPS+TP  L+KYR+ EL+ LRG GTG+ + W
Sbjct  136   GKVHFVCNSWVYPSLNYKSDRIFFANQPYLPSETPELLRKYRENELLTLRGDGTGKREAW  195

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DR+YDY  YNDLG+PD+G E  R  LGG++EYPYPRRGRTGR PT+TDP SESRIPL+ S
Sbjct  196   DRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGRPPTRTDPKSESRIPLILS  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DFLTYALKS+ QF+LPE  +LFD TP EFDSF+D+L LYEG  
Sbjct  256   LDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGTPNEFDSFEDVLRLYEGRD  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LPQGPL  A+   IPLEM++EL+R+DGEG+ +FPTP VI+
Sbjct  316   QLPQGPLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIK  356



>ref|XP_010040715.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
Length=656

 Score =   464 bits (1194),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 221/346 (64%), Positives = 273/346 (79%), Gaps = 12/346 (3%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  K 
Sbjct  21    SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81    AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141   RVHFVCNSWVYPADRYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDK A+YARP+LGG++EYPYPRRGRTGR PTKTDPN+E R+P L SL
Sbjct  201   RVYDYAYYNDLGNPDKDAKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTERRVPALMSL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE FGHLK++DFL YALK+VAQ L  + ES+   TP EFDSF+D+L LY+G IK
Sbjct  261   DIYVPRDEWFGHLKMSDFLAYALKAVAQLLKRKLESVCAKTPNEFDSFEDVLKLYKGSIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKE------LIRSDGEGLFKFPTPQVIQ  1141
             L   PLL ++ ++IPLEM+KE      LIR     L K+P PQVI+
Sbjct  321   L-ASPLLESLEESIPLEMIKERCFTPALIR-----LLKYPMPQVIK  360



>gb|AAD09861.1| lipoxygenase [Persea americana]
Length=858

 Score =   470 bits (1210),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 222/338 (66%), Positives = 263/338 (78%), Gaps = 2/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             +IKG VVLM+KNVLDFNDF AS +D + +FLG+ VS +LVS+   D  NG +GK  +AAY
Sbjct  18    QIKGSVVLMKKNVLDFNDFQASFLDRVHEFLGKGVSFQLVSAEHGDPDNGNRGKVGEAAY  77

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T + +GES F + F W   FG P A I+KN H +EF+LKTLTLED P    +
Sbjct  78    LEDWITTLTSIQAGESVFNVTFNWDMSFGTPGAVIVKNFHHSEFFLKTLTLEDFPAKDRI  137

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP S Y Y+RIFF N+ YL S  P PL+KYR+EELVHLRG G GELKEWDRV
Sbjct  138   HFVCNSWVYPTSNYKYDRIFFVNKTYLSSDMPEPLRKYREEELVHLRGDGEGELKEWDRV  197

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA+YNDLGDPDKG  YAR +LGG+ +YPYPRRGRT RAPTKTDP +ESR+PLL SLDI
Sbjct  198   YDYAFYNDLGDPDKGPNYARRVLGGSKDYPYPRRGRTARAPTKTDPKTESRLPLL-SLDI  256

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALKS+ QFL+PE ++L DSTP EFD+FQD  NLYEGGIKLP
Sbjct  257   YVPRDERFGHLKMSDFLAYALKSLVQFLVPEIKALCDSTPNEFDTFQDD-NLYEGGIKLP  315

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
               P L  I D IPLEM+KEL+R+DGE L KFP PQVI+
Sbjct  316   DSPALDKIRDMIPLEMIKELVRTDGERLLKFPLPQVIK  353



>gb|ERN11692.1| hypothetical protein AMTR_s00022p00225700 [Amborella trichopoda]
Length=618

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 221/342 (65%), Positives = 265/342 (77%), Gaps = 2/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             S T  I+G +VL +KNVLDFNDF+ S +DNL +FLG++VSL+LVS+  AD   GLKGK  
Sbjct  21    SSTTMIEGWLVLKKKNVLDFNDFHLSFLDNLDEFLGKRVSLQLVSATHADPERGLKGKLG  80

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAAYL+ W  K+  LA GE+ F + FEW E FG+P  FII+N H  EFYLK LTL  VP 
Sbjct  81    KAAYLEEWSKKHDGLAVGEAQFIVNFEWDESFGIPGGFIIRNEHHAEFYLKALTLHHVPG  140

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
              G VHF C SWVYPA KYN +R+FFSN++YLPS+TP  LKK R+EEL++LRG G GELKE
Sbjct  141   KGRVHFVCNSWVYPAKKYNSDRVFFSNESYLPSETPLALKKLREEELLNLRGNGVGELKE  200

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG+PD   + ARPILGG+ E+PYPRRGRTGR PTKTDP  E R+PLL 
Sbjct  201   WDRVYDYAYYNDLGNPDD-PDLARPILGGSKEFPYPRRGRTGRPPTKTDPKFERRLPLL-  258

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SLDIYVPRDE+FGHLK++DFL YALKS+ QFLLPE ++LF  TP EFDSF+D++ +Y GG
Sbjct  259   SLDIYVPRDERFGHLKMSDFLAYALKSINQFLLPEIKALFGKTPDEFDSFEDVMKMYGGG  318

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP+   L  +   IP EM+KEL+R+DGE   KFP PQVIQ
Sbjct  319   IKLPENEALDTLKGLIPFEMIKELLRTDGERFLKFPLPQVIQ  360



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   471 bits (1212),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 270/346 (78%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  37    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEPAANGLKSR  96

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  97    GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  156

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  157   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  216

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  TKTDPNSESR+
Sbjct  217   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRL  276

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE +SL D T  EFD+F D++NL
Sbjct  277   PLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNL  335

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP GP L  I + IP E+LKELIRSDGE   KFP P VI+
Sbjct  336   YEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIK  381



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   471 bits (1211),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 273/346 (79%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLK--  283
             +S   +I+GK+VLM+KNVLDFND  AS+VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  27    VSGGNRIRGKLVLMKKNVLDFNDLKASVVDRIHELLGKGVSMQLISATHPEPAANGLKSR  86

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  + AYL+ WV   T L++GE++F I  +W E  GVP A +I+N+H ++FYLKT+TLE
Sbjct  87    GKLGEVAYLEKWVTTTTSLSAGEASFSISLDWDESHGVPGALLIRNHHHSQFYLKTITLE  146

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPS+TP  L  YR++ELV+LRG+G+G
Sbjct  147   DVPGHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSKTPELLHPYREDELVNLRGSGSG  206

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG EY RP+LGG++EYPYPRRGRTGR PTKTDPN ESR+
Sbjct  207   ELKEWDRVYDYAYYNDLGSPDKGPEYVRPVLGGSNEYPYPRRGRTGREPTKTDPNFESRL  266

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE +SL D T  EFD+F+D+LNL
Sbjct  267   PLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFEDVLNL  325

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             Y+GGIKLP GP L  I + IP E+LKELIRSDGE   KFP P VI+
Sbjct  326   YDGGIKLPNGPTLKKIRECIPWELLKELIRSDGERFLKFPMPDVIK  371



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   470 bits (1209),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 269/346 (78%), Gaps = 2/346 (1%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             EA   +  +KG V+LM+KNVLDFNDFNAS++D L +FLG+ VS +LVS+  AD  NG KG
Sbjct  18    EAPKSSTTVKGSVLLMKKNVLDFNDFNASLLDGLHEFLGKGVSFQLVSATVADPHNGNKG  77

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K    AYL+ W+   T +A+GE+ F + F W E  GVP A I+KNNH + FYLKT+TLE 
Sbjct  78    KIGPPAYLEEWITTMTSVATGETKFTVHFSWDESQGVPGAIIVKNNHHSAFYLKTITLEG  137

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TG  643
             VPN   +HF C SWVYP  KY Y+RIFF+N  YLPS+TP PLK+YR+EELVHLRG   TG
Sbjct  138   VPNKEHIHFVCNSWVYPVDKYKYDRIFFANNTYLPSKTPEPLKRYREEELVHLRGDDVTG  197

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKE DR+Y+YAYYNDLG+PDKG +YARPILGG+ E PYPRRGRTGR PTKTDPN ESR+
Sbjct  198   ELKEHDRIYNYAYYNDLGNPDKGHDYARPILGGSQEQPYPRRGRTGRHPTKTDPNYESRL  257

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+FGHLK++DFL YALKS+ Q LLP   ++FD+TP EFDSF+D+L L
Sbjct  258   PLL-SLDIYVPRDERFGHLKMSDFLAYALKSLTQSLLPTLSAVFDTTPMEFDSFKDVLQL  316

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGG+ +PQ P L  I  ++P EMLKEL+R+DGE + K P PQVIQ
Sbjct  317   YEGGLPIPQSPELDEIRSHLPFEMLKELVRTDGERVLKLPLPQVIQ  362



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   469 bits (1208),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 267/342 (78%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L LVSS   D  NG KGK  
Sbjct  16    TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLVSSDVTDSENGSKGKLG  75

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF LK+LTLEDVP 
Sbjct  76    KAAHLEDWITTITSLTAGESAFKVTFDYETDFGYPGAFLIRNSHFSEFLLKSLTLEDVPG  135

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  136   HGRVHYICNSWIYPAKHYTTDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKE  195

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +
Sbjct  196   WDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITS  252

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SLDIYVPRDE+FGHLK++DFL YALK++AQF+ P  E++FD TP EFDSF+D+L +YE G
Sbjct  253   SLDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEG  312

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEMLKE+ R+DG+   KFP PQVI+
Sbjct  313   IDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIK  354



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   469 bits (1207),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 269/342 (79%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17    TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAA+L+ W+ + T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77    KAAHLEDWITRITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137   HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVDLRGTGEGELKE  196

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +
Sbjct  197   WDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITS  253

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFLTYALK++AQ + P  E++FD TP EFDSF+D+L +YE G
Sbjct  254   SLNIYVPRDERFGHLKMSDFLTYALKAIAQIIQPALEAVFDVTPNEFDSFEDVLKIYEEG  313

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  314   IDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  355



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   469 bits (1207),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 221/346 (64%), Positives = 269/346 (78%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKSR  81

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F +  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82    GKLGKVAYLEKWATTITSLSAGETSFTVSLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  TKTDPNSESR+
Sbjct  202   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRL  261

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE +SL D T  EFD+F D++NL
Sbjct  262   PLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNL  320

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP GP L  I + IP E+LKELIRSDGE   KFP P VI+
Sbjct  321   YEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIK  366



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   469 bits (1207),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 222/346 (64%), Positives = 269/346 (78%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82    GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  TKTDPNSESR+
Sbjct  202   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTDPNSESRL  261

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE +SL D T  EFD+F D++NL
Sbjct  262   PLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPELKSLCDKTINEFDTFDDVVNL  320

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP GP L  I + IP E+LKELIRSDGE   KFP P VI+
Sbjct  321   YEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIK  366



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =   469 bits (1206),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 271/341 (79%), Gaps = 2/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG+VVLM+KNVLD N   ASI+D + + LG+ VS++L+S+ + D  NG +GK  K A
Sbjct  38    RKIKGRVVLMKKNVLDMNHLGASILDRVHEVLGKGVSIQLISANRGDPANGKRGKLGKTA  97

Query  305   YLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL++W+   T +A+ + A F + FEW E  G+P AFIIKN+H  E YLKT+TLEDVP HG
Sbjct  98    YLENWIATITSVATADDASFNVSFEWDEAMGIPGAFIIKNHHHYEVYLKTVTLEDVPRHG  157

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +VHF C SWVYPA +Y Y+RIFF+N+ YLP QTP PL+ YR++ELV+LRG G+GELK+WD
Sbjct  158   QVHFVCNSWVYPAHRYKYDRIFFTNKTYLPGQTPEPLRDYREQELVNLRGNGSGELKKWD  217

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYN+LG P+KG EY RP+LGG+ +YPYPRRGRTGR PTK+DPN+ESR+PLL SL
Sbjct  218   RVYDYAYYNNLGMPNKGKEYERPVLGGSKDYPYPRRGRTGRKPTKSDPNTESRLPLL-SL  276

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+F  +K++DFL YALKS+ Q LLPE  SLFD T  EFD+FQD+LNLYEGG+K
Sbjct  277   DIYVPRDERFSPVKMSDFLAYALKSLGQVLLPELASLFDKTINEFDTFQDVLNLYEGGLK  336

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             LP G  ++ I D IP EMLKEL+RSDGE L KFP P VI+ 
Sbjct  337   LPNGVPISKIKDCIPWEMLKELLRSDGERLLKFPMPDVIKA  377



>ref|XP_006838255.2| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Amborella 
trichopoda]
Length=783

 Score =   465 bits (1197),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 215/339 (63%), Positives = 263/339 (78%), Gaps = 1/339 (0%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             +KG VVL +KNVLDFNDF+ S +D+L +FLG++VSL LVS+  AD   GLKGK  KAAYL
Sbjct  1     MKGSVVLQKKNVLDFNDFHVSFLDSLHEFLGKRVSLHLVSATHADPERGLKGKLGKAAYL  60

Query  311   DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  490
             + W  K   LA GE+ F ++FEW E FG P AF+I+N H  +FYLK+LTL  VP  G VH
Sbjct  61    EEWGKKQVGLAVGEAQFTVDFEWDESFGTPGAFVIRNEHHGQFYLKSLTLHHVPGKGRVH  120

Query  491   FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVY  670
             F C SWVYP+ KY  +RIFFSN++YLP +TP  LK  R+EEL++LRG G GELKEWDRVY
Sbjct  121   FVCNSWVYPSKKYTSDRIFFSNESYLPGETPLALKNLREEELLNLRGNGVGELKEWDRVY  180

Query  671   DYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIY  850
             DYAYYNDLG PD G +  RP+LGG+ E+PYPRRGRTGR PTKTDP  ESR+PLL SLDIY
Sbjct  181   DYAYYNDLGKPDDGPDLVRPVLGGSVEFPYPRRGRTGRPPTKTDPKIESRLPLL-SLDIY  239

Query  851   VPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQ  1030
             VPRDE+FGHLK++DFL YALKS+ QFL+PE ++LFD TP EFDSF+D++ +YEGG+KLP+
Sbjct  240   VPRDERFGHLKMSDFLAYALKSIVQFLVPEIKALFDKTPKEFDSFEDVMKMYEGGVKLPE  299

Query  1031  GPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQGK  1147
                L  +   IP EM+KEL+R+DGE    +P PQVIQGK
Sbjct  300   TQALDTLKGLIPFEMIKELLRTDGERFLNYPLPQVIQGK  338



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   468 bits (1204),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/339 (65%), Positives = 268/339 (79%), Gaps = 2/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND +AS++D + + LG+ +S +LVS+   D  NG +GK   AAY
Sbjct  20    KIKGTVVLMKKNVLDFNDLHASLLDRMHEVLGKGISFQLVSATVGDPNNGKRGKVGPAAY  79

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L++GES F + F+W E  G+P A I+KN+H +EFYLK+LTL+ VP  G +
Sbjct  80    LEEWITTLTSLSAGESRFNVTFDWDESQGIPGAVIVKNSHHSEFYLKSLTLDGVPRKGSI  139

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG-TGTGELKEWDR  664
             HF C SWVYP  KY Y+RIFF+N  YLPS+TP PL+ YR EEL+HLRG   +GEL+E DR
Sbjct  140   HFVCNSWVYPVDKYKYDRIFFANTTYLPSKTPEPLRPYRQEELLHLRGDDDSGELQEHDR  199

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VY YAYYNDLG+PDKGAEYARP+LGG+SEYPYPRRGRTGR PTKTDPN+ESR+PLL SLD
Sbjct  200   VYAYAYYNDLGNPDKGAEYARPVLGGSSEYPYPRRGRTGRPPTKTDPNTESRLPLL-SLD  258

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ Q L P   +LFD TP EFDSFQD+LNLYEGG+KL
Sbjct  259   IYVPRDERFGHLKMSDFLGYALKSLTQSLQPILNTLFDKTPMEFDSFQDVLNLYEGGLKL  318

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+ P L  I D IP EM+KELIRSDGE + K P PQVI+
Sbjct  319   PECPELDEIRDRIPFEMIKELIRSDGEQVLKLPLPQVIK  357



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   468 bits (1203),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 268/345 (78%), Gaps = 1/345 (0%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E + P +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D  NGL+G
Sbjct  17    EKMKP-EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVDADNGLQG  75

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K  K AYL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE 
Sbjct  76    KLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEH  135

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  646
             VP HG +HF C SWVYP  KY+  R+FF+N+  LP   P PL +YR++EL+ LRG G GE
Sbjct  136   VPGHGRLHFVCNSWVYPDKKYDNPRVFFTNKTCLPHDMPKPLLQYREQELMALRGNGQGE  195

Query  647   LKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIP  826
             L+EWDRVYDYAYYNDLG+PDKG EYARP+LGG+++YPYPRRGRTGR PTK+DP +ESRIP
Sbjct  196   LQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSAKYPYPRRGRTGRPPTKSDPKTESRIP  255

Query  827   LLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLY  1006
             LL SL+IYVPRDE+FGHLK++DFL YALKS+ QF++PE + L D T  EFDS +D+L LY
Sbjct  256   LLMSLNIYVPRDERFGHLKMSDFLAYALKSIVQFIVPELQDLTDKTHNEFDSLEDVLELY  315

Query  1007  EGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              GG+KLP GPL   I +NIPLEMLKE+ R+DG  L KFP P+VIQ
Sbjct  316   YGGVKLPSGPLRDNIINNIPLEMLKEIFRTDGAQLLKFPVPRVIQ  360



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   467 bits (1202),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 266/340 (78%), Gaps = 3/340 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  KA
Sbjct  16    TKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSENGSKGKLGKA  75

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A+L+ W+   T L +GESAFK+ F++  +FG P AF+IKN+H +EF L++LTLEDVP HG
Sbjct  76    AHLEDWITTITSLTAGESAFKVTFDYESNFGYPGAFLIKNSHFSEFLLRSLTLEDVPGHG  135

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWD
Sbjct  136   RVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGEGELKEWD  195

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +SL
Sbjct  196   RVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITSSL  252

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGHLK++DFL YALK++AQF+ P  E++FD TP EFDSF+D+L +YE GI 
Sbjct  253   DIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEGID  312

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP   L+ +I  NIPLEMLKE+ R+DG+   KFP PQVI+
Sbjct  313   LPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIK  352



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   466 bits (1199),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 219/339 (65%), Positives = 266/339 (78%), Gaps = 2/339 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNVLDFND +AS++D + + LGQ V+ +LVS+ + D  NG +GK    AY
Sbjct  19    KIKGTVVLMKKNVLDFNDLHASLLDRMHEILGQGVTFQLVSATEGDPNNGKRGKVGPPAY  78

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L++GES F + F W E  G+P A I+KN+H +EF+LK+LTLE VP  G +
Sbjct  79    LEEWITTLTSLSAGESRFNVTFNWDESQGIPGAVIVKNSHHSEFFLKSLTLEGVPRKGRI  138

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  664
             HF C SWVYP  KY Y+R+FF+N  YLPS+TP PL+ YR EEL+HLRG   TGEL+E DR
Sbjct  139   HFVCNSWVYPVDKYTYDRVFFANHTYLPSKTPEPLRPYRLEELLHLRGDDVTGELQEHDR  198

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VY YAYYNDLGDPDKGAEY RP+LGG+SEYPYPRRGRTGR PTKTDPNSESR+PLL SL+
Sbjct  199   VYAYAYYNDLGDPDKGAEYVRPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRLPLL-SLN  257

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YALKS+ Q L P   ++FD TP EFDS QD+LNLYEGG+KL
Sbjct  258   IYVPRDERFGHLKMSDFLAYALKSLTQSLQPLLNTVFDKTPMEFDSLQDVLNLYEGGLKL  317

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+ P L  I D IPLEM+KEL+RSDGE + K P PQVI+
Sbjct  318   PEFPALEEIKDRIPLEMIKELVRSDGEQVLKLPLPQVIK  356



>gb|KCW44986.1| hypothetical protein EUGRSUZ_L01433 [Eucalyptus grandis]
Length=636

 Score =   459 bits (1180),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 218/362 (60%), Positives = 273/362 (75%), Gaps = 23/362 (6%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +KK+KG VVLM+KNVL+FNDFNAS++D + +  GQKVSL+LVS+V  D   GL+GK  K 
Sbjct  21    SKKVKGTVVLMKKNVLNFNDFNASVLDLVFELFGQKVSLQLVSAVHGDPEKGLRGKLGKP  80

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+  +T+L +G+SAF + F+W E+ GVP A I++N H  +FYLKT+TLEDVP  G
Sbjct  81    AYLEDWITTSTLLKAGDSAFMVTFDWDEEVGVPGAIIVQNKHHRQFYLKTVTLEDVPGEG  140

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA +Y  ER+FFSN+ YLP QTPAPL KYR+EELV+LRG GTGEL+EWD
Sbjct  141   RVHFVCNSWVYPADRYKKERVFFSNKTYLPGQTPAPLVKYREEELVNLRGDGTGELQEWD  200

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG+PDK A+YARP+LGG++EYPYPRRGRTGR PTKTDPN+E R+P L SL
Sbjct  201   RVYDYAYYNDLGNPDKDAKYARPVLGGSAEYPYPRRGRTGRPPTKTDPNTERRVPALMSL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE FGHLK++DFL YALK+VAQ L  + ES+   TP EFDSF+D+L LY+G IK
Sbjct  261   DIYVPRDEWFGHLKMSDFLAYALKAVAQLLKRKLESVCAKTPNEFDSFEDVLKLYKGSIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEG----------------------LFKFPTPQV  1135
             L   PLL ++ ++IPLEM+KE   ++ +                       L K+P PQV
Sbjct  321   L-ASPLLESLEESIPLEMIKERCCAENKTAWRTVVEFSRKMLAGVTPALIRLLKYPMPQV  379

Query  1136  IQ  1141
             I+
Sbjct  380   IK  381



>ref|XP_004296897.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=884

 Score =   466 bits (1199),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 219/346 (63%), Positives = 267/346 (77%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  283
             +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VS++L+S+   +       L+
Sbjct  30    VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSMQLISATHPEPAANRLVLR  89

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90    GKPGKIAYLEKWITTVTSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG VHF C SWVYPA +Y Y RIFFSN+AYLPSQTP  L  YR+EEL +LRG G+G
Sbjct  150   DVPGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSG  209

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTD NSESR+
Sbjct  210   ELKEWDRVYDYAYYNDLGSPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDHNSESRL  269

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
              LL SLDIYVPRDE+FGH+K +DFL YALKS+ Q LLPE  SL D T  EFD+F+D+L+L
Sbjct  270   FLL-SLDIYVPRDERFGHVKFSDFLAYALKSLVQILLPELRSLCDKTINEFDTFEDVLDL  328

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP GP L  + D +P E+LKEL+RSDGE   KFP P VI+
Sbjct  329   YEGGIKLPNGPTLKKLRDRVPWELLKELLRSDGERFLKFPMPDVIK  374



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   465 bits (1197),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 214/342 (63%), Positives = 266/342 (78%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17    TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             K A+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77    KTAHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137   HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKE  196

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +
Sbjct  197   WDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPQTESRLPITS  253

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFL YALK++AQ + P  E++FD TP EFDSF+D+L +YE G
Sbjct  254   SLNIYVPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDKTPNEFDSFEDVLKIYEEG  313

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  314   IDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  355



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   465 bits (1196),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 216/338 (64%), Positives = 265/338 (78%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA +Y  +R+FFSN+ YLP +TP PL KYR+EELV LRGTG GELKEWDRV
Sbjct  138   HYICNSWVYPAKRYTKDRVFFSNKTYLPRETPEPLLKYREEELVSLRGTGEGELKEWDRV  197

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P K     RP+LGG+ EYPYPRRGRTGR PT  DP +ESR+P+ +SLDI
Sbjct  198   YDYAYYNDLGVPPKN---PRPVLGGSQEYPYPRRGRTGRKPTTEDPETESRLPVTSSLDI  254

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  ES+FD TP EFDSF+D+L +YE GI LP
Sbjct  255   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALESVFDETPKEFDSFEDVLKIYEEGIDLP  314

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  315   NQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  352



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/342 (63%), Positives = 266/342 (78%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             + TKK+KG VVLM+KNVLDFNDFNAS +D L +FLG K++L L+SS   D  NG KGK  
Sbjct  17    TTTKKVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKITLRLISSDVTDSANGSKGKLG  76

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  77    KAAHLEDWITPITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  136

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKE
Sbjct  137   HGRVHYICNSWIYPAKHYTKDRVFFSNKTYLPHETPATLLKYREEELVELRGTGEGELKE  196

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PT  DP +ESR+P+ +
Sbjct  197   WDRVYDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTNEDPQTESRLPITS  253

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFL YALK++AQ + P  E++FD TP EFDSF+D+L +YE G
Sbjct  254   SLNIYVPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDKTPNEFDSFEDVLKIYEEG  313

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  314   IDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  355



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   464 bits (1195),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 268/338 (79%), Gaps = 2/338 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             I+GKVVLM+KNVLDFND +AS +D+L +F+G++VSL+LVS+V+ D GN +KGK  KA YL
Sbjct  22    IRGKVVLMKKNVLDFNDLSASFLDDLHEFVGKRVSLQLVSAVKVDPGNDMKGKVGKAEYL  81

Query  311   DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  490
             + W+  +T L +GES F + F+W ED G P AFIIKNNH +EFYLK+ TLE+VP+ G +H
Sbjct  82    EDWITTSTPLIAGESTFSVTFDWDEDIGTPGAFIIKNNHHSEFYLKSFTLENVPSQGVIH  141

Query  491   FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT-GTGELKEWDRV  667
             F C SWVYPA KY  +RIFFSN+ Y+ S+TP PL +YR EEL  LRG     +L+EWDRV
Sbjct  142   FICNSWVYPAHKYEKDRIFFSNRTYILSETPKPLLEYRKEELESLRGIRNNQQLQEWDRV  201

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYA YNDLGDPDKG +YARPILGG+S+YPYPRRGRT R PTK+D NSESR+ L  SLDI
Sbjct  202   YDYANYNDLGDPDKGPQYARPILGGSSQYPYPRRGRTSRPPTKSDANSESRLNLAMSLDI  261

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLKL DFL Y+LK+V Q + PE ESLFD+TP EFD+ +D+L LYEGGIK+P
Sbjct  262   YVPRDERFGHLKLTDFLAYSLKAVVQVIKPELESLFDNTPNEFDTLEDVLKLYEGGIKVP  321

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             QG L+  I DNIP +MLK++ R DGE   K+P PQVI+
Sbjct  322   QG-LVKGIRDNIPAKMLKQIFRIDGENFLKYPVPQVIK  358



>ref|XP_010108010.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXC17575.1| Linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=884

 Score =   464 bits (1193),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 262/340 (77%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             TKKIKG VVLM+KNVLDFND  AS++D + +  G+ VS++++SSV  D  NG +GK  K 
Sbjct  36    TKKIKGTVVLMKKNVLDFNDIKASLLDRIHELFGKVVSMQIISSVLPDPENGFRGKLGKV  95

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   +  A+ E+ F + FEW E  G+P AFIIKN+H ++F+LKT+TLEDVP HG
Sbjct  96    AYLEKWISTISPTAARETQFTVTFEWGETMGLPGAFIIKNHHHSQFFLKTVTLEDVPGHG  155

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYP  +Y Y R+FFS++ YLP QTP  L+ YR+EEL +LRG GTGELKEWD
Sbjct  156   RVHFVCNSWVYPTHRYKYNRVFFSSKTYLPCQTPDLLRYYREEELKNLRGNGTGELKEWD  215

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG PDKG +YARP+LGG  EYPYPRRGRTGR PTKTDPNSE R+PLL +L
Sbjct  216   RVYDYAYYNDLGSPDKGPDYARPVLGGTQEYPYPRRGRTGRKPTKTDPNSEKRLPLL-NL  274

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K +DFL YALKS+ Q LLPE +SL D T  EFD F+D+L LYEGG+K
Sbjct  275   DIYVPRDERFGHVKFSDFLAYALKSLVQVLLPELKSLCDKTINEFDKFEDVLRLYEGGLK  334

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP G  L  I + IP E+L+EL RSDGE   KFP P VI+
Sbjct  335   LPNGHTLGKIRERIPWELLRELARSDGERFLKFPIPAVIK  374



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   462 bits (1189),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 215/338 (64%), Positives = 264/338 (78%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA +Y  +R+FFSN+ YLP +TP  L KYR+EELV LRGTG GELKEWDRV
Sbjct  138   HYICNSWVYPAKRYTKDRVFFSNKTYLPHETPEALLKYREEELVSLRGTGEGELKEWDRV  197

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P K     RP+LGG+ EYPYPRRGRTGR PT  DP +ESR+P+ +SLDI
Sbjct  198   YDYAYYNDLGVPPKN---PRPVLGGSQEYPYPRRGRTGRKPTTEDPETESRLPVTSSLDI  254

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  ES+FD TP EFDSF+D+L +YE GI LP
Sbjct  255   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALESVFDETPKEFDSFEDVLKIYEEGIDLP  314

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  315   NQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  352



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   461 bits (1186),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 212/338 (63%), Positives = 266/338 (79%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG +V+L+L+SS  +D  NG KGK  KAA+
Sbjct  17    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNRVTLQLISSDLSDPENGAKGKLGKAAH  76

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77    LEDWITTITSLTAGESAFKVTFDYDKDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA  Y  +R+FFSN+ YLP +TP  L KYR+EEL+ LRGTG GELKEWDRV
Sbjct  137   HYVCNSWVYPAKNYTKDRVFFSNKTYLPHETPEGLLKYREEELLSLRGTGEGELKEWDRV  196

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P K     RP+LGG  EYPYPRRGRTGR PT+ DP +ESR+P+ +SLDI
Sbjct  197   YDYAYYNDLGVPPKN---PRPVLGGTQEYPYPRRGRTGRKPTEEDPQTESRLPITSSLDI  253

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  E++FD TP EFDSF+D+L +YE GI LP
Sbjct  254   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDETPKEFDSFEDVLKIYEEGIDLP  313

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                ++ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  314   NQAMIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  351



>emb|CAE17327.1| lipoxygenase [Fragaria x ananassa]
Length=884

 Score =   461 bits (1187),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 265/346 (77%), Gaps = 4/346 (1%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG---LK  283
             +S +KKI+G VVLM+KNVLDFND  AS++D + +FLG+ VSL+L+S+   +       L+
Sbjct  30    VSESKKIRGTVVLMKKNVLDFNDMKASLLDRIHEFLGKGVSLQLISATHPEPAANRLVLR  89

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W+   T L +G++AF    +W E  GVP A +I N+H ++FYLKT+TL+
Sbjct  90    GKPGKIAYLEKWITTATSLTAGDTAFSASIDWDESMGVPGALMITNHHHSQFYLKTITLD  149

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DV  HG VHF C SWVYPA +Y Y RIFFSN+AYLPSQTP  L  YR+EEL +LRG G+G
Sbjct  150   DVLGHGRVHFVCNSWVYPAHRYKYNRIFFSNKAYLPSQTPELLLPYREEELTNLRGIGSG  209

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             ELKEWDRVYDYAYYNDLG PDKG EY RP+LGG+ EYPYPRRGRTGR PTKTD NSESR+
Sbjct  210   ELKEWDRVYDYAYYNDLGSPDKGPEYERPVLGGSQEYPYPRRGRTGRKPTKTDHNSESRL  269

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
              LL SLDIYVPRDE+FGH+K +DFL YALKS+ Q LLPE  SL D T  EFD+F+D+L+L
Sbjct  270   FLL-SLDIYVPRDERFGHVKFSDFLAYALKSLVQILLPELRSLCDKTINEFDTFEDVLDL  328

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP GP L  + D +P E+LKEL+RSDGE   KFP P VI+
Sbjct  329   YEGGIKLPNGPTLKKLRDRVPWELLKELLRSDGERFLKFPMPDVIK  374



>ref|XP_011625454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Amborella trichopoda]
Length=846

 Score =   459 bits (1182),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 263/337 (78%), Gaps = 2/337 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             I+G +VL +KNVLDFNDF+ S +DNL +FLG++VSL+LVS+  AD   GLKGK  KAAYL
Sbjct  2     IEGWLVLKKKNVLDFNDFHLSFLDNLDEFLGKRVSLQLVSATHADPERGLKGKLGKAAYL  61

Query  311   DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  490
             + W  K+  LA GE+ F + FEW E FG+P  FII+N H  EFYLK LTL  VP  G VH
Sbjct  62    EEWSKKHDGLAVGEAQFIVNFEWDESFGIPGGFIIRNEHHAEFYLKALTLHHVPGKGRVH  121

Query  491   FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVY  670
             F C SWVYPA KYN +R+FFSN++YLPS+TP  LKK R+EEL++LRG G GELKEWDRVY
Sbjct  122   FVCNSWVYPAKKYNSDRVFFSNESYLPSETPLALKKLREEELLNLRGNGVGELKEWDRVY  181

Query  671   DYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIY  850
             DYAYYNDLG+PD   + ARPILGG+ E+PYPRRGRTGR PTKTDP  E R+PLL SLDIY
Sbjct  182   DYAYYNDLGNPDD-PDLARPILGGSKEFPYPRRGRTGRPPTKTDPKFERRLPLL-SLDIY  239

Query  851   VPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQ  1030
             VPRDE+FGHLK++DFL YALKS+ QFLLPE ++LF  TP EFDSF+D++ +Y GGIKLP+
Sbjct  240   VPRDERFGHLKMSDFLAYALKSINQFLLPEIKALFGKTPDEFDSFEDVMKMYGGGIKLPE  299

Query  1031  GPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L  +   IP EM+KEL+R+DGE   KFP PQVIQ
Sbjct  300   NEALDTLKGLIPFEMIKELLRTDGERFLKFPLPQVIQ  336



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   458 bits (1179),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 210/342 (61%), Positives = 265/342 (77%), Gaps = 3/342 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             +  KK+KG VVL++KNVLDFNDFNAS +D L +FL  K++L L+SS   D  NG KGK  
Sbjct  16    TTAKKVKGTVVLIKKNVLDFNDFNASFLDRLHEFLNNKITLRLISSDVTDSANGSKGKLG  75

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             KAA+L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EF+LK+LTLEDVP 
Sbjct  76    KAAHLEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFFLKSLTLEDVPG  135

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VH+ C SW+YP+  Y  +R+FFSN+ YLP +TPA L KYR+EEL+ LRGTG GELKE
Sbjct  136   HGRVHYICNSWIYPSKHYTKDRVFFSNKTYLPHETPATLLKYREEELLDLRGTGEGELKE  195

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG P       RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +
Sbjct  196   WDRVYDYAYYNDLGVPPNN---PRPVLGGTQEYPYPRRGRTGRKPTKEDPKTESRLPVTS  252

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SLDIYVPRDE+FGHLK++DFL YALK++AQF+ P  E++FD TP EFDSF+D+L +YE G
Sbjct  253   SLDIYVPRDERFGHLKMSDFLAYALKAIAQFIQPALEAVFDDTPKEFDSFEDVLKIYEEG  312

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   L+ +I  NIPLEML+E+ R+DG+   K+P PQVI+
Sbjct  313   IDLPNQALIDSIVKNIPLEMLREIFRTDGQKFLKYPVPQVIK  354



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   459 bits (1180),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 224/340 (66%), Positives = 267/340 (79%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34    RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQDPADGLRGKLGKVA  93

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  94    YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  153

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP  +Y Y+R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  154   VHFICNSWVYPTHRYKYDRVFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  213

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG PDKG EYARPILGG  EYPYPRRGRTGR  TK DP+SE R+PL+ SLD
Sbjct  214   VYDYDYYNDLGSPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKNDPHSEQRLPLI-SLD  272

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+AQ LLPE  SL D T  EFD+F+D+LNLYEGGIKL
Sbjct  273   IYVPRDERFGHLKFSDFLAYALKSLAQVLLPETTSLCDKTINEFDTFEDVLNLYEGGIKL  332

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P GP ++ I D+IP EMLKEL+R+DGE LFKFP P VI+ 
Sbjct  333   PNGPTISKIRDHIPWEMLKELVRNDGERLFKFPKPDVIKA  372



>gb|KFK35600.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=857

 Score =   457 bits (1176),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 213/338 (63%), Positives = 262/338 (78%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  KA +
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTDPADGSKGKLGKAGH  77

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWDRV
Sbjct  138   HYLCNSWVYPAKNYAKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGKGELKEWDRV  197

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P       RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +SLDI
Sbjct  198   YDYAYYNDLGVPPNN---PRPVLGGTPEYPYPRRGRTGRNPTKEDPQTESRLPVTSSLDI  254

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  E++FD TP EFDSF+D+L +YE GI LP
Sbjct  255   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDDTPKEFDSFEDVLKIYEEGIDLP  314

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L+ +I  NIPLEMLKE+ R+DG+   ++P PQVI+
Sbjct  315   NQSLIDSIVKNIPLEMLKEIFRTDGQKFLRYPVPQVIK  352



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   457 bits (1176),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 267/341 (78%), Gaps = 2/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELV--SSVQADLGNGLKGKRSK  298
             K +KG VVLM+KN+L+ ND  AS+VD++ + LG+KV+ +L+  SS+  D    LKGK  K
Sbjct  19    KTMKGVVVLMKKNLLEVNDIAASVVDSVDEILGRKVAFQLITTSSLDHDSEENLKGKPGK  78

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+ W+ K   L +G++ + + FEW+++ GVP AF + N H +EFYLKTLTLEDVP H
Sbjct  79    IAYLEDWITKIGPLTAGDATYTVTFEWTKEMGVPGAFTVTNFHHSEFYLKTLTLEDVPGH  138

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SWVYPA  Y  +R+FF+NQ YLP+QTPAPL++YR+EEL +LRG GTG+L+EW
Sbjct  139   GRVHFVCNSWVYPAQYYETDRVFFANQTYLPNQTPAPLRRYREEELQNLRGNGTGKLEEW  198

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDY  YNDLGDPDKG ++ R ILGG++EYPYPRRGRTGR    +DPNSESRIPL  S
Sbjct  199   DRVYDYDIYNDLGDPDKGPKHVRSILGGSTEYPYPRRGRTGRPLASSDPNSESRIPLYQS  258

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L IYVPRDE+F HLK++DF+ YALKS+ QFL PEFE+LFD TP EFDS +D+L LYEGGI
Sbjct  259   LSIYVPRDERFSHLKMSDFVAYALKSIFQFLAPEFEALFDKTPEEFDSLEDVLQLYEGGI  318

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             K+  G LL  I+++IP EM+KEL+RSDGE  FKFP PQVI+
Sbjct  319   KVQNGSLLEKISEHIPFEMIKELLRSDGEKSFKFPLPQVIK  359



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   456 bits (1174),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/357 (61%), Positives = 274/357 (77%), Gaps = 9/357 (3%)
 Frame = +2

Query  95    GKLAEALSPTK-----KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQ  259
             G L  AL         +++G V+LM+KNVLDFND ++S++D L +F+G++VSL+L+S+ Q
Sbjct  3     GNLVNALEENNMNKRDRMRGTVILMKKNVLDFNDLSSSLLDRLHEFMGKRVSLQLISAFQ  62

Query  260   ADLGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSE---DFGVPAAFIIKNNHP  430
              D GN +KGK  K AYL+ W+   T L +GESAF + F+W +     G P AF+I+N+H 
Sbjct  63    TDSGNEMKGKLGKPAYLEDWITTITPLTAGESAFGVTFDWDDDDDSIGTPQAFLIRNHHH  122

Query  431   NEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDE  610
             +EFYLK++TLE VP HG VHF C SWVYPA KY  +RIFFSN+AYLPS+TP PL KYR+E
Sbjct  123   SEFYLKSMTLESVPGHGVVHFNCNSWVYPAHKYKKDRIFFSNKAYLPSETPEPLLKYREE  182

Query  611   ELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAP  790
             EL  LRG G G L+EWDRVYDYAYYNDL DPDKGA+YARP+LGG++EYPYPRRGRTGR P
Sbjct  183   ELESLRGDGRGTLQEWDRVYDYAYYNDLSDPDKGAQYARPVLGGSTEYPYPRRGRTGRPP  242

Query  791   TKTDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPT  970
             TK+D   ESR+ L  SLDIYVPRDE+FGHLKL+DFL  ALKS+ Q + PE ESL DSTP 
Sbjct  243   TKSDVKIESRLNLAMSLDIYVPRDERFGHLKLSDFLANALKSIVQVIKPELESLLDSTPD  302

Query  971   EFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             EFDSF+D+  LYEGGIK+P+G ++  + D IP E+LKE++R+DGE   KFP PQVI+
Sbjct  303   EFDSFEDMFKLYEGGIKVPEG-IIKNVRDKIPAELLKEILRTDGERFLKFPVPQVIK  358



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   457 bits (1175),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/367 (60%), Positives = 269/367 (73%), Gaps = 25/367 (7%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82    GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTK---------  796
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  TK         
Sbjct  202   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTEHERHEEF  261

Query  797   ------------TDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPE  940
                         TDPNSESR+PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE
Sbjct  262   LRFYDQFSFMLRTDPNSESRLPLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPE  320

Query  941   FESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKF  1120
              +SL D T  EFD+F D++NLYEGGIKLP GP L  I + IP E+LKELIRSDGE   KF
Sbjct  321   LKSLCDKTINEFDTFDDVVNLYEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKF  380

Query  1121  PTPQVIQ  1141
             P P VI+
Sbjct  381   PMPDVIK  387



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   457 bits (1175),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 222/367 (60%), Positives = 269/367 (73%), Gaps = 25/367 (7%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISATHPEAAANGLKPR  81

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82    GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTK---------  796
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  TK         
Sbjct  202   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTTKTEHERHEEF  261

Query  797   ------------TDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPE  940
                         TDPNSESR+PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE
Sbjct  262   LRFYDQFSFMLRTDPNSESRLPLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPE  320

Query  941   FESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKF  1120
              +SL D T  EFD+F D++NLYEGGIKLP GP L  I + IP E+LKELIRSDGE   KF
Sbjct  321   LKSLCDKTINEFDTFDDVVNLYEGGIKLPNGPTLKKIRERIPWELLKELIRSDGERFLKF  380

Query  1121  PTPQVIQ  1141
             P P VI+
Sbjct  381   PMPDVIK  387



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   456 bits (1172),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 264/338 (78%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L++FLG KV+L L+SS  AD GNG KGK  K A+
Sbjct  20    KVKGTVVLMKKNVLDFNDFNASFLDRLTEFLGNKVTLRLISSDVADSGNGSKGKLGKPAH  79

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++   FG P AF I+N+H +EFYLK+LTLEDVP HG V
Sbjct  80    LEEWITTITPLTAGESAFKVTFDYENGFGFPGAFAIRNDHFSEFYLKSLTLEDVPGHGRV  139

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP+  Y  +R+FFSN+ YLPSQTP PL +YR++ELV LRGTG GELKE DRV
Sbjct  140   HFLCNSWVYPSHTYEKDRVFFSNKTYLPSQTPEPLVQYREKELVSLRGTGKGELKEGDRV  199

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLGDP K     RP+LGG+ EYPYPRRGRTGR PTK DPN+ESR+P+ +SL++
Sbjct  200   YDYAYYNDLGDPPKN---PRPVLGGSEEYPYPRRGRTGRKPTKEDPNTESRLPITSSLNV  256

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL +ALKS+ Q + P  E++FD +P EFDSF+D+L +YE GI LP
Sbjct  257   YVPRDERFGHLKMSDFLVFALKSIVQIVQPALEAVFDKSPNEFDSFEDVLKIYEEGIDLP  316

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                    I +NIPLE+L+E+ R+DG  L K+P PQ+I+
Sbjct  317   NQSFFDNIRNNIPLELLREIFRTDGAKLLKYPEPQIIK  354



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   455 bits (1171),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 264/345 (77%), Gaps = 6/345 (2%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E + P +KIKG V+LM+KNVLDFNDF+AS +D   + LG++VS +L+SS   D      G
Sbjct  17    EKMKP-EKIKGTVILMKKNVLDFNDFHASFLDGFHELLGKRVSFQLISSQHVD-----AG  70

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K  K AYL+ W    T   +GES F + F++ E+ G+P AF+IKNNH +EFYLKTLTLE 
Sbjct  71    KLGKEAYLEDWNSTETSAVAGESKFDVNFDFEEEIGLPGAFLIKNNHHSEFYLKTLTLEH  130

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGE  646
             VP HG +HF C SWVYP  KY+  R+FF+N+  LP   P PL +YR++EL+ LRG G GE
Sbjct  131   VPGHGRLHFVCNSWVYPDKKYDNPRVFFTNKTCLPHDMPKPLLQYREQELMALRGNGQGE  190

Query  647   LKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIP  826
             L+EWDRVYDYAYYNDLG+PDKG EYARP+LGG+++YPYPRRGRTGR PTK+DP +ESRIP
Sbjct  191   LQEWDRVYDYAYYNDLGNPDKGPEYARPVLGGSAKYPYPRRGRTGRPPTKSDPKTESRIP  250

Query  827   LLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLY  1006
             LL SL+IYVPRDE+FGHLK++DFL YALKS+ QF++PE + L D T  EFDS +D+L LY
Sbjct  251   LLMSLNIYVPRDERFGHLKMSDFLAYALKSIVQFIVPELQDLTDKTHNEFDSLEDVLELY  310

Query  1007  EGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              GG+KLP GPL   I +NIPLEMLKE+ R+DG  L KFP P+VIQ
Sbjct  311   YGGVKLPSGPLRDNIINNIPLEMLKEIFRTDGAQLLKFPVPRVIQ  355



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   455 bits (1170),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 264/340 (78%), Gaps = 3/340 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             ++KG VVLM+KNVLDF DFNAS  D L +F+G+ VS +LVSS  AD  NG +GK  + AY
Sbjct  5     RVKGAVVLMKKNVLDFTDFNAS-XDRLDEFVGKSVSFQLVSSTIADPDNGNRGKVGEPAY  63

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             ++ W+   T +A GES F++ F+W E  G+P A I++N H  EFYLKTLTLED P +G +
Sbjct  64    IEEWITTITSIADGESKFQVTFQWDESQGIPGAVIVRNYHHFEFYLKTLTLEDFPGNGRI  123

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  664
             HF C SWVYP   Y Y+RIFF+N  YLP+ TPAPL+ YR+EELVHLRG   TGELKE+ R
Sbjct  124   HFVCNSWVYPVDYYMYDRIFFTNHTYLPTNTPAPLQAYRNEELVHLRGDNVTGELKEFQR  183

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG+PD G+ YARP+LGG+ ++PYPRRGRTGR PT+TDP +ESR+P L SLD
Sbjct  184   VYDYAYYNDLGNPDNGSNYARPVLGGSEQFPYPRRGRTGRPPTRTDPKTESRLPGL-SLD  242

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YA+K++ Q LLP  ++LF+ TP EFDS QD+LNLYEGGI+L
Sbjct  243   IYVPRDERFGHLKMSDFLAYAIKALVQSLLPVLKTLFNKTPFEFDSLQDVLNLYEGGIQL  302

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P+ P L  I D IP EM+KEL+R+DGE L K P PQVIQ 
Sbjct  303   PECPELDKIKDRIPFEMIKELVRTDGEHLLKLPMPQVIQA  342



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   455 bits (1170),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 262/340 (77%), Gaps = 3/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSKA  301
             KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N LKGK  K 
Sbjct  19    KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDLKGKLGKP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +GE+AF++ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79    AYLEKWITTVTPLTAGETAFQVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SW+YPA  Y+  RIFF+N+ YLP +TPAPL+KYR+EEL HLRG G GELKEWD
Sbjct  139   RVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGELKEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY +YNDLG   KG+EY RP+LGG+SE+PYPRRGRTGR   K DPN+ESR+PLL SL
Sbjct  199   RVYDYDFYNDLGSSKKGSEYFRPVLGGSSEHPYPRRGRTGRK--KEDPNTESRLPLLKSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
              IYVPRDE+FGHLK+ADFL YALK+VAQ +    ++  D+TP EFDSF D+L LYEGGI+
Sbjct  257   SIYVPRDERFGHLKMADFLAYALKTVAQVVKNGVDTFVDTTPNEFDSFDDVLKLYEGGIE  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL  I  N PLE L+E+ R+DGE  F+FP PQVI+
Sbjct  317   LPHVPLLDNIRKNFPLEFLEEIFRTDGERFFEFPKPQVIK  356



>ref|XP_010024349.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW60798.1| hypothetical protein EUGRSUZ_H03535 [Eucalyptus grandis]
Length=899

 Score =   456 bits (1172),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 266/339 (78%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G V LM+KNVLD ND  AS++D + +  G+ VSL+LVS+V +D  NG +GK  K A
Sbjct  51    KKIRGTVKLMKKNVLDMNDMKASLLDRIHELFGKGVSLQLVSAVHSDPSNGSRGKLGKVA  110

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T L +GE+ F + F+W +  G+P AFII+N+H ++FYLKT+TLEDVP HG 
Sbjct  111   YLEKWIRKITSLTAGEAEFGVTFDWDKSMGIPGAFIIRNHHHSQFYLKTVTLEDVPGHGP  170

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             V F C SWVYP+ +Y Y+R+FFSN+ YLP QTP  L KYR+EELV+L+G+G+GELKEWDR
Sbjct  171   VKFVCNSWVYPSHRYMYDRVFFSNKTYLPCQTPLALLKYREEELVNLQGSGSGELKEWDR  230

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PDKG ++AR +LGG+ ++PYPRRGRTGR PTK DPN ESR+PLL SL+
Sbjct  231   VYDYAYYNDLGSPDKGPDHARQVLGGSKDFPYPRRGRTGRKPTKKDPNCESRLPLL-SLN  289

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+K +DFL YALKS+ Q +LPE +SL + T  EFDSF+D+L LYEGGIKL
Sbjct  290   IYVPRDERFSHIKFSDFLAYALKSLGQVVLPEIKSLGNKTFNEFDSFEDVLRLYEGGIKL  349

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P GP  + + D IP E+LKEL+R+DGE   KFP P VI+
Sbjct  350   PSGPKFSKLKDRIPWELLKELVRNDGERPLKFPMPDVIK  388



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   454 bits (1168),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/340 (66%), Positives = 267/340 (79%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDF D  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34    RKIKGTVVLMKKNVLDFTDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P +G 
Sbjct  93    YLEKWVATITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGYGR  152

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP  +Y Y+R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153   VHFICNSWVYPTHRYKYDRVFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  212

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG PDKG EYARPILGG  EYPYPRRGRTGR  TK DP+SE R+PL+ SLD
Sbjct  213   VYDYDYYNDLGSPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKNDPHSEQRLPLI-SLD  271

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+AQ LLPE  SL D T  EFD+F+D+LNLYEGGIKL
Sbjct  272   IYVPRDERFGHLKFSDFLAYALKSLAQVLLPETTSLCDKTINEFDTFEDVLNLYEGGIKL  331

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P GP ++ I D+IP EMLKEL+R+DGE LFKFP P VI+ 
Sbjct  332   PNGPTISKIRDHIPWEMLKELVRNDGERLFKFPKPDVIKA  371



>ref|XP_010674736.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=861

 Score =   454 bits (1167),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 211/348 (61%), Positives = 266/348 (76%), Gaps = 1/348 (0%)
 Frame = +2

Query  101   LAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGL  280
             L+  ++  K+IKG+VVLM+K VLDFNDF ASI+D   + LG+KVS +L S+V AD  N  
Sbjct  9     LSGNVTKKKEIKGRVVLMKKYVLDFNDFTASILDRFDELLGKKVSFQLASAVNADPENES  68

Query  281   KGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTL  460
             KGK  K +YL  W+   T L  GESAF I F W ED GVP A +I+N H N+FYLK++TL
Sbjct  69    KGKLGKPSYLGDWLTNFTGLTPGESAFSITFAWDEDIGVPGAIVIRNEHQNQFYLKSVTL  128

Query  461   EDVP-NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG  637
             ED P N G++HF C SW+YP  +Y  +RIFFSN+ YLP QTPAPL+KYR+EEL  LRG G
Sbjct  129   EDTPDNIGKIHFVCNSWIYPTQRYTKDRIFFSNKTYLPHQTPAPLRKYREEELEILRGNG  188

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
              G+L+EWDRVYDYAYYNDLGDPDKG +Y RP+LGG++E+PYPRRGRT R P+KTDPN+ES
Sbjct  189   EGKLEEWDRVYDYAYYNDLGDPDKGPKYVRPVLGGSAEFPYPRRGRTSRPPSKTDPNTES  248

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
             R+PL+  LD+YVPRDEKFGHLK++DFL YALKS++Q  +   ES+FD  P EFDSFQD L
Sbjct  249   RLPLVKGLDVYVPRDEKFGHLKMSDFLGYALKSLSQDFVAGLESIFDKNPNEFDSFQDEL  308

Query  998   NLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LYEGG+KLP+  ++  I ++IP E LK  ++SDG  + KFP P VI+
Sbjct  309   DLYEGGVKLPESDIINKIKESIPFEFLKAFLQSDGAPILKFPMPDVIK  356



>gb|KCW61801.1| hypothetical protein EUGRSUZ_H044981, partial [Eucalyptus grandis]
Length=795

 Score =   451 bits (1161),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 247/290 (85%), Gaps = 0/290 (0%)
 Frame = +2

Query  272   NGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKT  451
             N L+GK  K A+L+ W+   T L +G+SAFK+ F W ++ GVP A I++NNH ++FYLKT
Sbjct  1     NCLRGKLGKPAHLEGWITTITPLTTGDSAFKVTFNWDKEVGVPGAIIVQNNHHSQFYLKT  60

Query  452   LTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG  631
             +TLEDVP  G VHF C SWVYPA++Y  +R+FFSN+ YLPSQTPAPL KYR+EELV+LRG
Sbjct  61    ITLEDVPGEGRVHFVCNSWVYPANQYKKDRVFFSNKTYLPSQTPAPLVKYREEELVNLRG  120

Query  632   TGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNS  811
              GTGEL+EWDRVYDYAYYNDLGDPDKG++YARP+LGG+SEYPYPRRGRTGR PT+TDPN+
Sbjct  121   DGTGELQEWDRVYDYAYYNDLGDPDKGSKYARPVLGGSSEYPYPRRGRTGRPPTETDPNT  180

Query  812   ESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQD  991
             ESR+PLL SL+ YVPRDE+FGHLK++DFL YALK+V QFL PE ES+FDSTP EFDSFQD
Sbjct  181   ESRLPLLMSLNTYVPRDERFGHLKMSDFLAYALKAVGQFLKPELESIFDSTPNEFDSFQD  240

Query  992   ILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LNLYEGGIKLP  PLL ++ +NIPLEMLK L R+DGEGL ++P PQVI+
Sbjct  241   VLNLYEGGIKLPNCPLLESLKENIPLEMLKILFRTDGEGLLEYPMPQVIK  290



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   456 bits (1172),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 264/342 (77%), Gaps = 9/342 (3%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  K A
Sbjct  112   KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167   YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TGTGELKE  655
             VHF C SWVYP  KY  +R+FF+N+ YLPS+TP PL+KYR+EELVHLRG    G GEL+E
Sbjct  227   VHFVCNSWVYPTEKYTKDRVFFTNKTYLPSETPLPLRKYREEELVHLRGDDEKGKGELQE  286

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDY  YNDLG+PDKGA+Y RPILGG+SEYPYPRRGRTGR  TKTD  SESR+PL  
Sbjct  287   WDRVYDYDCYNDLGNPDKGAKYVRPILGGSSEYPYPRRGRTGRQKTKTDEKSESRLPLAE  346

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLKL+DFL YALKS+AQF+ PE ESL D TP EFDSF+D+  LYEGG
Sbjct  347   SLNIYVPRDERFGHLKLSDFLVYALKSIAQFIKPELESLLDQTPNEFDSFEDVRKLYEGG  406

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP+G LL  I D+IP EM KE+ R+D   L KFP PQVI+
Sbjct  407   IPLPEG-LLQHIGDSIPSEMFKEIFRTDDAKLLKFPMPQVIK  447



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   453 bits (1166),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/342 (65%), Positives = 276/342 (81%), Gaps = 3/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGN---GLKGKRS  295
             KKIKG+VVLM+KNVLDFNDF+A+I+D + +  GQKVSL+LV++V  D  +   GL+G+  
Sbjct  17    KKIKGRVVLMKKNVLDFNDFHANILDGVHELFGQKVSLQLVTAVHGDGHHPDKGLEGRLG  76

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
               AYL+ WV   T+L +GESAF +EF+W E+ GVP AFI+KN H +EFYLKTLT+E VP 
Sbjct  77    NPAYLEDWVRTGTILDAGESAFDVEFDWDEELGVPGAFIVKNFHHSEFYLKTLTIEHVPG  136

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG VHF C SWVYP  KY  +R+FF NQ YLPS+TP  L+KYR+EELV LRG G GELKE
Sbjct  137   HGRVHFICNSWVYPTDKYKKDRVFFVNQTYLPSETPTALRKYREEELVELRGDGNGELKE  196

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYA YNDLG PD G+ +ARP+LGG++++PYPRRGRTGR PT++DPN+ESR+PL+T
Sbjct  197   WDRVYDYALYNDLGVPDLGSHFARPVLGGSTKFPYPRRGRTGRRPTRSDPNTESRLPLVT  256

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLKL+DFL YALKSV Q LLPEF++L DSTP EFD+ +D L LYE G
Sbjct  257   SLNIYVPRDERFGHLKLSDFLGYALKSVVQVLLPEFQALHDSTPNEFDTMEDFLKLYEKG  316

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP G L+    DN+PLE+++E+ RSDGEG  KFPTP +I+
Sbjct  317   IQLPGGDLVKDFTDNLPLELIREIFRSDGEGFLKFPTPAIIK  358



>gb|KFK35599.1| hypothetical protein AALP_AA4G012300 [Arabis alpina]
Length=856

 Score =   453 bits (1165),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 213/338 (63%), Positives = 262/338 (78%), Gaps = 4/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  +G KGK  KA +
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDLTD-PDGSKGKLGKAGH  76

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++  DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  77    LEDWITTITSLTAGESAFKVTFDYDSDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  136

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA  Y  +R+FFSN+ YLP +TPA L KYR+EELV LRGTG GELKEWDRV
Sbjct  137   HYLCNSWVYPAKNYAKDRVFFSNKTYLPHETPATLLKYREEELVSLRGTGKGELKEWDRV  196

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P       RP+LGG  EYPYPRRGRTGR PTK DP +ESR+P+ +SLDI
Sbjct  197   YDYAYYNDLGVPPNN---PRPVLGGTPEYPYPRRGRTGRNPTKEDPQTESRLPVTSSLDI  253

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  E++FD TP EFDSF+D+L +YE GI LP
Sbjct  254   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALEAVFDDTPKEFDSFEDVLKIYEEGIDLP  313

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L+ +I  NIPLEMLKE+ R+DG+   ++P PQVI+
Sbjct  314   NQSLIDSIVKNIPLEMLKEIFRTDGQKFLRYPVPQVIK  351



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   462 bits (1188),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 215/338 (64%), Positives = 264/338 (78%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D L +FLG KV+L L+SS   D  NG  GK  KAA+
Sbjct  18    KVKGTVVLMKKNVLDFNDFNASFLDRLHEFLGNKVTLRLISSDVTDPENGSNGKLGKAAH  77

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L +GESAFK+ F++ +DFG P AF+I+N+H +EFYLK+LTLEDVP HG V
Sbjct  78    LEDWITTITSLTAGESAFKVTFDYDQDFGYPGAFLIRNSHFSEFYLKSLTLEDVPGHGRV  137

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             H+ C SWVYPA +Y  +R+FFSN+ YLP +TP  L KYR+EELV LRGTG GELKEWDRV
Sbjct  138   HYICNSWVYPAKRYTKDRVFFSNKTYLPHETPEALLKYREEELVSLRGTGEGELKEWDRV  197

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P K     RP+LGG+ EYPYPRRGRTGR PT  DP +ESR+P+ +SLDI
Sbjct  198   YDYAYYNDLGVPPKN---PRPVLGGSQEYPYPRRGRTGRKPTTEDPETESRLPVTSSLDI  254

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL YALK++AQ + P  ES+FD TP EFDSF+D+L +YE GI LP
Sbjct  255   YVPRDERFGHLKMSDFLAYALKAIAQIIQPALESVFDETPKEFDSFEDVLKIYEEGIDLP  314

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L+ +I  NIPLEMLKE+ R+DG+   K+P PQVI+
Sbjct  315   NQALIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIK  352


 Score =   405 bits (1042),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 233/306 (76%), Gaps = 4/306 (1%)
 Frame = +2

Query  227   KVSLELVSSVQADLG-NGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPA  403
             ++     S +  DL  NG  GK  KAA+L+ W+   T L +GESAFK+  ++ +DFG P 
Sbjct  396   RIHTSFNSLIHCDLAENGSNGKLGKAAHLEDWITTITSLTAGESAFKVRIDYDQDFGYPG  455

Query  404   AFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTP  583
             AF+I+N+H +EFYLK+LTLEDVP HG VH+ C SWVYPA +Y  +R+FFSN+ YLP +TP
Sbjct  456   AFLIRNSHFSEFYLKSLTLEDVPGHGRVHYICNSWVYPAKRYTKDRVFFSNKTYLPHETP  515

Query  584   APLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYP  763
              PL KYR+EELV LRGTG GELKEWDRVYDYAYYNDLG P K     RP+LGG+ EYPYP
Sbjct  516   EPLLKYREEELVSLRGTGEGELKEWDRVYDYAYYNDLGVPPKN---PRPVLGGSQEYPYP  572

Query  764   RRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEF  943
             RRGRTGR PT  DP +ESR+P+ +SLDIYVPRDE+FGHLK++DFL YALK++AQ + P  
Sbjct  573   RRGRTGRKPTTEDPETESRLPVTSSLDIYVPRDERFGHLKMSDFLAYALKAIAQIIQPAL  632

Query  944   ESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFP  1123
             ES+FD TP EFDSF+D+L +YE GI LP   L+ +I  NIPLEMLKE+ R+DG+   K+P
Sbjct  633   ESVFDETPKEFDSFEDVLKIYEEGIDLPNQALIDSIVKNIPLEMLKEIFRTDGQKFLKYP  692

Query  1124  TPQVIQ  1141
              PQVI+
Sbjct  693   VPQVIK  698



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   453 bits (1166),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 220/367 (60%), Positives = 269/367 (73%), Gaps = 25/367 (7%)
 Frame = +2

Query  113   LSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK--  283
             +S + +I+GKVVLM+KNVLDFND  AS VD + + LG+ VS++L+S+   +   NGLK  
Sbjct  22    VSGSNRIRGKVVLMKKNVLDFNDLKASFVDRIHELLGKGVSMQLISANHPEAAANGLKSR  81

Query  284   GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             GK  K AYL+ W    T L++GE++F I  +W E  G P A +I+N+H ++FYLKT+TLE
Sbjct  82    GKLGKVAYLEKWATTITSLSAGETSFTISLDWDESHGAPGALLIRNHHHSQFYLKTITLE  141

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++HF C SWVYPA +Y Y RIFF N+AYLPSQTP  L  YR+EEL +LRG+G+G
Sbjct  142   DVPEHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLPSQTPELLHPYREEELANLRGSGSG  201

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTK---------  796
             ELKEWDRVYDYAYYNDLG PDKG +YARPILGG+ EYPYPRRGRTGR  +K         
Sbjct  202   ELKEWDRVYDYAYYNDLGSPDKGPKYARPILGGSYEYPYPRRGRTGRKTSKTEHERHEEF  261

Query  797   ------------TDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPE  940
                         TDPNSESR+PLL SLDIYVPRDE+FGH+K +DFL Y LKS+ Q LLPE
Sbjct  262   LRFYDQFSFMLRTDPNSESRLPLL-SLDIYVPRDERFGHVKFSDFLAYGLKSLVQILLPE  320

Query  941   FESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKF  1120
              +SL D T  EFD+F D++NLYEGGIKLP GP L  + + IP E+LKELIRSDGE   KF
Sbjct  321   LKSLCDKTINEFDTFDDVVNLYEGGIKLPNGPTLKKLRERIPWELLKELIRSDGERFLKF  380

Query  1121  PTPQVIQ  1141
             P P VI+
Sbjct  381   PMPDVIK  387



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   452 bits (1162),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 261/341 (77%), Gaps = 3/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA---DLGNGLKGKRSK  298
             K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A   D     +GK  K
Sbjct  22    KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAESYRGKVGK  81

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+ W+ K + L +G++A+ + FEW+ + GVP AF I N H NEFYLKTLTLEDVP H
Sbjct  82    KAYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGH  141

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SWVYP+  Y  +RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EW
Sbjct  142   GRVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEW  201

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDY  YNDLGDPDKG E+ RPILGG+ E+PYPRRGRTGR P  +DP  ESRIPL  S
Sbjct  202   DRVYDYDIYNDLGDPDKGPEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNS  261

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L IYVPRDE+F  LK++DF+ YALKS+ QFL PEF++LFD TP EFDSF+D+L LY+GGI
Sbjct  262   LSIYVPRDERFSQLKMSDFVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGI  321

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             K+    L+  I + IPLEM+KEL+RSDGE  FKFP PQVI+
Sbjct  322   KVSNDSLMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIK  362



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 264/340 (78%), Gaps = 2/340 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             ++KG V+LM+KNVLDF DF+AS+ D L +FLG+ VS +LVSS  AD  NG KGK  +  Y
Sbjct  5     RVKGTVILMKKNVLDFTDFHASLHDRLDEFLGKGVSFQLVSSTIADPNNGNKGKVGEPGY  64

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             ++ W+ K T +A+GES F++ F+W E  G+P A I++N+H +EFYLKTLTLE  P +G +
Sbjct  65    IEEWITKITSIAAGESKFQVTFQWDESEGIPGAVIVRNHHHSEFYLKTLTLEHFPGNGRI  124

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  664
             HF C SWVYP   Y Y+RIFF+N  YLP  TPAPL+ YR+EELVHLRG   TGELKE+ R
Sbjct  125   HFVCNSWVYPVDYYTYDRIFFANHTYLPINTPAPLQAYRNEELVHLRGDNITGELKEFQR  184

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             +YDYAYYNDLGDPD G+ YARP+LGG+ ++PYPRRGRTGR PT+TDP +ESR+P L SLD
Sbjct  185   IYDYAYYNDLGDPDNGSNYARPVLGGSEQFPYPRRGRTGRPPTRTDPKTESRLPGL-SLD  243

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK++DFL YA+K++ Q LLP  ++L D TP EF+S QD+LNLYEGGI+L
Sbjct  244   IYVPRDERFGHLKMSDFLAYAIKALVQSLLPVLKALLDKTPFEFNSLQDVLNLYEGGIQL  303

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P+   L  I D IP EM+KEL++++GE L K P PQVIQ 
Sbjct  304   PECAELDEIKDRIPFEMIKELVQTNGEHLLKLPMPQVIQA  343



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   449 bits (1156),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 264/341 (77%), Gaps = 6/341 (2%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+ NVLDFNDF+AS++D + +FLGQ VSL+L+S    D   G +GK  K A
Sbjct  19    KKIKGTVVLMKNNVLDFNDFHASVLDRVHEFLGQGVSLQLIS---GDSSTGSQGKLGKVA  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++W+     + +GE+ FK+ F+   D GVP AF+I+NNH ++F+LKT+TLEDVP+ G 
Sbjct  76    YLENWIGTLGPVTAGETTFKVTFDVEGDIGVPGAFVIRNNHHSQFFLKTVTLEDVPSAGH  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             + F C SWVYPASKY  +R+FF+N+ YLPS TP PL+KYR +EL  LRG GTGEL+EWDR
Sbjct  136   ILFVCNSWVYPASKYKKDRVFFANKTYLPSDTPLPLRKYRQQELEQLRGNGTGELEEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPL--LTS  838
             VYDYA YNDLGDPDKG++Y R  LGG+SEYPYPRRGRTGR+PT+TDPN ES+IPL  L  
Sbjct  196   VYDYACYNDLGDPDKGSKYVRQTLGGSSEYPYPRRGRTGRSPTRTDPNCESKIPLVDLLR  255

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             LDIYVPRDE+FGHLK++DF+ Y LKS+AQ + P  +S FD TP EFDSFQD+LNLY+GG 
Sbjct  256   LDIYVPRDERFGHLKMSDFIAYGLKSLAQSVKPALQSKFDKTPNEFDSFQDVLNLYDGGF  315

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              +P+G L   + D IPL M KE+ R+DGE   KFP PQVI+
Sbjct  316   PMPEG-LFKDVGDKIPLTMFKEIFRTDGERFLKFPVPQVIK  355



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   449 bits (1155),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/349 (61%), Positives = 259/349 (74%), Gaps = 1/349 (0%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             K    +   KKI+G VVLM+K  LD ND  AS+ D   + LG KVSL+L+S+V  D    
Sbjct  12    KTKHEVGEIKKIQGTVVLMKKKFLDSNDLTASVTDRFDEILGNKVSLQLISAVNGDPEKE  71

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  457
             L+GK  K A L+ W  K T L +    F + FEW E+ GVP AFIIKN+H NEFYLKT+T
Sbjct  72    LRGKLGKPANLEDWDTKITALTAPGVTFNVTFEWEEEIGVPGAFIIKNSHHNEFYLKTVT  131

Query  458   LEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG  637
             LEDVP HG VHF C SWVYPAS Y  +R+FF+NQ YLP++TPAPL+ YR+EEL+ LRG G
Sbjct  132   LEDVPGHGRVHFVCNSWVYPASCYKKDRVFFTNQTYLPTETPAPLRCYREEELLTLRGNG  191

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
              G+L+EWDRVYDY  YNDL +P+KG ++ RPILGG+SEYPYPRRGRTGR P +TDP  ES
Sbjct  192   NGKLEEWDRVYDYDIYNDLSEPEKGPKHVRPILGGSSEYPYPRRGRTGRPPAETDPRHES  251

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
             RIPL  SL IYVPRDE+F HLK +D + Y LKS  QF++PE E+ FDSTP+EFD F+DIL
Sbjct  252   RIPLFKSLSIYVPRDERFSHLKFSDLVAYGLKSAVQFIVPEVEAQFDSTPSEFDKFEDIL  311

Query  998   NLYEGGI-KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              LYE GI K+P  PLL +I + IPL+ LKEL+R+DGE  F+FPTPQVI+
Sbjct  312   QLYEKGIKKVPNFPLLESIRNQIPLQTLKELLRTDGEQPFRFPTPQVIK  360



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score =   450 bits (1158),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 262/342 (77%), Gaps = 9/342 (3%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVL++KN LDFND  AS++D + +  G+ VSL+L+SS      NGLKGK  K A
Sbjct  112   KKIKGRVVLIKKNFLDFNDLKASVLDRVHELFGEGVSLQLISS-----ENGLKGKLGKPA  166

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+   T L  GESAF++ F+  E+ GVP A +IKNNH +EF+LKT+TLE+VP    
Sbjct  167   YLEDWITTITSLTPGESAFEVTFDHEEEVGVPGAILIKNNHHSEFFLKTVTLENVPGEDR  226

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TGTGELKE  655
             +HF C SWVYP  KY  +R+FF+N+ YLPS+TP PL+KYR+EELVHLRG    G GEL+E
Sbjct  227   LHFVCNSWVYPTEKYTKDRVFFTNKTYLPSETPLPLRKYREEELVHLRGDDEKGKGELQE  286

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDY  YNDLG+PDKGA+Y RPILGG+SEYPYPRRGRTGR  TKTD  SESR+PL  
Sbjct  287   WDRVYDYDCYNDLGNPDKGAKYVRPILGGSSEYPYPRRGRTGRQKTKTDEKSESRLPLAE  346

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLKL+DFL YALKS+AQF+ PE ESL D TP EFDSF+D+  LYE G
Sbjct  347   SLNIYVPRDERFGHLKLSDFLVYALKSIAQFIKPELESLLDQTPNEFDSFEDVXKLYEXG  406

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP+G LL  I D+IP E  KE+ R+D   L KFP PQVI+
Sbjct  407   IPLPEG-LLXHIGDSIPSEXFKEIFRTDDAKLLKFPMPQVIK  447



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   449 bits (1154),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/340 (62%), Positives = 260/340 (76%), Gaps = 2/340 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA--DLGNGLKGKRSKA  301
             K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A        +GK  K 
Sbjct  22    KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSESYRGKVGKK  81

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+ K + L +G++A+ + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG
Sbjct  82    AYLEDWITKISPLTAGDTAYDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHG  141

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYP+  Y  +RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWD
Sbjct  142   RVHFICNSWVYPSEYYKKDRIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWD  201

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY  YNDLGDPDKG E+ RPILGG+ E+PYPRRGRTGR P  +DP  ESRIPL  SL
Sbjct  202   RVYDYDIYNDLGDPDKGPEHVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNSL  261

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
              IYVPRDE+F  LK++DF+ YALKS+ QFL PEF++LFD TP EFDSF+D+L LY+GGIK
Sbjct  262   SIYVPRDERFSQLKMSDFVAYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGIK  321

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +    L+  I + IPLEM+KEL+RSDGE  FKFP PQVI+
Sbjct  322   VSNDSLMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIK  361



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   448 bits (1153),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/341 (63%), Positives = 265/341 (78%), Gaps = 2/341 (1%)
 Frame = +2

Query  116   SPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRS  295
             S   +++G VVLM+K+VLDFNDF AS++D L +F+G+ VSL+LVS+V  D  NGLKGK  
Sbjct  14    SNRHQVEGTVVLMKKSVLDFNDFTASMLDGLHEFVGKGVSLQLVSTVNTDSENGLKGKLG  73

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             K A LD W   +  L++GES FK+ F+W E+ G P AF+I NNH NEFYLK+LTL+ VP 
Sbjct  74    KPANLD-WSTASKPLSTGESTFKVSFDWDEEIGTPGAFLIWNNHDNEFYLKSLTLKGVPG  132

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
                +HF C SWVYPA  Y  +RIFFSN+ YLPS+TP  L KYR+EEL  LRG G G+L++
Sbjct  133   QDVIHFVCNSWVYPAKNYVKDRIFFSNKTYLPSETPTTLLKYREEELETLRGDGKGQLEK  192

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYA YNDLG+PDKG E++RPILGG++EYPYPRRGRTGR P K+DPN E+R+ L  
Sbjct  193   WDRVYDYACYNDLGNPDKGLEHSRPILGGSAEYPYPRRGRTGREPAKSDPNYETRLDLEM  252

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL IYVPRDEKFGHLK++DFL YALKS+ Q L PE ESLFDSTP EFDSF+D+L LYE G
Sbjct  253   SLKIYVPRDEKFGHLKMSDFLAYALKSIVQVLKPELESLFDSTPNEFDSFEDVLKLYESG  312

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             I +P+G LL  + +NI  E+LKE++R+DGE L KFP PQVI
Sbjct  313   IDVPEG-LLKDVRENIHGEILKEILRTDGEKLLKFPLPQVI  352



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   448 bits (1153),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 263/340 (77%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDFND  AS +D + + LG+ VS++LVS+V  D  +GL+GK  K A
Sbjct  34    RKIKGTVVLMKKNVLDFNDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDGLRGKLGKVA  92

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ WV   T L +GE+ F I FEW E  G P A IIKN+H ++ YLKT+TLED+P HG 
Sbjct  93    YLEKWVTTITPLTAGETMFTITFEWDESMGFPGAIIIKNHHHSQLYLKTVTLEDIPGHGR  152

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             VHF C SWVYP  +Y Y+R FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153   VHFICNSWVYPTHRYKYDRAFFSNKAYLPCQTPEPLRLYREEELINLRGNGKGELKEWDR  212

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG PDKG  YARPILGG  E+PYPRRGRTGR  TK DP+ E R+PL+ SLD
Sbjct  213   VYDYDYYNDLGSPDKGEGYARPILGGTEEHPYPRRGRTGRRKTKNDPHCEQRLPLI-SLD  271

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFD+F+D+LNLYEGGIKL
Sbjct  272   IYVPRDERFGHLKFSDFLAYALKSLGQVLLPEITSLCDKTINEFDTFEDVLNLYEGGIKL  331

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P GP ++ I D+IP EMLKEL+R+DGE L KFP P VI+ 
Sbjct  332   PNGPTISKIRDHIPWEMLKELVRNDGERLLKFPKPDVIKA  371



>ref|XP_010549787.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=861

 Score =   447 bits (1151),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 256/338 (76%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             K+KG VVLM+KNVLDFNDFNAS +D+L +FLG KV+L L+SS  AD  NG KGK  K A+
Sbjct  20    KVKGMVVLMKKNVLDFNDFNASFLDHLHEFLGNKVTLRLISSDVADSENGSKGKLGKPAH  79

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+   T L  GESAFK+ F+    FG P AF I+NNH +EFYLK+LTLEDVP HG V
Sbjct  80    LEDWITTVTPLTVGESAFKVTFDCENGFGFPGAFTIRNNHFSEFYLKSLTLEDVPGHGTV  139

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYPA  Y  +R+FF N+ YLPSQTP PL  YR+EELV LRGTG GELKEWDRV
Sbjct  140   HFVCNSWVYPAKNYKKDRVFFCNKTYLPSQTPEPLLTYREEELVALRGTGEGELKEWDRV  199

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG P K     RP+LGG+ EYPYPRRGRTGR PTK DPN+ES++P+ +SL++
Sbjct  200   YDYAYYNDLGVPPKN---PRPVLGGSEEYPYPRRGRTGRKPTKEDPNTESKLPITSSLNV  256

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK++DFL + LK++ Q + P  E++FD TP EFDSF+D+L +YE GI LP
Sbjct  257   YVPRDERFGHLKMSDFLAFNLKAIVQIIQPALEAVFDETPKEFDSFEDVLEIYEKGIDLP  316

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                    I +NIP E+L+E+ R+DG    K+P PQ+I+
Sbjct  317   NQSFFDEIRNNIPFELLREIFRTDGAKFLKYPKPQIIK  354



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   447 bits (1150),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 259/340 (76%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQAD-LGNGLKGKRSKA  301
             KKI+G VVLM+KNVLD  D NASI D + +FLGQ VSL+LVS+V +D   N  KGK  K 
Sbjct  19    KKIRGTVVLMKKNVLDLTDLNASIHDRVHEFLGQGVSLQLVSAVNSDPSANDFKGKLGKP  78

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             AYL+ W+   T L +GE+AFK+ F W E+ G+P A ++KNNH +EFYLKT+TLE VP  G
Sbjct  79    AYLEKWITTVTPLTAGETAFKVTFNWDEEIGIPGALLVKNNHQSEFYLKTVTLEGVPGLG  138

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SW+YPA  Y+  RIFF+N+ YLP +TPAPL+KYR+EEL HLRG G GELKEWD
Sbjct  139   RVHFVCKSWIYPAEHYSKPRIFFTNKTYLPHETPAPLRKYREEELFHLRGNGEGELKEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY +YNDLG   KG+EY RP+LGG+SEYPYPRRGRTGR   + DP++ESR+PLL SL
Sbjct  199   RVYDYDFYNDLGSSKKGSEYFRPVLGGSSEYPYPRRGRTGRK-KEADPHTESRLPLLKSL  257

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
              IYVPRDE+FGHLKLADFL YALK+VAQ +    ++  D+TP EFDSF D+L LYEGG +
Sbjct  258   SIYVPRDERFGHLKLADFLAYALKTVAQVVKNGVDTFVDTTPNEFDSFDDVLKLYEGGYE  317

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP  PLL  I    PLE L+E+ R+DGE  F+FP PQVI+
Sbjct  318   LPHVPLLDNIRKIFPLEFLEEIFRTDGERFFEFPKPQVIK  357



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   448 bits (1152),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 265/341 (78%), Gaps = 2/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVS--SVQADLGNGLKGKRSK  298
             K +KG VVLM+KN+L+ ND  ASIVD++ + LG+KV+L+L++  S+  D    LKGK  K
Sbjct  118   KTMKGIVVLMKKNLLEVNDIAASIVDSVDEILGRKVALQLITTASLDHDSEENLKGKPGK  177

Query  299   AAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
              AYL+  + K   L +G++ + + FEW+++ G+P AF + N H +EFYLKTLTLED+P H
Sbjct  178   IAYLEDLITKIGPLTAGDATYTVTFEWTKEMGIPGAFTVTNFHHSEFYLKTLTLEDIPGH  237

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G VHF C SWVYPA  Y  +R+FF+NQ YLP+QTPA L++YR+EEL +LRG GTG+L+EW
Sbjct  238   GRVHFVCNSWVYPAQYYKTDRVFFANQTYLPNQTPARLRRYREEELQNLRGNGTGKLEEW  297

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDY  YNDLGDPDK  ++ R ILGG++EYPYPRRGRTGR    +DPNSESRIPL  S
Sbjct  298   DRVYDYDIYNDLGDPDKSPKHVRSILGGSTEYPYPRRGRTGRPLASSDPNSESRIPLYQS  357

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L IYVPRDE+F HLK++DF+ YALKS+ QFL PEFE+LFD TP EFDS +D+L LYEGGI
Sbjct  358   LSIYVPRDERFSHLKMSDFVAYALKSIFQFLAPEFEALFDKTPEEFDSLEDVLQLYEGGI  417

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             K+P G LL  I+++IP E +KELIRSDGE  FKFP PQVI+
Sbjct  418   KVPNGSLLEKISEHIPFETIKELIRSDGEKSFKFPLPQVIK  458



>ref|XP_006607065.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like, partial 
[Glycine max]
Length=436

 Score =   431 bits (1108),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 199/341 (58%), Positives = 266/341 (78%), Gaps = 5/341 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  K 
Sbjct  4     SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62    AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G V+F C SW+YPA +Y ++R+FF+N+AYLP QTP PL+K+R++EL+ LRG G G+L EW
Sbjct  122   GPVNFVCNSWIYPAHRYAHDRVFFANKAYLPYQTPEPLRKFREQELIALRGKGFGKLNEW  181

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG PD G +YARP+LGG S+ PYPRRGRTGR   KTDP +ESR+ LL +
Sbjct  182   DRVYDYAYYNDLGLPDDGPDYARPVLGG-SQCPYPRRGRTGRPHCKTDPKTESRLRLL-N  239

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FGH+K +DFL Y+LKSVAQ LLPE +SL D T  EFD+F+D+L++YEG I
Sbjct  240   LNVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFEDVLDIYEGSI  299

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP GPL + + + +P E+L+ELIR+DGE   KFP P VI+
Sbjct  300   KLPSGPLASKLRELVPYELLRELIRNDGERFLKFPVPDVIK  340



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   443 bits (1139),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 218/342 (64%), Positives = 269/342 (79%), Gaps = 6/342 (2%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRS  295
              KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  
Sbjct  32    CKKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIG  91

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             K A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP 
Sbjct  92    KLAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPG  151

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
              G VHF C SWVYPA  YN +RIFF+N+ YLP+QTP PL+ YR++ELV+LRG GT EL+E
Sbjct  152   EGRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDGTTELQE  211

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
              DRVYDYAYYNDLGDP KG ++ RP+LGG+++YPYPRRGRTGR   + D  SESR+ ++ 
Sbjct  212   HDRVYDYAYYNDLGDPKKGKKFERPVLGGSADYPYPRRGRTGRKLAE-DSKSESRLSIVY  270

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFL +ALKS+AQ + P  ESL DS+P EFDSF DIL LYEGG
Sbjct  271   SLNIYVPRDERFGHLKMSDFLAFALKSIAQVIKPALESL-DSSPNEFDSFDDILKLYEGG  329

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   LL  I  +IP EMLKE+ R+DG+ L KFP PQVI+
Sbjct  330   IDLPNN-LLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIK  369



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   442 bits (1138),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 260/339 (77%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  30    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  89

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  90    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  149

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++LRG+G+G LKEWDR
Sbjct  150   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  209

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG E  RP+LGG+ EYPYPRRGRT R PTKTDPNSESR+P L  L+
Sbjct  210   VYDYAFYNDLGFPDKGPESVRPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPL-GLN  268

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  269   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  328

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  329   PDHH-LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  366



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   442 bits (1138),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 260/339 (77%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  40    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAESGNGCKGKLGKPA  99

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  100   FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  159

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++LRG+G+G LKEWDR
Sbjct  160   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLRGSGSGMLKEWDR  219

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG E  RP+LGG+ EYPYPRRGRT R PTKTDPNSESR+P L  L+
Sbjct  220   VYDYAFYNDLGFPDKGPESVRPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPL-GLN  278

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  279   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  338

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  339   PDHH-LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  376



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 260/339 (77%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  27    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  86

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  87    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  146

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++L G+G+G LKEWDR
Sbjct  147   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  206

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG E ARP+LGG+ EYPYPRRGRT R PTKTDPNSESR+P L  L+
Sbjct  207   VYDYAFYNDLGFPDKGPESARPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPL-GLN  265

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  266   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  325

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  326   PDHH-LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  363



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   442 bits (1136),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 260/339 (77%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  37    KKVRGTVVLMKKNVLDLKDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  96

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HG+
Sbjct  97    FLEKWMSTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVILEDVPGHGQ  156

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y R+FFSN+ YLPS TP PL+ YR+EEL++L G+G+G LKEWDR
Sbjct  157   LHFVCNSWVYPAHRYKYNRVFFSNKTYLPSNTPEPLRPYREEELLNLHGSGSGMLKEWDR  216

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG E ARP+LGG+ EYPYPRRGRT R PTKTDPNSESR+P L  L+
Sbjct  217   VYDYAFYNDLGFPDKGPESARPVLGGSKEYPYPRRGRTSRRPTKTDPNSESRLPPL-GLN  275

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  276   IYVPRDERFTHVKLSDFLAYAVKSLGQVLIPEIVALFDKTFNEFDSFEDVLKLYEGGIKL  335

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  336   PDHH-LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  373



>ref|XP_010667400.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=895

 Score =   442 bits (1137),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/338 (62%), Positives = 259/338 (77%), Gaps = 4/338 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGL-KGKRSKAAY  307
             IKG +VLM+KNVLD  D +ASI+D + +  G+ VSL+L+S+ Q++    + +GK  KA+Y
Sbjct  51    IKGTIVLMKKNVLDMTDVSASILDKIHELGGKGVSLQLISADQSNEPARISRGKLGKASY  110

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             ++ WV   T L +GE+ F I F+W E   VP AFIIKN H ++FYLKT+TL DVP HG V
Sbjct  111   VEKWVSTITPLTAGETTFNITFDWHESMDVPGAFIIKNYHRSQFYLKTVTL-DVPGHGGV  169

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y R+FFSN+ YLP QTP  L+ YR+EELV+LRG G G LKEWDRV
Sbjct  170   HFVCNSWVYPTHRYRYNRVFFSNKTYLPHQTPEALRIYREEELVNLRGDGKGMLKEWDRV  229

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY YYNDLG PDKG EYARP+LGG++EYPYPRRG+TGR PTK DPN+ESR+PLL SLDI
Sbjct  230   YDYDYYNDLGMPDKGEEYARPVLGGSTEYPYPRRGKTGRKPTKADPNTESRLPLL-SLDI  288

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGH+K +DFL YA+KS+AQ LLPE +S+ D TP EFDSF+D++ LYEGGI LP
Sbjct  289   YVPRDERFGHIKFSDFLAYAMKSIAQILLPELKSICDKTPNEFDSFEDVMKLYEGGITLP  348

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              G  L  + D IP EMLKEL R+DGE   KFP P VI+
Sbjct  349   DGA-LKKLKDRIPWEMLKELFRTDGEQFLKFPMPDVIK  385



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   441 bits (1135),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 264/340 (78%), Gaps = 1/340 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   K A
Sbjct  34    RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQDPADSLRGTLGKVA  93

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  94    YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  153

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             + F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  154   LLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  213

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG+PDKG EYARPILGG  EYPYPRRGRTGR  TKTDP++E R+PL+ SLD
Sbjct  214   VYDYDYYNDLGNPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKTDPHTEKRLPLI-SLD  272

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+ Q LLPE +SL D T  EFD+F+D+LNLYEGG+KL
Sbjct  273   IYVPRDERFGHLKFSDFLAYALKSLVQILLPEIKSLCDKTINEFDTFEDVLNLYEGGLKL  332

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P  P L  I D+IP EML EL+R+DGE   KFP P VI+ 
Sbjct  333   PNKPTLHKIRDHIPWEMLGELVRNDGERFLKFPKPDVIKA  372



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   439 bits (1130),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 265/341 (78%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI G+VVLM+ NVLDF+DFNAS++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8     KKILGEVVLMKSNVLDFDDFNASLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ W+   T L +GE+ FK+ F+W E+  G+P AF I N+H  +FYLK+LTL+ VP HG
Sbjct  68    YLEEWITTITPLTTGEATFKVTFDWDEEHMGIPGAFFITNHHHTQFYLKSLTLQHVPPHG  127

Query  482   E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
               + F C SW+YP+ +YN +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128   TTLFFPCNSWIYPSHRYNKDRIFFVNQSYLPSETPEPLRKFREDELQSLRGDGNGELQEW  187

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYA YNDL DPDK  +YARP+LGG++ YPYPRRGRTGR PTK+DP +ESRIPL+ S
Sbjct  188   DRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPLVKS  247

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FGHLKL+DFL YALK+V+Q + P  E  F+  P EFDS QD+L+LYEGG 
Sbjct  248   LNVYVPRDERFGHLKLSDFLAYALKAVSQVIKPGLEEYFEGIPGEFDSLQDVLDLYEGGF  307

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              +P+G L   I +NI    LKE+ R+DGE LFKFP PQVI+
Sbjct  308   PVPEG-LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIK  347



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   440 bits (1131),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 268/342 (78%), Gaps = 6/342 (2%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGLK-GKRS  295
              KKIKG VVLM+KNVLDFNDFNAS +D   + LG+KV+L+L+S+V  +   NGL+ GK  
Sbjct  32    CKKIKGTVVLMKKNVLDFNDFNASFLDRFHELLGRKVTLQLISAVHGEPAENGLQAGKIG  91

Query  296   KAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             K A+++ W+ K T LA+GESAF + FEW ED GVP AF+I+NNH +EFYLKTLTLEDVP 
Sbjct  92    KLAHIEGWIPKCTPLAAGESAFNVTFEWDEDIGVPGAFLIRNNHHSEFYLKTLTLEDVPG  151

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
              G VHF C SWVYPA  YN +RIFF+N+ YLP+QTP PL+ YR++ELV+LRG  T EL+E
Sbjct  152   EGRVHFVCNSWVYPAKDYNTDRIFFTNKTYLPTQTPGPLRYYREQELVNLRGDVTTELQE  211

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
              DRVYDYAYYNDLGDP KG ++ RP+LGG+++YPYPRRGRTGR   + D  SESR+ ++ 
Sbjct  212   HDRVYDYAYYNDLGDPKKGKKFERPVLGGSADYPYPRRGRTGRKLAE-DSKSESRLSIVY  270

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FGHLK++DFL +ALKS+AQ + P  ESL DS+P EFDSF DIL LYEGG
Sbjct  271   SLNIYVPRDERFGHLKMSDFLAFALKSIAQVIKPALESL-DSSPNEFDSFDDILKLYEGG  329

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I LP   LL  I  +IP EMLKE+ R+DG+ L KFP PQVI+
Sbjct  330   IDLPNN-LLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIK  369



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =   439 bits (1130),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 263/341 (77%), Gaps = 4/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79    KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139   LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  658
             HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199   HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+SE+PYPRRGRTGR PT+TDPN+ES++ L+ S
Sbjct  259   DRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKLIMS  318

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FG LKL+D L Y LK++ Q L PE  +L   +  EF++ Q++L LYEGGI
Sbjct  319   LNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYEGGI  378

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I D+I  E+ KEL R+DGE   KFP PQVIQ
Sbjct  379   ELPDG-ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQ  418



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   439 bits (1129),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/340 (64%), Positives = 265/340 (78%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+GK  K A
Sbjct  34    RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGKLGKVA  92

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
              ++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93    DVEKWVTTRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             V F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153   VLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  212

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG+PDKG EYARPILGG  EYPYPRRGRTGR  TKTDP++E R+PLL SLD
Sbjct  213   VYDYDYYNDLGNPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKTDPHTEKRLPLL-SLD  271

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+ Q LLPE +SL D T  EFD+F+D+LNLYEGGIKL
Sbjct  272   IYVPRDERFGHLKFSDFLAYALKSLVQILLPEIKSLCDKTINEFDTFEDVLNLYEGGIKL  331

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P  P L  I D++P EML+EL+R+DGE   KFP P VI+ 
Sbjct  332   PNKPTLHKIRDHVPWEMLRELVRNDGERFLKFPKPDVIKA  371



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   439 bits (1129),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/342 (61%), Positives = 262/342 (77%), Gaps = 4/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K A
Sbjct  34    KKIKGRVVLMKKNVLDLNDLTASVLDRVDELVGKAVSLQLISSVNGDPEKGSPGKVGKPA  93

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G 
Sbjct  94    YLENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGR  153

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKE  655
             +HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+E
Sbjct  154   IHFVCNSWVYPADKYKKDRIFFTNKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQE  213

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG+PDKG EYARP+LGG+SE+PYPRRGRTGR PTKTDPN+ES++ L+ 
Sbjct  214   WDRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTKTDPNTESQLKLIM  273

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SL+IYVPRDE+FG LKL+D L Y LK++ Q L PE  +L   +  EF++ Q+IL LYEGG
Sbjct  274   SLNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEILMLYEGG  333

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP G +L  I D+I  E+ KEL  +DGE   KFP PQVIQ
Sbjct  334   IELPDG-ILKYIRDSIHEELFKELFPTDGENFLKFPVPQVIQ  374



>ref|XP_009418148.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=855

 Score =   438 bits (1126),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/339 (60%), Positives = 262/339 (77%), Gaps = 3/339 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             +KG VVLMRKN LDF DF AS++D + + LGQ+VSL+LVS+   D  +G +G     AYL
Sbjct  15    VKGTVVLMRKNTLDFTDFTASLLDGVQELLGQRVSLQLVSATVGDPKHGNRGVVGDPAYL  74

Query  311   DHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVH  490
             D +V K   +A+GES F + F W E  GVP A I+KN H ++FYLK++TL+D P  G +H
Sbjct  75    DGFVSKLPSIAAGESTFDVTFHWQEKNGVPGAVIVKNRHASQFYLKSITLKDFPGKGRIH  134

Query  491   FACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDRV  667
             F C SWVY A KY Y+R+FF+N AYLP +TPAPLK YR++EL++LRG   TG+L+EWDR+
Sbjct  135   FVCNSWVYSADKYKYDRVFFANTAYLPGETPAPLKPYREDELLNLRGEDVTGQLQEWDRI  194

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG+PD  A  ARP+LGG+SEYPYPRRGRTGR PTKTDPNSESR+PL+ SLDI
Sbjct  195   YDYAYYNDLGNPDSDAALARPVLGGSSEYPYPRRGRTGRPPTKTDPNSESRLPLI-SLDI  253

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+FGHLK+ADFLTYALK++ Q ++P  E++ D TP EFDSF+DIL LYEGG+ + 
Sbjct  254   YVPRDERFGHLKMADFLTYALKALVQAVVPVLEAIADETPNEFDSFEDILKLYEGGLPVA  313

Query  1028  QGPLLTAIADNIPLEMLKELIRSDG-EGLFKFPTPQVIQ  1141
             + PLL  + D IP EM++EL R++G + L K P PQ+I+
Sbjct  314   KVPLLDELRDRIPFEMIRELFRTEGNQRLLKLPIPQIIE  352



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   439 bits (1130),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 263/341 (77%), Gaps = 4/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79    KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139   LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  658
             HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199   HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+SE+PYPRRGRTGR PT+TDPN+ES++ L+ S
Sbjct  259   DRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKLIMS  318

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FG LKL+D L Y LK++ Q L PE  +L   +  EF++ Q++L LYEGGI
Sbjct  319   LNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYEGGI  378

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I D+I  E+ KEL R+DGE   KFP PQVIQ
Sbjct  379   ELPDG-ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQ  418



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   439 bits (1130),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 263/341 (77%), Gaps = 4/341 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG+VVLM+KNVLD ND  AS++D + + +G+ VSL+L+SSV  D   G  GK  K AY
Sbjct  79    KIKGRVVLMKKNVLDLNDLTASVLDRVEELVGKAVSLQLISSVNGDPEKGSPGKVGKPAY  138

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L++W+   T L +G+SAF I F+W E+ GVP AFII+N+H +EFYLKTLTLEDVP  G++
Sbjct  139   LENWITTITPLTAGDSAFDITFDWDEEIGVPGAFIIRNDHHSEFYLKTLTLEDVPGEGQI  198

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG---TGELKEW  658
             HF C SWVYPA KY  +RIFF+N+ YL S TP PL+K+R+EELV+LRG     T EL+EW
Sbjct  199   HFVCNSWVYPADKYKKDRIFFANKTYLSSDTPKPLQKFREEELVNLRGDDDDKTRELQEW  258

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+SE+PYPRRGRTGR PT+TDPN+ES++ L+ S
Sbjct  259   DRVYDYAYYNDLGNPDKGQEYARPVLGGSSEFPYPRRGRTGRPPTETDPNTESQLKLIMS  318

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+FG LKL+D L Y LK++ Q L PE  +L   +  EF++ Q++L LYEGGI
Sbjct  319   LNIYVPRDERFGPLKLSDLLAYGLKTIPQVLKPELAALLVGSHNEFNNMQEVLKLYEGGI  378

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I D+I  E+ KEL R+DGE   KFP PQVIQ
Sbjct  379   ELPDG-ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQ  418



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =   437 bits (1125),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 258/341 (76%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV   T L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTITPLTAGEAAFDVTFDWDKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGTEYARPVLGGSIEYPYPRRGRTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPVKMSDLLAYVLKSIPQVLKPEIRDLLVGNKNEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P EM KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKHISDSTPEEMFKELFRTDGERFLKFPVPQVIK  363



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   437 bits (1123),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 264/340 (78%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG VVLM+KNVLDF+D  AS +D + + LG+ VS++LVS+V  D  + L+G   K A
Sbjct  34    RKIKGTVVLMKKNVLDFHDIKASFLDRVHELLGKGVSMQLVSAVHQD-PDSLRGTLGKVA  92

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             Y++ WV   T L +GE+ F I FEW E+ G+P A IIKN+H ++ YLKT+TLEDVP HG 
Sbjct  93    YVEKWVTSRTPLTAGETIFTITFEWDENMGLPGAIIIKNHHHSQLYLKTVTLEDVPGHGR  152

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             + F C SWVYP+ +Y Y R+FFSN+AYLP QTP PL+ YR+EEL++LRG G GELKEWDR
Sbjct  153   LLFICNSWVYPSHRYKYNRVFFSNKAYLPCQTPEPLRLYREEELLNLRGHGKGELKEWDR  212

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY YYNDLG+PDKG EYARPILGG  EYPYPRRGRTGR  TKTDP++E R+PL+ SLD
Sbjct  213   VYDYDYYNDLGNPDKGEEYARPILGGTEEYPYPRRGRTGRRKTKTDPHTEKRLPLI-SLD  271

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL YALKS+ Q LLPE +SL D T  EFD+F+D+LNLYEGG+KL
Sbjct  272   IYVPRDERFGHLKFSDFLAYALKSLVQILLPEIKSLCDKTINEFDTFEDVLNLYEGGLKL  331

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P  P L  I D+IP EML EL+R+DGE   KFP P VI+ 
Sbjct  332   PNKPTLHKIRDHIPWEMLGELVRNDGERFLKFPKPDVIKA  371



>gb|KJB38135.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=570

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 249/338 (74%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54    KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114   LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY +YNDL  PD+G ++ RP+LGG+ + PYPRRGRTGR P K D  +ESR+ LL SL I
Sbjct  234   YDYDFYNDLAMPDRGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLL-SLKI  292

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F  +K +DF+ YALKS+ Q L+PE  +L D T  EFDSFQD+L+LYEGGI+LP
Sbjct  293   YVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGGIRLP  352

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 L  I D +P EM++EL+R+DGE L KFP P VI+
Sbjct  353   NDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIK  390



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   435 bits (1118),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 258/339 (76%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  K A
Sbjct  31    KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  90

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  91    FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  150

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y+R+FF+N+ YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  151   LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  210

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG +Y RP+LGG+ EYPYPRRGRT R  TKTDP SESR+P L  LD
Sbjct  211   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPL-GLD  269

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F  +KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  270   IYVPRDERFTPVKLSDFLAYAVKSLGQVLIPEIVALFDKTINEFDSFEDVLKLYEGGIKL  329

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  330   PDHH-LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  367



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   434 bits (1117),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 258/339 (76%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  K A
Sbjct  41    KKVRGTVVLMKKNVLDLTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGKPA  100

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  101   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  160

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y+R+FF+N+ YLP  TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  161   LHFVCNSWVYPAHRYKYDRVFFANKTYLPCNTPEPLRPYREQELLSLRGSGSGKLKEWDR  220

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG +Y RP+LGG+ EYPYPRRGRT R  TKTDP SESR+P L  LD
Sbjct  221   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPL-GLD  279

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F  +KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  280   IYVPRDERFTPVKLSDFLAYAVKSLGQVLIPEIVALFDKTINEFDSFEDVLKLYEGGIKL  339

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  340   PDHH-LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  377



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   434 bits (1117),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 261/381 (69%), Gaps = 43/381 (11%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQA---------------  262
             K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS  A               
Sbjct  22    KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESGPLD  81

Query  263   ----------------------------DLGNGLKGKRSKAAYLDHWVLKNTVLASGESA  358
                                          +    +GK  K AYL+ W+ K + L +G++A
Sbjct  82    WYGHTVRWLRCLGTCKGGCCFTGKKESEPIAESYRGKVGKKAYLEDWITKISPLTAGDTA  141

Query  359   FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYE  538
             + + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG VHF C SWVYP+  Y  +
Sbjct  142   YDVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYYKKD  201

Query  539   RIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAE  718
             RIFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E
Sbjct  202   RIFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPE  261

Query  719   YARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFL  898
             + RPILGG+ E+PYPRRGRTGR P  +DP  ESRIPL  SL IYVPRDE+F  LK++DF+
Sbjct  262   HVRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNSLSIYVPRDERFSQLKMSDFV  321

Query  899   TYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEML  1078
              YALKS+ QFL PEF++LFD TP EFDSF+D+L LY+GGIK+    L+  I + IPLEM+
Sbjct  322   AYALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGIKVSNDSLMEKIRERIPLEMI  381

Query  1079  KELIRSDGEGLFKFPTPQVIQ  1141
             KEL+RSDGE  FKFP PQVI+
Sbjct  382   KELLRSDGEKGFKFPLPQVIK  402



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   434 bits (1115),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/337 (60%), Positives = 253/337 (75%), Gaps = 3/337 (1%)
 Frame = +2

Query  137   GKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDH  316
             G +VLM+KNVLD +D  +S++D + + LG+ VSL+L+S+V  D  NGL+GK  K  YL+ 
Sbjct  32    GALVLMKKNVLDVSDLKSSLLDRVHELLGKGVSLQLISAVHTDPANGLRGKLGKPVYLEK  91

Query  317   WVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFA  496
             WV  NT L +GE+   +EFEW E  GVP AF+IKNNH ++FYL TLTLEDVP HG + F 
Sbjct  92    WVTTNTPLTAGETKLDVEFEWDESMGVPGAFMIKNNHHSQFYLGTLTLEDVPGHGRLQFV  151

Query  497   CFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT--GTGELKEWDRVY  670
             C SWVYPA +YN+ R+FFSN+ YLP QTP PL+KYR+EELV+LRG   G G+L EWDRVY
Sbjct  152   CNSWVYPAHRYNHHRVFFSNKTYLPCQTPEPLRKYREEELVNLRGNGKGKGKLNEWDRVY  211

Query  671   DYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIY  850
             DY YYNDLG P++G  +ARP+LGG+   PYPRRG+TGR P K DPN+ESR+ LL +L+IY
Sbjct  212   DYDYYNDLGMPERGVNFARPVLGGSPALPYPRRGKTGRKPHKKDPNTESRLSLL-NLNIY  270

Query  851   VPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQ  1030
             VPRDE+F  +K +DFL YA KS+ Q L+PE  +L D T  EFDSFQDIL+LYEGGIKLP 
Sbjct  271   VPRDERFNMVKFSDFLAYAFKSLFQVLVPEIAALGDKTINEFDSFQDILDLYEGGIKLPN  330

Query  1031  GPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                L  I D +P EM+KEL+R+DGE L KFP P VI 
Sbjct  331   KDTLKKIKDCLPWEMIKELVRNDGERLMKFPMPAVIN  367



>gb|AEZ50136.1| lipoxygenase [Diospyros kaki]
Length=901

 Score =   434 bits (1117),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 258/349 (74%), Gaps = 1/349 (0%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             K+    +  +KIKG VVLM+KN+LDF+D  AS  D   +  G KVSL+L+S+V  D  N 
Sbjct  48    KIKHEGAEMEKIKGSVVLMKKNLLDFSDLVASAADRFDEIRGNKVSLQLISAVNGDPEND  107

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTL  454
              +GK  K AYL+ W  K   L + + AF I FEW+E+  G+P AFIIKN+H NEFYL+TL
Sbjct  108   NRGKVGKPAYLEDWFTKFDPLTAADVAFNITFEWNEEEIGLPGAFIIKNSHHNEFYLRTL  167

Query  455   TLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGT  634
             TLEDVP HG +HF C SWVYP   Y  +R+FF+NQ YLPS+TP+PL+ YR+EEL  LRG 
Sbjct  168   TLEDVPGHGRIHFICNSWVYPHQYYKKDRVFFTNQTYLPSKTPSPLRHYREEELKTLRGN  227

Query  635   GTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSE  814
             GTG+L+EWDRVYDY  YNDL +P+KG +Y RPILGG+++YPYPRRGRTGR P + DP  E
Sbjct  228   GTGKLEEWDRVYDYDLYNDLSEPEKGPKYIRPILGGSTKYPYPRRGRTGRPPAEADPRYE  287

Query  815   SRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDI  994
             SR+PLL SL+IYVPRDE+F HLK +D L Y LKS+ QFLLPE ES+ DS P EF+  +D+
Sbjct  288   SRLPLLKSLNIYVPRDERFSHLKFSDVLAYGLKSLFQFLLPEVESIIDSAPNEFNKLEDM  347

Query  995   LNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             L+LYE GIKLP  P L +I  NIP + LKE++R+DGE  F+FP P VI+
Sbjct  348   LDLYEAGIKLPDWPFLESIRKNIPSQTLKEILRTDGERAFRFPVPLVIK  396



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   434 bits (1117),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 262/380 (69%), Gaps = 42/380 (11%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSV------QADLGNG----  277
             K++G VVLM+K VL  ND  AS+VD + +  G+KV+L+L+SS        A LG      
Sbjct  22    KMRGVVVLMKKKVLGVNDIAASVVDRVDEIRGRKVALQLISSTAALDHDSAHLGESGPLD  81

Query  278   --------------------------------LKGKRSKAAYLDHWVLKNTVLASGESAF  361
                                              +GK  K AYL+ W+ K + L +G++A+
Sbjct  82    WYGHTVRWLRCLGTCKGGCCFTGKKESEPIESYRGKVGKKAYLEDWITKISPLTAGDTAY  141

Query  362   KIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYER  541
              + FEW+ + GVP AF I N H NEFYLKTLTLEDVP HG VHF C SWVYP+  Y  +R
Sbjct  142   DVTFEWTREMGVPGAFTITNFHHNEFYLKTLTLEDVPGHGRVHFICNSWVYPSEYYKKDR  201

Query  542   IFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEY  721
             IFF+NQAYLPSQTPAPL+ YR+EEL +LRG GTG+L+EWDRVYDY  YNDLGDPDKG E+
Sbjct  202   IFFANQAYLPSQTPAPLRGYREEELENLRGNGTGKLEEWDRVYDYDIYNDLGDPDKGPEH  261

Query  722   ARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLT  901
              RPILGG+ E+PYPRRGRTGR P  +DP  ESRIPL  SL IYVPRDE+F  LK++DF+ 
Sbjct  262   VRPILGGSPEFPYPRRGRTGRPPASSDPKVESRIPLYNSLSIYVPRDERFSQLKMSDFVA  321

Query  902   YALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLK  1081
             YALKS+ QFL PEF++LFD TP EFDSF+D+L LY+GGIK+    L+  I + IPLEM+K
Sbjct  322   YALKSIFQFLAPEFKALFDKTPDEFDSFEDVLKLYDGGIKVSNDSLMEKIRERIPLEMIK  381

Query  1082  ELIRSDGEGLFKFPTPQVIQ  1141
             EL+RSDGE  FKFP PQVI+
Sbjct  382   ELLRSDGEKGFKFPLPQVIK  401



>gb|KJB38136.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=645

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 249/338 (74%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54    KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114   LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY +YNDL  PD+G ++ RP+LGG+ + PYPRRGRTGR P K D  +ESR+ LL SL I
Sbjct  234   YDYDFYNDLAMPDRGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLL-SLKI  292

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F  +K +DF+ YALKS+ Q L+PE  +L D T  EFDSFQD+L+LYEGGI+LP
Sbjct  293   YVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGGIRLP  352

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 L  I D +P EM++EL+R+DGE L KFP P VI+
Sbjct  353   NDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIK  390



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   434 bits (1116),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 259/339 (76%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  45    QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  104

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  105   FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  164

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYP  +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  165   LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  224

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG +Y RP+LGG+ EYPYPRRGRT R  TKTDP SESR+P L  LD
Sbjct  225   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPL-GLD  283

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F  +KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  284   IYVPRDERFTPMKLSDFLAYAVKSLGQVLVPEIVALFDKTINEFDSFEDVLKLYEGGIKL  343

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  344   PDHH-LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  381



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   433 bits (1114),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/339 (59%), Positives = 259/339 (76%), Gaps = 2/339 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +K++G VVLM+KNVLDF D  AS++D   + +G+ VSL+L+S+  A+ GNG  GK  + A
Sbjct  28    QKVRGTVVLMKKNVLDFTDVGASLLDRFHEVIGKGVSLQLISADHAEPGNGCTGKLGQPA  87

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  88    FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  147

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYP  +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  148   LHFVCNSWVYPEHRYKYDRMFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  207

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG +Y RP+LGG+ EYPYPRRGRT R  TKTDP SESR+P L  LD
Sbjct  208   VYDYAFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTDPMSESRLPPL-GLD  266

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F  +KL+DFL YA+KS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  267   IYVPRDERFTPMKLSDFLAYAVKSLGQVLVPEIVALFDKTINEFDSFEDVLKLYEGGIKL  326

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  327   PDHH-LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  364



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   433 bits (1114),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 257/340 (76%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM+KNVLD  D  AS +D + +  G+ VSL+L+S+  A+ GNG KGK  K A
Sbjct  30    KKVRGTVVLMKKNVLDLTDVGASFLDRVHEVFGKGVSLQLISADHAEPGNGCKGKLGKPA  89

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             ++++WV   T +++G++ F + F+W E  G P AFIIKN H ++ YL+T+ LEDVP HG+
Sbjct  90    FMENWVSTLTSISAGDATFNVTFDWDESMGFPGAFIIKNYHHSQLYLRTVVLEDVPGHGQ  149

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y R+FF+N+ YLPS TP PL+ YR+EEL+ LRG+G+G LKEWDR
Sbjct  150   LHFVCNSWVYPAHRYKYNRVFFANKTYLPSNTPEPLRPYREEELLSLRGSGSGMLKEWDR  209

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA+YNDLG PDKG EY RP+LGG+ EYPYPRRGRT R  TKTD NSES++P L  L+
Sbjct  210   VYDYAFYNDLGFPDKGPEYVRPVLGGSKEYPYPRRGRTSRRATKTDLNSESQLPPL-GLN  268

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F H+KL+DFL YALKS+ Q L+PE  +LFD T  EFDSF+D+L LYEGGIKL
Sbjct  269   IYVPRDERFTHVKLSDFLAYALKSLGQVLIPEIVALFDKTIDEFDSFEDVLKLYEGGIKL  328

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P    L  +   IP EMLKELIRSDGE   KFP P VI+ 
Sbjct  329   PDHH-LNKLRQCIPWEMLKELIRSDGEPPLKFPMPDVIKA  367



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   432 bits (1112),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 263/340 (77%), Gaps = 4/340 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             ++G+V+LM+KNVLDF D +AS  D + + +G++VSL+LVS+ + D GNG+KGK  K AYL
Sbjct  24    MRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQLVSADKGDPGNGMKGKVGKPAYL  83

Query  311   DHWVLKNTVLASGESAFKIEFEWSED--FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             + W    T L +GES +K+ F+  +D   G P AF+IKNNH +EFYLK+L L++VP  G 
Sbjct  84    EDWNSTITPLIAGESTYKVTFDLDDDDDIGTPGAFLIKNNHHSEFYLKSLKLQNVPGQGV  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG-ELKEWD  661
             +HF C SWVYP+ KY  +RIFFSN+ Y  S+TPAPL KYR+EEL  LRG+G   +LKEWD
Sbjct  144   IHFTCNSWVYPSQKYQKDRIFFSNKTYFLSETPAPLLKYREEELETLRGSGDSIQLKEWD  203

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDL DPDKG +Y RP+LGG+SEYPYPRRGRT R P K+D NSESR+ L  SL
Sbjct  204   RVYDYAYYNDLADPDKGPKYVRPVLGGSSEYPYPRRGRTNRPPAKSDANSESRLNLAMSL  263

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K++DFL YA+K++ Q + PE ESLFDSTP EFDS +D+L LYEGGI+
Sbjct  264   DIYVPRDERFGHVKMSDFLAYAIKAIVQVIKPELESLFDSTPNEFDSLEDVLKLYEGGIE  323

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +P+G  +  I D IP EMLKE++R+DG+ L K+P P VI+
Sbjct  324   VPEGA-VKRIRDKIPAEMLKEILRTDGQKLLKYPVPHVIK  362



>ref|XP_011648826.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Cucumis 
sativus]
Length=854

 Score =   432 bits (1110),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 200/341 (59%), Positives = 262/341 (77%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KI G+VVLM+ NVLDF+DF+ S++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8     RKILGEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68    YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  482   E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
               + F C SW+YP+ +Y  +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128   TTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGELQEW  187

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYA YNDL DPDK  +YARP+LGG++ YPYPRRGRTGR PTK+DP +ESRIPL+ S
Sbjct  188   DRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPLVKS  247

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FGHLKL+DFL YALK+++QF+ P  E  F+  P EFDS QD L+LYEGG 
Sbjct  248   LNVYVPRDERFGHLKLSDFLAYALKAISQFIKPGLEEYFEGIPGEFDSLQDFLDLYEGGF  307

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              +P+G L   I +NI    LKE+ R+DGE LFKFP PQVI+
Sbjct  308   PVPEG-LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIK  347



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Cucumis 
sativus]
Length=852

 Score =   431 bits (1109),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/341 (59%), Positives = 262/341 (77%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KI G+VVLM+ NVLDF+DF+ S++D L +F+G++VSL+LVS++  D  N L+GK  + A
Sbjct  8     RKILGEVVLMKSNVLDFDDFSTSLLDTLYEFVGKRVSLQLVSAIHGDPSNELRGKLGEEA  67

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSED-FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ W+   T L +GE+ FK+ F+W E   G+P AF I N+H + FYLK+LTL+ VP HG
Sbjct  68    YLEEWITTITPLTTGEATFKVTFDWDEQRMGIPGAFFITNHHHSHFYLKSLTLQHVPPHG  127

Query  482   E-VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
               + F C SW+YP+ +Y  +RIFF NQ+YLPS+TP PL+K+R++EL  LRG G GEL+EW
Sbjct  128   TTLFFPCNSWIYPSHRYKNDRIFFLNQSYLPSETPDPLRKFREDELQSLRGGGNGELQEW  187

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYA YNDL DPDK  +YARP+LGG++ YPYPRRGRTGR PTK+DP +ESRIPL+ S
Sbjct  188   DRVYDYALYNDLADPDKAPQYARPVLGGSTTYPYPRRGRTGRPPTKSDPETESRIPLVKS  247

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FGHLKL+DFL YALK+++QF+ P  E  F+  P EFDS QD L+LYEGG 
Sbjct  248   LNVYVPRDERFGHLKLSDFLAYALKAISQFIKPGLEEYFEGIPGEFDSLQDFLDLYEGGF  307

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              +P+G L   I +NI    LKE+ R+DGE LFKFP PQVI+
Sbjct  308   PVPEG-LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIK  347



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 255/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV +D  N   GK  K A
Sbjct  78    KKIKGRVVLMKKIVLDLNDLKASILDRVHELLGKAVSLRLISSVNSDPENESTGKVGKPA  137

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV   T L +GE+AF + F+W E+ GVP AFI++N H +EFYLKT+TLEDVP  G 
Sbjct  138   YLENWVTTITPLTAGETAFDVTFDWDEEIGVPGAFIVRNYHHSEFYLKTVTLEDVPGEGR  197

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FF N  YLP  TP  L+K+R+EELV+LRG     GEL+EW
Sbjct  198   VHFVCNSWVYPADKYKKDRVFFXNXTYLPGDTPKSLQKFREEELVNLRGDDEERGELQEW  257

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR  TKTDPN+ESR+ L+  
Sbjct  258   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGRTGRPATKTDPNTESRLKLIQR  317

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG LK++D L Y LKS+ Q L PE  +L      EF++ +D+L LYEGG 
Sbjct  318   LNVYVPRDERFGPLKMSDLLAYVLKSIPQVLKPEIXALLLGNKNEFETMEDVLKLYEGGX  377

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+IP EM KEL R+DGE   KFP PQVI+
Sbjct  378   ELPDG-ILKHISDSIPEEMFKELFRTDGEKFLKFPVPQVIK  417



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 257/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRG+TGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P E+ KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIK  363



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 257/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRG+TGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P E+ KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIK  363



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =   431 bits (1108),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/341 (60%), Positives = 257/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGDPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRG+TGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P E+ KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIK  363



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   430 bits (1106),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/341 (58%), Positives = 266/341 (78%), Gaps = 5/341 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL+GK  K 
Sbjct  4     SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPD--PGLRGKLGKV  61

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             A+L+ WV   T L S  ++ F + FEW E  GVP AFII+NNH ++FYLKT+T+ED+P H
Sbjct  62    AHLERWVSTITSLTSATDTEFTVTFEWDESMGVPGAFIIRNNHHSQFYLKTVTIEDIPGH  121

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G V+F C SW+YPA +Y ++R+FF+N+AYLP QTP PL+K+R++EL+ LRG G G+L EW
Sbjct  122   GPVNFVCNSWIYPAHRYAHDRVFFANKAYLPYQTPEPLRKFREQELIALRGKGFGKLNEW  181

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG PD G +YARP+LGG S+ PYPRRGRTGR   KTDP +ESR+ LL +
Sbjct  182   DRVYDYAYYNDLGLPDDGPDYARPVLGG-SQCPYPRRGRTGRPHCKTDPKTESRLRLL-N  239

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FGH+K +DFL Y+LKSVAQ LLPE +SL D T  EFD+F+D+L++YEG I
Sbjct  240   LNVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFEDVLDIYEGSI  299

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KLP GPL + + + +P E+L+ELIR+DGE   KFP P VI+
Sbjct  300   KLPSGPLASKLRELVPYELLRELIRNDGERFLKFPVPDVIK  340



>ref|XP_004496744.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004496745.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004496746.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=858

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 262/348 (75%), Gaps = 3/348 (1%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E     K++KG+VVLM+K++LDF+D  A+++D + +FLG+ VSL+L+S+   D   GL+G
Sbjct  2     EIFDHKKEVKGRVVLMKKSLLDFHDIKANLLDRIHEFLGKGVSLQLISATTPDPEKGLRG  61

Query  287   KRSKAAYLDHWVLKNTVLASG-ESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTL  460
             K  K AYL+ W+   + L +  E+ F + F+W  E  GVP AFII NNH ++FYLKT+T+
Sbjct  62    KHGKVAYLERWISSISSLTTATETEFSVTFDWDHEKMGVPGAFIITNNHHSQFYLKTVTI  121

Query  461   EDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGT  640
             ED+P H  + F C SWVYPA +Y ++R+FF+N+AYLPS+TP  L+K R+EELV LRG G 
Sbjct  122   EDIPGHAPITFVCNSWVYPAHRYTHQRVFFTNKAYLPSETPESLRKLREEELVALRGKGV  181

Query  641   GELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESR  820
             G+L EWDRVYDYA YNDLG PD G +YARP++GG+  +PYPRRGRT R  TKTDP +ESR
Sbjct  182   GKLNEWDRVYDYACYNDLGTPDDGIDYARPVIGGSLNFPYPRRGRTSRPHTKTDPKTESR  241

Query  821   IPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILN  1000
             + LL +L+IYVPRDE+FGH+K +DFL YALKSVAQ LLPE  SL D T  EFD+FQD+L+
Sbjct  242   LHLL-NLNIYVPRDEQFGHVKFSDFLAYALKSVAQVLLPELRSLCDKTINEFDTFQDVLD  300

Query  1001  LYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             +YEG  KLP GPLLT I + IP E+L+EL+R+DGE   KFP P +I+ 
Sbjct  301   IYEGSFKLPTGPLLTKIRELIPYEILRELVRNDGEKFLKFPVPDIIKA  348



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =   429 bits (1104),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 257/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV  D  N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKVVSLRLISSVNGDPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ Y+ S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYISSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRG+TGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P E+ KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIK  363



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =   430 bits (1106),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 259/342 (76%), Gaps = 4/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  88    KKIKGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  147

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  148   YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  207

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG---ELKE  655
             VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  208   VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  267

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVY YAYYNDLG PDKG EYARPILGG+SE+PYPRRGRTGR  T+ DP SES + L+ 
Sbjct  268   WDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRGRTGRQATEKDPKSESPMMLIM  327

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             S+ +YVPRDE+FGHLK++D + YA+KS++Q + P+  +   +T  EF S +D+L LYEGG
Sbjct  328   SIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLYEGG  387

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP+G LL ++ DNIP+E +KEL R+DGE   KFP PQVI+
Sbjct  388   IELPKG-LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIK  428



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =   428 bits (1100),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 256/341 (75%), Gaps = 3/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG+VVLM+K VLD ND  ASI+D + + LG+ VSL L+SSV     N LKGK  K A
Sbjct  24    KKIKGRVVLMKKVVLDVNDLKASILDRVDELLGKAVSLRLISSVNGAPENELKGKVGKPA  83

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL++WV     L +GE+AF + F+W ++ GVP AF+++N H +EFYLKTLTLEDVP  G 
Sbjct  84    YLENWVTTIAPLTAGEAAFDVTFDWEKEIGVPGAFVVRNEHHSEFYLKTLTLEDVPGEGR  143

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG--TGELKEW  658
             VHF C SWVYPA KY  +R+FFSN+ YL S TP PL+K+R+EELV+LRG     GEL+EW
Sbjct  144   VHFVCNSWVYPADKYKKDRVFFSNKTYLSSDTPKPLQKFREEELVNLRGDDEERGELQEW  203

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG+PDKG EYARP+LGG+ EYPYPRRG+TGR  TKTDPN+ESR+ L+  
Sbjct  204   DRVYDYAYYNDLGNPDKGPEYARPVLGGSIEYPYPRRGKTGRPATKTDPNTESRLKLIQI  263

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L++YVPRDE+FG +K++D L Y LKS+ Q L PE   L      EF+S +++L LYEGG+
Sbjct  264   LNVYVPRDERFGPIKMSDLLAYVLKSIPQVLKPEIRDLLVGNKDEFESMEEVLKLYEGGL  323

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +LP G +L  I+D+ P E+ KEL R+DGE   KFP PQVI+
Sbjct  324   ELPDG-ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIK  363



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =   426 bits (1095),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 230/292 (79%), Gaps = 1/292 (0%)
 Frame = +2

Query  266   LGNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYL  445
             L N L+G+  K AYL+ W+   T L + E+ F I F+W E  GVP AFII+N+H ++FYL
Sbjct  3     LANELRGRLGKVAYLEKWITTITPLTAVETLFTITFDWDEAMGVPGAFIIRNHHHSQFYL  62

Query  446   KTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHL  625
             KT+TLEDVP HG +HF C SWVYP  +Y Y+R+FFSN+ YLP QTP PL+KYR EELV+L
Sbjct  63    KTVTLEDVPGHGRIHFVCNSWVYPTHRYKYDRVFFSNKTYLPCQTPEPLRKYRREELVNL  122

Query  626   RGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDP  805
             RG G GELKEWDRVYDYA+YNDLG+PDKG EYARP+LGG+ EYPYPRRGRTGR PTKTDP
Sbjct  123   RGNGKGELKEWDRVYDYAFYNDLGNPDKGPEYARPVLGGSQEYPYPRRGRTGRKPTKTDP  182

Query  806   NSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSF  985
             NSE R+PL+ SLDIYVPRDE+FGHLK +DFL YALKS+ Q LLPE  SL D T  EFDSF
Sbjct  183   NSERRLPLI-SLDIYVPRDERFGHLKFSDFLAYALKSLVQILLPEITSLCDKTINEFDSF  241

Query  986   QDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              D+LNLYEGGIKLP    ++ I D IP EMLKEL+R+DGE   KFP P VI+
Sbjct  242   DDVLNLYEGGIKLPNSQTVSKIRDRIPWEMLKELVRNDGERFLKFPMPDVIK  293



>ref|XP_009406999.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   422 bits (1085),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 257/340 (76%), Gaps = 4/340 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             ++KG VVLM KNVLDFND   +++D L D LGQ V+ +LVS+   D  NG +G     A 
Sbjct  32    QVKGTVVLMPKNVLDFNDLAGNVIDGLFDILGQNVTFQLVSATVGDPNNGNRGVVGSPAS  91

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L  ++ +   LA+GES F + F+W E+ G+P A I+KN H  +F+LKTLTL++ P  G +
Sbjct  92    L-QYLGRLPSLAAGESRFSVTFQWEENKGIPGAVIVKNKHATQFFLKTLTLDNFPGKGRI  150

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKEWDR  664
             HF C SWVYPASKY Y+R+FF+N  YLP  TPAPLK YR +EL++LRG   TGELKEWDR
Sbjct  151   HFVCNSWVYPASKYKYDRVFFANTTYLPGDTPAPLKPYRQDELLNLRGQDVTGELKEWDR  210

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYAYYNDLG PD+GA   RPILGG++EYPYPRRG+TGRAPTKTDP +ESR+PLL +L+
Sbjct  211   VYDYAYYNDLGSPDQGANLVRPILGGSAEYPYPRRGKTGRAPTKTDPKTESRLPLL-NLN  269

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK+ DFLTYA+K+++  LLP  +++FD TP EFDSF+++L+LYE G+ +
Sbjct  270   IYVPRDERFGHLKMGDFLTYAIKAISTGLLPTLQAIFDITPNEFDSFEEVLSLYENGLPV  329

Query  1025  PQGPLLTAIADNIPLEMLKELIRSD-GEGLFKFPTPQVIQ  1141
             PQ PLL  +   IP EM++EL+R++ G+   K P P VIQ
Sbjct  330   PQIPLLDELRQRIPFEMIRELLRTEKGQNFLKLPKPHVIQ  369



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis sativus]
Length=864

 Score =   427 bits (1098),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 258/342 (75%), Gaps = 5/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI G VVL+R NVLDFNDF ++++DNL + LG  VSL+LVS+   D   G KGK  +AA
Sbjct  18    KKINGTVVLVRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKGFKGKVGEAA  77

Query  305   YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             YL++W+  NT++   +GE+AF I F+W E+ GVP AF I N H +EF+LK+LTLEDVP H
Sbjct  78    YLENWI-GNTIIPIFAGETAFSITFDWDEEIGVPGAFFITNQHFSEFFLKSLTLEDVPGH  136

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G +HF C SWVYPA KY   RIFF+NQAYLP++ P PL KYR +EL++LRG G GE KEW
Sbjct  137   GRLHFDCNSWVYPADKYKTPRIFFANQAYLPNEMPKPLVKYRADELLNLRGNGKGERKEW  196

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT-  835
             DR+YDY  YND+GDPD   +  RP+LGG+S+YPYPRRGRTGR P+K DP SESR+P  + 
Sbjct  197   DRIYDYDVYNDIGDPDSNLDLGRPVLGGSSKYPYPRRGRTGRPPSKKDPKSESRLPSSSK  256

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             + D+YVPRDE+FGHLK++DFL Y LKS+++ L P+ E LFDSTP EFD F D+ +LYE G
Sbjct  257   ATDVYVPRDERFGHLKMSDFLAYGLKSISRSLKPKLEDLFDSTPGEFDDFNDVFDLYEKG  316

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             + +P+  LL  I +NIP  +LKE+ R+DGE   +FPTPQ++ 
Sbjct  317   LPVPRS-LLQGITENIPAPLLKEIFRTDGERFLRFPTPQLVH  357



>gb|ADL41189.1| lipoxygenase [Camellia sinensis]
Length=868

 Score =   427 bits (1097),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 198/339 (58%), Positives = 253/339 (75%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVLM+K++LDF+  +  +VD + + +GQKVSL+L+S+V  D G  L+GK  K A
Sbjct  18    KKIKGTVVLMKKSLLDFDGLSLPLVDRIEEVVGQKVSLQLISAVNGDPGKDLRGKIGKKA  77

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T   S + +F + FEW E+ GVP AF I N+H NEFYLKT+TLE VP+HG+
Sbjct  78    YLEDWITKITT-PSADVSFNVTFEWDEEVGVPGAFTITNSHHNEFYLKTVTLEGVPDHGQ  136

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             + F C SWVYP   Y  +R+FF+NQ YLP +TPAPL  YR+EEL+ LRG GTG+L+EWDR
Sbjct  137   IQFICNSWVYPKKYYEKDRVFFTNQTYLPGETPAPLCHYREEELLTLRGNGTGKLEEWDR  196

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDY  YNDL +P+   +Y RPILGG+S+YPYPRRGRTGR P + DP  ESR+PLL SL 
Sbjct  197   VYDYDLYNDLSEPETDLKYGRPILGGSSKYPYPRRGRTGRPPLEKDPRYESRLPLLKSLS  256

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+F  LKL+D + Y LKSV QFLLPEFE+ FD TP EFD+ +D++ LY+GGIK+
Sbjct  257   IYVPRDERFSRLKLSDLVAYGLKSVFQFLLPEFEAQFDKTPEEFDNLEDVMKLYDGGIKI  316

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P   LL ++   IP E LKE++R+DGE    FP PQVI+
Sbjct  317   PDCHLLESLRKEIPFETLKEILRTDGERFCHFPVPQVIE  355



>gb|KJB38138.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=869

 Score =   426 bits (1095),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 249/338 (74%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  23    KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  82

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  83    LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  142

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  143   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  202

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY +YNDL  PD+G ++ RP+LGG+ + PYPRRGRTGR P K D  +ESR+ LL SL I
Sbjct  203   YDYDFYNDLAMPDRGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLL-SLKI  261

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F  +K +DF+ YALKS+ Q L+PE  +L D T  EFDSFQD+L+LYEGGI+LP
Sbjct  262   YVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGGIRLP  321

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 L  I D +P EM++EL+R+DGE L KFP P VI+
Sbjct  322   NDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIK  359



>gb|KHG03761.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
 gb|KHG17470.1| Linoleate 9S-lipoxygenase 5, chloroplastic -like protein [Gossypium 
arboreum]
Length=873

 Score =   426 bits (1094),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 250/338 (74%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNV+D ND  AS +D + +  G+ VSL+L+S+V  D  N ++GK  K A 
Sbjct  27    KIKGTVVLMKKNVMDMNDLTASFLDRVYELFGRGVSLQLISAVYTDPANEMRGKLGKPAN  86

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  87    LEKWITKITPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  146

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLPSQ   PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  147   HFVCNSWVYPTHRYKYDRVFFSNKTYLPSQMAVPLRKYREEELVNLRGDGKGCLKEWDRV  206

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY +YNDL  P++G ++ RP+LGG+ + PYPRRGRTGR P K D  +ESR+ LL SL I
Sbjct  207   YDYDFYNDLAMPERGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLL-SLKI  265

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F  +K +DF+ YALKS+ Q L+PE  +L D T  EFDSFQD+L+LYEGGIKLP
Sbjct  266   YVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGGIKLP  325

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 L  I D +P EM++EL+R+DGE L KFP P VI+
Sbjct  326   DDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIK  363



>gb|KJB38137.1| hypothetical protein B456_006G238200 [Gossypium raimondii]
Length=900

 Score =   426 bits (1094),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 199/338 (59%), Positives = 249/338 (74%), Gaps = 1/338 (0%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KNV+D ND  AS +D + +   + VSL+L+S+V  D  N ++GK  K A 
Sbjct  54    KIKGTVVLMKKNVMDMNDLTASCLDRVYELFDRGVSLQLISAVYTDPANEMRGKLGKPAN  113

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W+ K T L +GE  F + FEW E  GVP AFIIKN H ++FYLKT+TLEDVP HG V
Sbjct  114   LEKWITKFTPLTAGEITFSVTFEWDESIGVPGAFIIKNRHHSQFYLKTVTLEDVPGHGRV  173

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y+R+FFSN+ YLP Q P PL+KYR+EELV+LRG G G LKEWDRV
Sbjct  174   HFVCNSWVYPTHRYKYDRVFFSNKTYLPCQMPVPLRKYREEELVNLRGDGKGCLKEWDRV  233

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDY +YNDL  PD+G ++ RP+LGG+ + PYPRRGRTGR P K D  +ESR+ LL SL I
Sbjct  234   YDYDFYNDLAMPDRGHDFHRPVLGGSLDCPYPRRGRTGRKPHKKDSRTESRLFLL-SLKI  292

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F  +K +DF+ YALKS+ Q L+PE  +L D T  EFDSFQD+L+LYEGGI+LP
Sbjct  293   YVPRDEQFSLVKFSDFVAYALKSLFQVLIPEVAALCDKTINEFDSFQDVLDLYEGGIRLP  352

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 L  I D +P EM++EL+R+DGE L KFP P VI+
Sbjct  353   NDATLKKIRDCVPWEMIRELVRNDGERLMKFPMPAVIK  390



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =   426 bits (1096),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 259/342 (76%), Gaps = 4/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86    KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146   YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG---ELKE  655
             VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206   VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVY YAYYNDLG PDKG EYARPILGG+SE+PYPRR RTGR  T+ DP SES + L+ 
Sbjct  266   WDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQATEKDPKSESPMMLIM  325

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             S+ +YVPRDE+FGHLK++D + YA+KS++Q + P+  +   +T  EF S +D+L LYEGG
Sbjct  326   SIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLYEGG  385

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP+G LL ++ DNIP+E +KEL+R+DGE   KFP PQVI+
Sbjct  386   IELPKG-LLKSVRDNIPVETIKELLRTDGEKFLKFPVPQVIK  426



>emb|CDO99039.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   424 bits (1091),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 252/338 (75%), Gaps = 3/338 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KIKG VVLM+KN+LD  D  ASI+D L +   + VS++LVS+ Q D  NG +GK  KAA 
Sbjct  38    KIKGTVVLMKKNILDVKDVGASILDRLHELFHRGVSIQLVSADQIDPENG-RGKLGKAAI  96

Query  308   LDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             L+ W  K T +++ +  F + FEW E  G P A I++N+H ++FYLKT+TL+DVP HG++
Sbjct  97    LEKWNAKLTSVSATDVKFDVNFEWDESMGAPGALIVRNHHHSQFYLKTVTLDDVPGHGQL  156

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SWVYP  +Y Y R+FF+N+ YLPS TP  L+ YR+EEL +LRG GTG LKEWDRV
Sbjct  157   HFVCNSWVYPQHRYKYNRVFFANKTYLPSNTPEALRPYREEELDNLRGNGTGMLKEWDRV  216

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG+PD G E+ R +LGG+ +YPYPRRGRTGRAPTK DP +ESR+ LL  L I
Sbjct  217   YDYAYYNDLGNPDGGPEHERSVLGGSKQYPYPRRGRTGRAPTKKDPTTESRLRLL-DLSI  275

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDEKF H+K ADF+ YA+KSV Q LLPE  S+FD T  EFDSFQD+L+LYEGGIKLP
Sbjct  276   YVPRDEKFSHVKFADFIAYAVKSVGQVLLPEVASVFDKTFNEFDSFQDVLDLYEGGIKLP  335

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
                 +  +   I  E+LKEL+RSDGEG+ KFP P VI+
Sbjct  336   SHA-MDKLKHCISWELLKELVRSDGEGMMKFPVPSVIK  372



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =   426 bits (1094),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 258/342 (75%), Gaps = 4/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86    KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146   YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG---ELKE  655
             VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206   VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVY YAYYNDLG PDKG EYARPILGG+SE+PYPRR RTGR  T+ DP SES + L+ 
Sbjct  266   WDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQATEKDPKSESPMMLIM  325

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             S+ +YVPRDE+FGHLK++D + YA+KS++Q + P+  +   +T  EF S +D+L LYEGG
Sbjct  326   SIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLYEGG  385

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP+G LL ++ DNIP+E +KEL R+DGE   KFP PQVI+
Sbjct  386   IELPKG-LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIK  426



>gb|EYU41500.1| hypothetical protein MIMGU_mgv1a001165mg [Erythranthe guttata]
Length=874

 Score =   424 bits (1090),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 263/355 (74%), Gaps = 7/355 (2%)
 Frame = +2

Query  95    GKLA-EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG  271
             GK+  E +   KK+KG VVLM+KNV+D  DF +SI+D   +  G+ VSL+LVSSV  D  
Sbjct  11    GKIKDEPIVELKKVKGTVVLMKKNVMDVTDFGSSILDRFHELFGKGVSLQLVSSVNGDSA  70

Query  272   NGLKGKRSKAAYLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLK  448
             N  KGK  K A+L++W+ K T L A  E++F + F W E  G+P AFIIKN+H ++FYLK
Sbjct  71    NENKGKLGKEAFLENWISKITSLNAKDEASFDVVFNWDESHGIPGAFIIKNHHHSQFYLK  130

Query  449   TLTLEDVPNH-GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHL  625
             +LTLED P+H G +HF C SWVYP  +Y Y+R+FF+N+ YL   TP PL+ YR++EL +L
Sbjct  131   SLTLEDFPSHEGPIHFDCNSWVYPTHRYKYDRVFFTNKTYLFDDTPQPLRFYRNQELKNL  190

Query  626   RG---TGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTK  796
             RG   +  G LKEWDRVYDYAYYNDLG P+KG +YARP LGGNS+YPYPRR +TGR P K
Sbjct  191   RGEEISSGGMLKEWDRVYDYAYYNDLGSPEKGKDYARPSLGGNSDYPYPRRAKTGRKPNK  250

Query  797   TDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEF  976
              DPNSE+R+ LL SL IYVPRDEKF  +K +DF+ YA+KS+ Q  +PE +++FD T  EF
Sbjct  251   KDPNSETRLFLL-SLSIYVPRDEKFNQVKFSDFIGYAIKSIGQVFVPEIKAVFDKTINEF  309

Query  977   DSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             D+FQD+LNLYEGG++LP+G  L  I  ++P E+LKELIRSDGE   KFPTP VI+
Sbjct  310   DTFQDVLNLYEGGVRLPEGQTLDKIRAHVPWELLKELIRSDGERFLKFPTPDVIK  364



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score =   423 bits (1088),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/343 (57%), Positives = 261/343 (76%), Gaps = 4/343 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VS++L+S+   D   GL GK  + 
Sbjct  6     SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSIQLISATSPDPAKGLLGKHGEE  65

Query  302   AYLDHWVLKNTVLASG-ESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPN  475
             +YL+ WV   + L S  ++ F + F+W  E  GVP AFII+N+H ++FYLKT+T+ED+P 
Sbjct  66    SYLERWVSTISSLTSASDTEFWVTFDWDHEKMGVPGAFIIRNHHKSQFYLKTVTIEDIPG  125

Query  476   HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             HG V+F C SWVYPA +Y ++R+FFSN+AYLP QTP PL+K R++EL  LRG G G+L E
Sbjct  126   HGPVNFVCNSWVYPAHRYTHDRVFFSNKAYLPCQTPGPLRKLREQELEVLRGKGVGKLNE  185

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG PD G  Y RP+LGG S +PYPRRGRTGR  TKTDP +ESR+ LL 
Sbjct  186   WDRVYDYAYYNDLGTPDDGPHYTRPVLGG-SNFPYPRRGRTGRPHTKTDPKTESRLHLL-  243

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             +L++YVPRDE+FGH+K +DFL YALKSVAQ L+PE +SL D T  EFD+F+D+L++YEG 
Sbjct  244   NLNVYVPRDEQFGHVKFSDFLAYALKSVAQVLVPEIKSLCDKTINEFDTFEDVLSIYEGS  303

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             IK+P GPL   + + +P E+++ELIRSDGE   KFP P VI+ 
Sbjct  304   IKMPSGPLAVKLRELVPYEIVRELIRSDGEKFLKFPVPDVIKA  346



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score =   423 bits (1087),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 242/310 (78%), Gaps = 3/310 (1%)
 Frame = +2

Query  218   LGQKVSLELVSSVQADLGNGLK--GKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDF  391
             + ++ S  L  +  +   NGLK  GK  + AYL+ WV   T L++GE++F I  +W E  
Sbjct  29    IDKQFSSRLTQNSYSCAANGLKSRGKLGEVAYLEKWVTTTTSLSAGEASFSISLDWDESH  88

Query  392   GVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLP  571
             GVP A +I+N+H ++FYLKT+TLEDVP HG++HF C SWVYPA +Y Y RIFF N+AYLP
Sbjct  89    GVPGALLIRNHHHSQFYLKTITLEDVPGHGQLHFVCNSWVYPAHRYKYNRIFFPNKAYLP  148

Query  572   SQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSE  751
             S+TP  L  YR++ELV+LRG+G+GE KEWDRVYDYAYYNDLG PDKG EYARP+LGG++E
Sbjct  149   SETPELLHPYREDELVNLRGSGSGEXKEWDRVYDYAYYNDLGSPDKGPEYARPVLGGSNE  208

Query  752   YPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFL  931
             YPYPRRGRTGR PTKTDPNSESR+PLL SLDIYVP+DE+FGH+K +DFL Y LKS+ Q L
Sbjct  209   YPYPRRGRTGREPTKTDPNSESRLPLL-SLDIYVPKDERFGHVKFSDFLAYGLKSLVQIL  267

Query  932   LPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGL  1111
             LPE +SL D T  EFD+F+D+LNLY+GGIKLP GP L  I + IP E+LKELIRSDGE  
Sbjct  268   LPELKSLCDKTINEFDTFEDVLNLYDGGIKLPNGPTLKKIRECIPWELLKELIRSDGERF  327

Query  1112  FKFPTPQVIQ  1141
              KFP P VI+
Sbjct  328   LKFPMPDVIK  337



>ref|XP_003626279.1| Chalcone synthase [Medicago truncatula]
Length=1317

 Score =   433 bits (1113),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 263/340 (77%), Gaps = 4/340 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             ++G+V+LM+KNVLDF D +AS  D + + +G++VSL+LVS+ + D GNG+KGK  K AYL
Sbjct  19    MRGEVILMKKNVLDFKDLSASFFDGIHELVGKRVSLQLVSADKGDPGNGMKGKVGKPAYL  78

Query  311   DHWVLKNTVLASGESAFKIEFEWSED--FGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             + W    T L +GES +K+ F+  +D   G P AF+IKNNH +EFYLK+L L++VP  G 
Sbjct  79    EDWNSTITPLIAGESTYKVTFDLDDDDDIGTPGAFLIKNNHHSEFYLKSLKLQNVPGQGV  138

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG-ELKEWD  661
             +HF C SWVYP+ KY  +RIFFSN+ Y  S+TPAPL KYR+EEL  LRG+G   +LKEWD
Sbjct  139   IHFTCNSWVYPSQKYQKDRIFFSNKTYFLSETPAPLLKYREEELETLRGSGDSIQLKEWD  198

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDL DPDKG +Y RP+LGG+SEYPYPRRGRT R P K+D NSESR+ L  SL
Sbjct  199   RVYDYAYYNDLADPDKGPKYVRPVLGGSSEYPYPRRGRTNRPPAKSDANSESRLNLAMSL  258

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+FGH+K++DFL YA+K++ Q + PE ESLFDSTP EFDS +D+L LYEGGI+
Sbjct  259   DIYVPRDERFGHVKMSDFLAYAIKAIVQVIKPELESLFDSTPNEFDSLEDVLKLYEGGIE  318

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +P+G  +  I D IP EMLKE++R+DG+ L K+P P VI+
Sbjct  319   VPEGA-VKRIRDKIPAEMLKEILRTDGQKLLKYPVPHVIK  357



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =   422 bits (1086),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 255/340 (75%), Gaps = 7/340 (2%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKIKG VVL + N     DF A I+D + +F G+ VSL+L+S+V  D  NG +GK  KA 
Sbjct  33    KKIKGTVVLRKTN-----DFGALILDRVHEFFGRGVSLQLISAVHGDPDNGNRGKLGKAV  87

Query  305   YLDHWVLKNT-VLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             +L+  +   T VL++ E+AF I F+W E  G P AFII+N+  ++FYLKT+TLED+P HG
Sbjct  88    HLERSITTITSVLSAVEAAFNITFDWDEAMGFPGAFIIRNHRHSQFYLKTVTLEDIPGHG  147

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             ++ F C SWVYPA +YNY+RIFFSN+ +LP  TP PL+ YR++EL+ LRG G+G LKEWD
Sbjct  148   QLLFICNSWVYPAHRYNYDRIFFSNKTFLPCNTPEPLRYYREQELIGLRGNGSGMLKEWD  207

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG PDKG EYARP+LGG+  YPYPRRGRT R PT+ DPN ESR+PLL  L
Sbjct  208   RVYDYAYYNDLGMPDKGPEYARPVLGGSKTYPYPRRGRTDRPPTEADPNIESRLPLL-GL  266

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             +IYVPRDE+F  +K++DFL  ALKSV Q L  E  +LFD TP EFD+FQD+LNLYE G+K
Sbjct  267   NIYVPRDERFSPVKMSDFLACALKSVGQVLPAEIVALFDKTPNEFDTFQDVLNLYERGVK  326

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP   LL  I + IP E+LKEL+RSDGE LFKFP P VI+
Sbjct  327   LPNRALLNKIREYIPCEILKELVRSDGERLFKFPMPDVIK  366



>emb|CDP20619.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 255/332 (77%), Gaps = 10/332 (3%)
 Frame = +2

Query  152   MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDHWVLKN  331
             M+K+VLDFNDF+A++VD L +FLG+KVSL+LVSSV+AD      GK    AYL++W+   
Sbjct  1     MKKHVLDFNDFSAAVVDLLYEFLGKKVSLQLVSSVKADHS----GKLGTPAYLENWITTF  56

Query  332   TVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWV  511
             + + +GESA  + F+W ED GVP AFIIKN H  EFYLKTLTLE+VP H  +HF C S V
Sbjct  57    SSVKAGESALSVTFDWDEDNGVPGAFIIKNFHQYEFYLKTLTLENVPGHDSIHFVCNSCV  116

Query  512   YPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYND  691
             YPA+KY  +RIFFSNQAYLP+ T  PLK  R+ EL +LRG GTGELKEWDR+YDYA YND
Sbjct  117   YPANKYKTDRIFFSNQAYLPNNTSEPLKFCREAELANLRGDGTGELKEWDRIYDYACYND  176

Query  692   LGDPD-KGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEK  868
             LGDPD K A Y  PILGG+  YPYPRRGRTGR  TKTDPNSESR+PLL SL+IYVPRDE+
Sbjct  177   LGDPDRKDASYVSPILGGSVVYPYPRRGRTGRPSTKTDPNSESRLPLLESLNIYVPRDER  236

Query  869   FGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTA  1048
             FGHLK++DFL Y LKS++QFLL ++ +  DS   EFDSF+D+  +YEGGIK+P+     +
Sbjct  237   FGHLKMSDFLAYELKSISQFLLSKYGNKSDSNSMEFDSFEDVQKIYEGGIKIPK-----S  291

Query  1049  IADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             + + I LE LK+++ +DGEGL K+P  ++I+G
Sbjct  292   LTEGISLEFLKQVLPTDGEGLLKYPLLKIIEG  323



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   422 bits (1084),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/348 (58%), Positives = 252/348 (72%), Gaps = 4/348 (1%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E  S    IKG VVLM+KN+L+ ND  AS +D + + LG+ VSL LVS+V  D  NG +G
Sbjct  69    EPPSDANNIKGTVVLMKKNLLELNDLGASFIDRVHELLGKAVSLRLVSAVNTDPANGNRG  128

Query  287   KRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
             K  KAAYL++W+ K T L + E AFK+ F W E  GVP AFII+N H +EFYLK+LTLE+
Sbjct  129   KIGKAAYLENWISKVTPLTAAECAFKVNFVWDEKIGVPGAFIIRNEHASEFYLKSLTLEN  188

Query  467   VPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRG---TG  637
             VP  G VHF C SWVYPA KY  +R+FF+N+ YL S+TP  LKK+R+EELV LRG     
Sbjct  189   VPGKGRVHFDCNSWVYPADKYKKDRVFFTNKTYLSSETPVGLKKFREEELVTLRGDDVVK  248

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
              GEL+EWDRVYDYAYYNDLG PDKG +YARPILGG++E+PYPRRGRTGRA    DP SE 
Sbjct  249   KGELQEWDRVYDYAYYNDLGSPDKGEKYARPILGGSAEFPYPRRGRTGRAANLKDPKSER  308

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
              +PL+  L +YVPRDEKFGHLK++D + YALKS++Q L P+  +       EFDS +D+L
Sbjct  309   PLPLVKGLFVYVPRDEKFGHLKMSDLIAYALKSISQILKPDELATLLGHQKEFDSLEDVL  368

Query  998   NLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              LYEGG++LP+G LL  +    P E +KEL R+DGE L KFP PQVI+
Sbjct  369   KLYEGGVELPEG-LLKFVRSTTPAETVKELFRTDGERLLKFPVPQVIK  415



>ref|XP_009790810.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=853

 Score =   420 bits (1079),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 256/348 (74%), Gaps = 3/348 (1%)
 Frame = +2

Query  98    KLAEALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNG  277
             KL+     T  +KG VVLM+KN LD +D  AS+VD + + LG KVSL+L+ +V AD  N 
Sbjct  4     KLSNPSKKTTNVKGTVVLMKKNFLDLDDVKASVVDRVDEVLGHKVSLQLIGAVNADPANK  63

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  457
              +GK  K A+L++W  K T L + ++ F++ FEW E+ GVP AF+IKN H  EFYLK LT
Sbjct  64    CRGKPGKPAFLENWEAKFTPLTATDATFRVTFEWEEEAGVPGAFLIKNFHQKEFYLKKLT  123

Query  458   LEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG  637
             L+DVP HG V F C SW+YP+  Y  +RIFFSNQ YLPSQTP  L+ YR+EEL +LRG G
Sbjct  124   LDDVPGHGRVCFICNSWIYPSEYYKKDRIFFSNQTYLPSQTPENLRSYREEELENLRGNG  183

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
              G+L+EWDR+YDY  YNDLGDPDK  +Y R ILGG+++YPYPRRGRTGR PT TDP SES
Sbjct  184   IGKLEEWDRIYDYDVYNDLGDPDKAPKYERKILGGSADYPYPRRGRTGRLPTLTDPKSES  243

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
             R+P++ SL+IYVPRDE+F  LK++DF  YALK ++QFLL E E+   S  TEFD+F+D L
Sbjct  244   RLPMIKSLEIYVPRDERFNQLKMSDFAAYALKLLSQFLLAELEA---SNFTEFDTFEDEL  300

Query  998   NLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              +Y+ G K P   L+  I D++P+E++KEL+RSDGE L KFP PQVI+
Sbjct  301   KIYDDGFKFPFESLVHKIRDHVPMELVKELLRSDGEHLCKFPMPQVIK  348



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   420 bits (1079),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 256/342 (75%), Gaps = 5/342 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI G VVLMR NVLDFNDF ++++DNL + LG  VSL+LVS+   D     +GK  +AA
Sbjct  18    KKIHGTVVLMRDNVLDFNDFGSTVLDNLHELLGGGVSLQLVSAQHGDPSKEFQGKVGEAA  77

Query  305   YLDHWVLKNTVLA--SGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             YL++W+  NT+L   +GE+AF I F+W E+ G+P AF I N H +EF+LK+LTL+DVP H
Sbjct  78    YLENWI-GNTILPIFAGETAFSITFDWDEEIGIPGAFFITNQHFSEFFLKSLTLDDVPGH  136

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEW  658
             G +HF C SWVYPA KY   RIFF+NQAYLP++ P PL KYR +EL+ LRG G GE KEW
Sbjct  137   GRIHFDCNSWVYPADKYQTPRIFFANQAYLPNEMPKPLVKYRADELLTLRGNGKGERKEW  196

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT-  835
             DR+YDY  YND+GDPD   + +RP+LGG+S+YPYPRRGRTGR P+K DP SESR+   + 
Sbjct  197   DRIYDYDVYNDIGDPDSNLDLSRPVLGGSSKYPYPRRGRTGRPPSKKDPKSESRLASSSK  256

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             + D+YVPRDE+FGHLK++DFL Y LKS+++ + P+ E LFDSTP EFD F D+ +LYE G
Sbjct  257   ATDVYVPRDERFGHLKMSDFLAYGLKSISRSIKPKLEDLFDSTPGEFDDFNDVFDLYEKG  316

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             + +P+  LL  I +NIP  +LKE+ R+DGE   +FPTPQ+I 
Sbjct  317   LPVPRT-LLQGITENIPAPLLKEIFRTDGERFLRFPTPQLIH  357



>gb|KCW61804.1| hypothetical protein EUGRSUZ_H04500 [Eucalyptus grandis]
Length=633

 Score =   412 bits (1060),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 254/347 (73%), Gaps = 9/347 (3%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVD---NLSDFL------GQKVSLELVSSVQADLGNGL  280
             +I+G+VVL +K   DF  F ++IV+    L D +      G+ VS++ +S+V AD GN L
Sbjct  31    RIRGQVVLRKKKATDFTSFASTIVEVGRGLVDKVTGHELGGKDVSVQFISAVNADHGNEL  90

Query  281   KGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTL  460
             +GK     +L+  V  +     GE AF +      + GVP AF+I+NNH +EF+LKT+TL
Sbjct  91    QGKLGNPVHLEDPVKTSACSTPGELAFSLTHHLDREIGVPGAFLIRNNHHSEFFLKTVTL  150

Query  461   EDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGT  640
             EDVP HG++HF C SWVYPA  Y  +RIFF+N+ YLPS+TPAPL KYR+EEL +LRG GT
Sbjct  151   EDVPGHGQIHFVCNSWVYPAHCYAKDRIFFANKTYLPSETPAPLNKYREEELENLRGDGT  210

Query  641   GELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESR  820
             GE KEW+RVYDYAYYNDL +P KG  Y RPILGG++++PYPRRGRTGR PTK DP+ ESR
Sbjct  211   GERKEWERVYDYAYYNDLSEPQKGPNYVRPILGGSTDHPYPRRGRTGRPPTKEDPDVESR  270

Query  821   IPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILN  1000
             +P+L SL IYVPRDE+F H+K +D L +A+KSVA FL+P  E  FD TP EFD+FQ+IL 
Sbjct  271   LPILQSLSIYVPRDERFSHIKFSDLLAFAVKSVAHFLIPAAEGQFDRTPREFDNFQEILK  330

Query  1001  LYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +YEGGIKL +   + +I +++P EML+EL+R+D +G  KFPTPQVI+
Sbjct  331   VYEGGIKLQKNQFIESIMESVPSEMLRELLRTDSDGFLKFPTPQVIK  377



>ref|XP_007225308.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
 gb|ACH90245.1| lipoxygenase LOX-2 [Prunus persica]
 gb|EMJ26507.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
Length=881

 Score =   419 bits (1078),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 202/343 (59%), Positives = 254/343 (74%), Gaps = 5/343 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLG-NGL--KGKR  292
             + KI+G+VVLM+KNV+DF D  AS  D + + LG+ VS++L+S+ Q +   NGL  +G+ 
Sbjct  28    SSKIRGEVVLMKKNVMDFTDIRASFTDRIFELLGKGVSMQLISNNQPEPAENGLISRGRL  87

Query  293   SKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP  472
              KAAYL+ WV   T   +GE+ F I  +W    GVP A ++KN+H ++FYLKT+TLE+VP
Sbjct  88    GKAAYLEKWVTTITSTTAGETTFTISMDWENSMGVPEALLVKNHHHSQFYLKTITLENVP  147

Query  473   NHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELK  652
              HG +HF C SWVYPA  Y Y RIFF N+AYLPS+TP  L  YR+EEL +LRG+G+ +LK
Sbjct  148   EHGRLHFVCNSWVYPARYYKYNRIFFPNKAYLPSKTPGLLLPYREEELKNLRGSGSRKLK  207

Query  653   EWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLL  832
             EWDRVYDYA YNDLG PD G E+ARPILGG S+ PYPRRG+TGR PTKTDP+SESR+ LL
Sbjct  208   EWDRVYDYATYNDLGSPDDGPEHARPILGG-SQCPYPRRGKTGRKPTKTDPDSESRLALL  266

Query  833   TSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEG  1012
               L+IYVPRDE+F H+K +DF+ Y LKS+AQ LLPE  SL D T  EFD+F+D+ NLY+G
Sbjct  267   -DLNIYVPRDERFSHVKFSDFIAYFLKSLAQVLLPELRSLCDKTINEFDTFEDVFNLYDG  325

Query  1013  GIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              I+LP GP L  I D IP E+ KEL+RSDGE   KFP P VI 
Sbjct  326   CIELPNGPTLKKIRDCIPWELFKELVRSDGERFLKFPLPDVIN  368



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   416 bits (1070),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 263/340 (77%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  K A
Sbjct  22    KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  81

Query  305   YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  82    YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  141

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA  Y Y+R+FF+N+AYLPS TP PL+ YR++EL++L+G G+G LKEWD
Sbjct  142   PVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGSGMLKEWD  201

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG P+KG +YARP+LGG+ +YPYPRRGRTGR P K D N+ESR+ LL SL
Sbjct  202   RVYDYAYYNDLGSPEKGKDYARPVLGGSKDYPYPRRGRTGRRPNKKDLNTESRLFLL-SL  260

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             + YVPRDEKF  +K +DF+ Y+LKS+ Q L+PE +++FD T  EFD+F+D+LNLYEGGIK
Sbjct  261   NTYVPRDEKFNQVKFSDFIGYSLKSLVQVLIPEIKAVFDKTINEFDTFEDVLNLYEGGIK  320

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP G  L  I + +P E++KELIRSDGE   KFP P VI+
Sbjct  321   LPDGHTLHKIRECVPWELIKELIRSDGERFLKFPMPDVIK  360



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   416 bits (1070),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 263/340 (77%), Gaps = 2/340 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G+VVLM+KNV+D  D  AS++D L +  G+ VS +L+S+ + DL NG +GK  K A
Sbjct  33    KKIQGRVVLMKKNVMDAADVGASVLDRLHEIFGRGVSFQLISAEKTDLANGKRGKLGKEA  92

Query  305   YLDHWVLKNTVL-ASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL+ WV K T L A  E+ F + F+W E  GVP AFI++N+H ++FYLKT+TLEDVP HG
Sbjct  93    YLEGWVSKFTSLTAEAEATFDVSFKWDESLGVPGAFIVRNHHHSQFYLKTVTLEDVPGHG  152

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              VHF C SWVYPA  Y Y+R+FF+N+AYLPS TP PL+ YR++EL++L+G G+G LKEWD
Sbjct  153   PVHFVCNSWVYPAHCYKYDRVFFTNKAYLPSDTPEPLRVYREQELINLQGNGSGMLKEWD  212

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDYAYYNDLG P+KG +YARP+LGG+ +YPYPRRGRTGR P K D N+ESR+ LL SL
Sbjct  213   RVYDYAYYNDLGSPEKGKDYARPVLGGSKDYPYPRRGRTGRRPNKKDLNTESRLFLL-SL  271

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             + YVPRDEKF  +K +DF+ Y+LKS+ Q L+PE +++FD T  EFD+F+D+LNLYEGGIK
Sbjct  272   NTYVPRDEKFNQVKFSDFIGYSLKSLVQVLIPEIKAVFDKTINEFDTFEDVLNLYEGGIK  331

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP G  L  I + +P E++KELIRSDGE   KFP P VI+
Sbjct  332   LPDGHTLHKIRECVPWELIKELIRSDGERFLKFPMPDVIK  371



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =   414 bits (1064),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 236/288 (82%), Gaps = 1/288 (0%)
 Frame = +2

Query  278   LKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLT  457
             ++G+  K AYL+ W+   + L +G+SA+++ F+W E  GVP AFII+N H +EFY+KTLT
Sbjct  1     MRGRVGKPAYLEDWITTISPLTAGDSAYEVYFDWDEKIGVPGAFIIRNEHHSEFYMKTLT  60

Query  458   LEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG  637
             LE+VP HG +HF C SWVYP  KY  +RIFF+N+ YLPS+TPA L+KYR+EELV+LRG G
Sbjct  61    LENVPGHGRLHFVCNSWVYPTDKYRTDRIFFTNKTYLPSETPATLRKYREEELVNLRGDG  120

Query  638   TGELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSES  817
              GELKEWDRVYDYAYYNDLG+PDKG +Y RP+LGG+++YPYPRRGRTGR PTKTDP  E+
Sbjct  121   KGELKEWDRVYDYAYYNDLGNPDKGEKYVRPVLGGSAKYPYPRRGRTGRPPTKTDPKVET  180

Query  818   RIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDIL  997
             R+ LL SL+IY PRDE+FGHLKL+DFL YALKS+ QFL PE E +F+STP EFDSF+D+L
Sbjct  181   RLQLLLSLNIYAPRDERFGHLKLSDFLAYALKSIGQFLKPELEDVFNSTPNEFDSFEDVL  240

Query  998   NLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              LYEGG+++P+G LL +I D+ P E++KE+ R+DGE L KFP PQVI+
Sbjct  241   KLYEGGVEVPEG-LLKSIRDSTPAEIIKEIFRTDGERLLKFPVPQVIK  287



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 231/293 (79%), Gaps = 6/293 (2%)
 Frame = +2

Query  269   GNGLKGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLK  448
             GN LKGK    A+L+ W+   T L +GESAF + F+W E+ G P AFIIKN H NEFYLK
Sbjct  8     GNALKGKLGTPAFLEKWITTLTSLTAGESAFNVTFDWDEEVGAPGAFIIKNLHHNEFYLK  67

Query  449   TLTLEDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLR  628
             T+TLEDVP H  +HF C SWVYPA KY  +RIFFSNQAYLP  TP PLK YR+ ELV+LR
Sbjct  68    TVTLEDVPGHERIHFVCNSWVYPADKYKTDRIFFSNQAYLPHNTPEPLKFYREAELVNLR  127

Query  629   GTGTGELKEWDRVYDYAYYNDLGDPDKG-AEYARPILGGNSEYPYPRRGRTGRAPTKTDP  805
             G GTGE KEWDR+YDYAYYNDLGDPDK    Y RP+LGG+ EYPYPRRGRTGR PTKTDP
Sbjct  128   GDGTGERKEWDRIYDYAYYNDLGDPDKNDPSYVRPVLGGSVEYPYPRRGRTGRPPTKTDP  187

Query  806   NSESRIPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSF  985
              SESR+PLL SL+IYVPRDE+FGHLK++DFL Y LKS++Q L  E E+ FDSTP+EFDSF
Sbjct  188   KSESRLPLLMSLNIYVPRDERFGHLKMSDFLAYGLKSISQLLSSELEAQFDSTPSEFDSF  247

Query  986   QDILNLYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             +D+  +YEGGIKLP+     ++ +NI LE+LK+++ +DGEGL K+P P++I+G
Sbjct  248   EDMQKIYEGGIKLPK-----SLTENISLEILKQVLPTDGEGLLKYPLPKIIEG  295



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =   414 bits (1064),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 255/342 (75%), Gaps = 8/342 (2%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KKI+G VVLM+KNVL+ ND  AS +D   +  G+KVSL+L+SSV  D  NGL+GK  KAA
Sbjct  86    KKIRGTVVLMKKNVLELNDLKASFLDRFHELRGKKVSLQLISSVNCDPENGLQGKVGKAA  145

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL+ W+ K T L + E+AF I F+W E+ GVP AFII+N H +EFYLK+LTLEDVP  G 
Sbjct  146   YLEDWITKITPLTAEENAFDITFDWDEEIGVPGAFIIRNEHHSEFYLKSLTLEDVPGEGR  205

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG---ELKE  655
             VHF C SWVYPA KY  +R+FF+N+ YL S TP PL+K+R+EEL +LRG       EL+E
Sbjct  206   VHFVCNSWVYPAKKYKKDRVFFANKTYLSSDTPVPLQKFREEELENLRGDDDDEKRELEE  265

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVY YAYYNDLG PDKG EYARPILGG+SE+PYPRR RTGR  T+     ES + L+ 
Sbjct  266   WDRVYGYAYYNDLGKPDKGPEYARPILGGSSEFPYPRRVRTGRQATE----KESPMMLIM  321

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             S+ +YVPRDE+FGHLK++D + YA+KS++Q + P+  +   +T  EF S +D+L LYEGG
Sbjct  322   SIFVYVPRDERFGHLKMSDAIAYAVKSLSQLVKPDELATLVATQNEFGSLKDVLKLYEGG  381

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             I+LP+G LL ++ DNIP+E +KEL R+DGE   KFP PQVI+
Sbjct  382   IELPKG-LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIK  422



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis sativus]
Length=860

 Score =   412 bits (1059),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 249/340 (73%), Gaps = 1/340 (0%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
              +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  K 
Sbjct  17    VQKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKK  76

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
              YL +W+ K   ++ GE+ FKI F W ED G+P AFII+NNH  +F+LK+LTLEDVP  G
Sbjct  77    TYLGNWMTKMVPVSPGETMFKISFVWEEDIGIPGAFIIRNNHFTKFFLKSLTLEDVPFVG  136

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
              +HF C SW+YP+ KY  +RIFF N+AY+P++TP PL+KYR +EL +LRG GTGE +EWD
Sbjct  137   RIHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYRQDELKNLRGDGTGERQEWD  196

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             R+YDY  YNDL DP  G+ Y RP+LGG+++YPYPRRGRTGR+P+K D   ESR+    SL
Sbjct  197   RIYDYDVYNDLEDPSSGSTYIRPVLGGSTQYPYPRRGRTGRSPSKKDKKYESRLSSSLSL  256

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             + YVPRDE+FGHLK +DFL Y LKSVAQ + P  + LF   P EFDSFQD+LNLYEGG  
Sbjct  257   NTYVPRDERFGHLKESDFLAYTLKSVAQSIKPALDELFSRNPGEFDSFQDVLNLYEGGFS  316

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP+  LL     NIP  +LKE+ R+DGE   KFP PQVIQ
Sbjct  317   LPKS-LLEKFRQNIPAPLLKEIFRTDGENFLKFPLPQVIQ  355



>ref|XP_003592410.1| Lipoxygenase [Medicago truncatula]
 gb|AES62661.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=856

 Score =   411 bits (1057),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 253/340 (74%), Gaps = 3/340 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             +KGKVVLM+K++LDF+D  ++++D + +FLG+ VSL+L+S+   D   GLKGK  K A L
Sbjct  9     VKGKVVLMKKSLLDFHDIKSNVLDRIHEFLGKGVSLQLISATAPDPAKGLKGKHGKVACL  68

Query  311   DHWVLKNTVLASG-ESAFKIEFEWS-EDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             + W+   + L +  ++ F + F+W  E  GVP AF+I+NNH ++FYLKT+TL+D+P HG 
Sbjct  69    ERWMSSISSLTTATDTEFSVTFDWDHEKMGVPGAFLIRNNHHSQFYLKTVTLDDIPGHGP  128

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             + F C SWVYP  +Y ++R+FF+N+AYLP  TP  L+K R+EEL  LRG G G+L EWDR
Sbjct  129   ITFVCNSWVYPTHRYTHDRVFFANKAYLPCDTPEALRKLREEELGTLRGKGIGKLNEWDR  188

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             VYDYA YNDLG PD G +YARP++GG+ ++PYPRRGRT R  TKTDP +ESR+ LL +L+
Sbjct  189   VYDYACYNDLGTPDNGPDYARPVIGGSQKFPYPRRGRTSRPHTKTDPKTESRLHLL-NLN  247

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGH+K +DFL Y+LKSV Q LLPE  SL D T  EFD+FQD+L++YEG   L
Sbjct  248   IYVPRDEQFGHVKFSDFLAYSLKSVTQVLLPELRSLCDKTINEFDTFQDVLDIYEGSFNL  307

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQG  1144
             P GPL + I D IP E+ +EL+R+DGE   +FP P VI+ 
Sbjct  308   PSGPLHSKIRDLIPYEIFRELVRNDGEKFLRFPVPDVIKA  347



>gb|AEU04516.1| lipoxygenase 1 [Taxus wallichiana var. chinensis]
Length=855

 Score =   411 bits (1057),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 253/341 (74%), Gaps = 5/341 (1%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             + +KG VVL +KNVLD NDF+A IVDNLS+ LG  VSL LV        +G K  +S+ A
Sbjct  7     ESVKGVVVLQKKNVLDLNDFHAGIVDNLSELLGSGVSLTLVGLGTPPTKSGAK-LQSEPA  65

Query  305   YLDHWVLKNTVLASGESAFKIEFEW-SEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             YL  W+     + +G++ + +EF+W S   G P AF IKN H +EF+L +LTL  +P   
Sbjct  66    YLKKWITTRDGVVTGQTTYPVEFKWDSIQMGTPGAFFIKNFHKHEFFLNSLTLH-LPGAA  124

Query  482   E--VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
             +  VHF C SWVYPAS+YN +RIFFSN+ YLP +TP  L K R+EELV+LRG G+G+ +E
Sbjct  125   QDTVHFVCDSWVYPASRYNTDRIFFSNRNYLPHETPPALVKLRNEELVNLRGDGSGKREE  184

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDY  YNDLG+PDK  EY+R +LGG+ ++PYPRRGRTGR PTKTD  SESR+P+ +
Sbjct  185   WDRVYDYDLYNDLGNPDKDEEYSRQVLGGSKDFPYPRRGRTGRKPTKTDAASESRVPIQS  244

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             SLDI+VPRDE+FGHLKL+DFL YALKSV Q LLPE +SLFDSTP EFDSF+D++ LY  G
Sbjct  245   SLDIFVPRDERFGHLKLSDFLAYALKSVGQVLLPELKSLFDSTPNEFDSFEDLMKLYSDG  304

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVI  1138
             IKLP  PLL A    IPLE +K+L+RSDGE L KFP P+VI
Sbjct  305   IKLPSNPLLDAARSLIPLEFIKQLVRSDGEKLLKFPIPKVI  345



>ref|XP_009407000.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Musa acuminata 
subsp. malaccensis]
Length=1131

 Score =   418 bits (1074),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 197/343 (57%), Positives = 258/343 (75%), Gaps = 10/343 (3%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA-  304
             ++KG VVLM+KNVLDFND   +++D L + LGQ V+ +LVS+   D  NG +G   +AA 
Sbjct  21    QVKGTVVLMQKNVLDFNDLAGNVIDGLFELLGQGVTFQLVSATVGDPDNGNRGVVGEAAS  80

Query  305   --YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
               YL H       LA+GES + + F+W E+ G+P A I+KN H  +F+LKTLTL++ P  
Sbjct  81    LQYLGHL----PSLAAGESKYSVTFQWQENHGIPGAVIVKNKHATQFFLKTLTLDNFPGK  136

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTG-TGELKE  655
             G +HF C SWVYPASKY Y+R+FF+N  YL + TP PLK YR +EL +LRG   TGELKE
Sbjct  137   GRIHFVCNSWVYPASKYKYDRVFFANTTYLLADTPEPLKPYRQDELRNLRGQDVTGELKE  196

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG PD+GA + RPILGG++EYPYPRRG+TGRAPTKTDP +ESR+PLL 
Sbjct  197   WDRVYDYAYYNDLGSPDQGANHVRPILGGSAEYPYPRRGKTGRAPTKTDPKTESRLPLL-  255

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             +L+IYVPRDE+FGHLK+ DFLTYA+K+++  LLP  +++FD TP EFDSF+++L+LYE G
Sbjct  256   NLNIYVPRDERFGHLKMGDFLTYAIKAISTGLLPTLQAIFDITPNEFDSFEEVLSLYENG  315

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSD-GEGLFKFPTPQVIQ  1141
             + +PQ PLL  +   IP EM++EL+R++ G+   K P P VIQ
Sbjct  316   LPVPQIPLLDELRQRIPFEMIRELLRTEKGQNFLKLPKPHVIQ  358



>ref|XP_010025191.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61803.1| hypothetical protein EUGRSUZ_H04500 [Eucalyptus grandis]
Length=877

 Score =   412 bits (1058),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 254/347 (73%), Gaps = 9/347 (3%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVD---NLSDFL------GQKVSLELVSSVQADLGNGL  280
             +I+G+VVL +K   DF  F ++IV+    L D +      G+ VS++ +S+V AD GN L
Sbjct  31    RIRGQVVLRKKKATDFTSFASTIVEVGRGLVDKVTGHELGGKDVSVQFISAVNADHGNEL  90

Query  281   KGKRSKAAYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTL  460
             +GK     +L+  V  +     GE AF +      + GVP AF+I+NNH +EF+LKT+TL
Sbjct  91    QGKLGNPVHLEDPVKTSACSTPGELAFSLTHHLDREIGVPGAFLIRNNHHSEFFLKTVTL  150

Query  461   EDVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGT  640
             EDVP HG++HF C SWVYPA  Y  +RIFF+N+ YLPS+TPAPL KYR+EEL +LRG GT
Sbjct  151   EDVPGHGQIHFVCNSWVYPAHCYAKDRIFFANKTYLPSETPAPLNKYREEELENLRGDGT  210

Query  641   GELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESR  820
             GE KEW+RVYDYAYYNDL +P KG  Y RPILGG++++PYPRRGRTGR PTK DP+ ESR
Sbjct  211   GERKEWERVYDYAYYNDLSEPQKGPNYVRPILGGSTDHPYPRRGRTGRPPTKEDPDVESR  270

Query  821   IPLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILN  1000
             +P+L SL IYVPRDE+F H+K +D L +A+KSVA FL+P  E  FD TP EFD+FQ+IL 
Sbjct  271   LPILQSLSIYVPRDERFSHIKFSDLLAFAVKSVAHFLIPAAEGQFDRTPREFDNFQEILK  330

Query  1001  LYEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             +YEGGIKL +   + +I +++P EML+EL+R+D +G  KFPTPQVI+
Sbjct  331   VYEGGIKLQKNQFIESIMESVPSEMLRELLRTDSDGFLKFPTPQVIK  377



>ref|XP_004230207.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=863

 Score =   411 bits (1057),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 256/340 (75%), Gaps = 2/340 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D  N  +GK  K 
Sbjct  25    TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDAANKGRGKLGKP  84

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A L+ W  K + L   E+ F + FEW+E+ G+P AF+IKN+H NEFYLKTLTL+DVP HG
Sbjct  85    ANLEGW--KISTLTEREATFSVNFEWNEEIGIPGAFLIKNSHHNEFYLKTLTLDDVPGHG  142

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +V F C SW+Y +  Y  +R+FF+NQ YLP++TPAPL+ YR+EEL +LRG GTG+ +EWD
Sbjct  143   KVKFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREEWD  202

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY  YNDLGDP+KG  Y R ILGG+S+YPYPRRGRTGR PTK DP SESR+PL  +L
Sbjct  203   RVYDYDVYNDLGDPEKGETYVRKILGGSSDYPYPRRGRTGRPPTKIDPKSESRLPLRKTL  262

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
             DIYVPRDE+F  LK++DF    LKS+ QFL+P F +LF+ TP EFDSF+D+  LYEGGI+
Sbjct  263   DIYVPRDERFSPLKMSDFAATGLKSIFQFLVPGFLALFNKTPFEFDSFEDMWKLYEGGIR  322

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP    +  I D++PLE+LKEL+RSDG+  FKFP PQVI+
Sbjct  323   LPSKSFVDKIRDHLPLELLKELLRSDGDYAFKFPMPQVIR  362



>ref|XP_009625816.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=832

 Score =   409 bits (1052),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/330 (59%), Positives = 246/330 (75%), Gaps = 3/330 (1%)
 Frame = +2

Query  152   MRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYLDHWVLKN  331
             M+KN LD +D  AS+VD + + LG KVSL+L+S+V AD  N  +GK  K A+L++W  K 
Sbjct  1     MKKNFLDLDDVKASVVDRVDEILGHKVSLQLISAVNADPANKCRGKPGKPAFLENWEAKF  60

Query  332   TVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEVHFACFSWV  511
             T L + ++ F + FEW E+ GVP AF+IKN H  EFYLKTLTL+DVP  G V F C SW+
Sbjct  61    TPLTATDATFGVTFEWEEEAGVPGAFLIKNFHQKEFYLKTLTLDDVPGRGRVCFICNSWI  120

Query  512   YPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRVYDYAYYND  691
             YP+  Y  +RIFFSNQ YLPSQTP PL+ YR+EEL +LRG G G+L+EWDR+YDY  YND
Sbjct  121   YPSEYYKRDRIFFSNQTYLPSQTPEPLRSYREEELENLRGNGIGKLEEWDRIYDYDVYND  180

Query  692   LGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDIYVPRDEKF  871
             LGDPDKG +Y R ILGG+++YPYPRRGRTGR PT TDP SESR+PL  SL+IYVPRDEKF
Sbjct  181   LGDPDKGPKYERKILGGSADYPYPRRGRTGRLPTATDPKSESRLPLHKSLEIYVPRDEKF  240

Query  872   GHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLPQGPLLTAI  1051
               LK++DF  YALK ++QFLL E E+   S  TEFD+F+D L +Y+ G K P   L+  +
Sbjct  241   NQLKMSDFAAYALKLLSQFLLAELEA---SNFTEFDTFEDELKIYDDGFKFPFESLVHKL  297

Query  1052  ADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              D +P+E++KEL+RSDGE L KFP PQVI+
Sbjct  298   RDLVPMELVKELLRSDGEHLCKFPMPQVIK  327



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   410 bits (1054),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/339 (57%), Positives = 251/339 (74%), Gaps = 1/339 (0%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             +KIKG+V+L+R N LD+N+  +S++DN+S+F G KVS +L+SS   D    L+GK  K  
Sbjct  16    QKIKGQVILLRSNSLDYNEIQSSVLDNISEFWGAKVSFQLISSENGDRSKELQGKVGKKT  75

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             YL +W+ K   ++ GE+ FKI F+W ED G+P AF+I+NNH  +F+LK+LTLEDVP  G 
Sbjct  76    YLGNWMTKMVPVSPGETVFKISFDWDEDIGIPGAFLIRNNHFTKFFLKSLTLEDVPFVGR  135

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SW+YP+ KY  +RIFF N+AY+P++TP PL+KYR++EL +LRG GTGE +EWDR
Sbjct  136   IHFDCNSWIYPSGKYKNDRIFFINKAYIPNETPEPLRKYREDELKNLRGDGTGERQEWDR  195

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLD  844
             +YDY  YNDL DP   + Y RP+LGG+++YPYPRRGRTGR+P+K D N ESR+    SL+
Sbjct  196   IYDYDVYNDLEDPSSDSTYVRPVLGGSTQYPYPRRGRTGRSPSKKDKNYESRLSSSLSLN  255

Query  845   IYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKL  1024
             IYVPRDE+FGHLK +DFL Y LKSVAQ + P  + LF   P EFDSFQD+L LYEGG  L
Sbjct  256   IYVPRDERFGHLKESDFLAYTLKSVAQSIKPALDELFSRNPGEFDSFQDVLKLYEGGFSL  315

Query  1025  PQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             P+  LL     +IP  +LKE+ R+DGE   KFP PQVIQ
Sbjct  316   PKS-LLEKFRQSIPAPLLKEIFRTDGEKFLKFPLPQVIQ  353



>gb|ACD43483.1| lipoxygenase 1 [Olea europaea]
Length=869

 Score =   410 bits (1054),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 252/346 (73%), Gaps = 2/346 (1%)
 Frame = +2

Query  107   EALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKG  286
             E  +  +KI+G V+LM+KNV++  D  AS +D + + +G+ V+L+L+S+  AD  NG +G
Sbjct  16    EPKTEERKIRGTVLLMKKNVMEMTDVGASFLDRVHEIVGKGVTLQLISASHADPANGSRG  75

Query  287   KRSKAAYLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLE  463
             K  K AYL+HWV K T L++ + A F I F+W E  GVP AFII+N+H ++FYLK +TLE
Sbjct  76    KLGKEAYLEHWVTKFTSLSAKDDAMFNITFDWDESMGVPGAFIIRNHHHSQFYLKKVTLE  135

Query  464   DVPNHGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             DVP HG++ F C SWVYPA +Y  +R+FF+ + YLP  TP PL+ YR++EL +LRG G+G
Sbjct  136   DVPGHGQLQFVCNSWVYPAHRYKNDRVFFAYKTYLPCNTPEPLRAYREDELTNLRGDGSG  195

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
              LKEWDRVYDYA YNDLG P+KG EYARP+LG + E+PYPRRGRTGR P + DPNSES++
Sbjct  196   TLKEWDRVYDYALYNDLGSPEKGQEYARPVLGDSKEFPYPRRGRTGREPNEKDPNSESQL  255

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL +L+IYVPRDE+F H+K  DF+ Y+ KS+ Q L+PE E++FD T  EFD FQD+  L
Sbjct  256   PLL-NLNIYVPRDERFSHVKFLDFIGYSFKSLGQVLIPEIEAVFDETINEFDDFQDVHKL  314

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIKLP G  L    + +P E  K L+  DG    +FPTP +I+
Sbjct  315   YEGGIKLPDGHALKNTRECLPWESFKNLLHLDGGRPLQFPTPDIIK  360



>emb|CDY46325.1| BnaC01g31590D [Brassica napus]
Length=882

 Score =   410 bits (1055),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 256/338 (76%), Gaps = 3/338 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             I+G+VV+M+KN+LDF D  AS++D + + LG++VSL L+SS+Q D  N  +G+  KAA+L
Sbjct  37    IEGEVVVMKKNLLDFKDTMASLLDRIHELLGRRVSLHLISSLQPDPANEKRGRLGKAAHL  96

Query  311   DHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGEV  487
             + WV K  T + + E+AF + F+W E  G PAAF+IKN H ++FYLK+LTL +    G +
Sbjct  97    EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNQHRSQFYLKSLTLRNSQG-GAI  155

Query  488   HFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDRV  667
             HF C SW+YP+ +Y  +R+FFSNQAYLPS+TP  +K+ R+EEL +LRG   GELKEWDRV
Sbjct  156   HFVCNSWIYPSHRYRSDRVFFSNQAYLPSETPELVKELREEELKNLRGNEKGELKEWDRV  215

Query  668   YDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSLDI  847
             YDYAYYNDLG PDKG + ARP+LGG+ E+PYPRRG+TGR PTK+DP SESR+ LL +L+I
Sbjct  216   YDYAYYNDLGAPDKGPDSARPVLGGSPEFPYPRRGKTGRKPTKSDPKSESRLALL-NLNI  274

Query  848   YVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIKLP  1027
             YVPRDE+F H+K +DFL YALKSV Q ++PE  SL D T  EFDSF+D+ +LY+G I+L 
Sbjct  275   YVPRDERFSHVKFSDFLAYALKSVTQVIVPEIASLCDKTINEFDSFEDVFHLYDGSIRLA  334

Query  1028  QGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
              G  ++ + D IP EM +ELIR+DGE   KFP P V++
Sbjct  335   NGHTISKLRDIIPWEMFRELIRNDGERFLKFPLPDVLK  372



>ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006606050.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Glycine max]
Length=858

 Score =   410 bits (1053),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 257/342 (75%), Gaps = 6/342 (2%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL   R K 
Sbjct  11    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLL--RGKV  68

Query  302   AYLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             A L+ WV   T L S     F + FEW E  GVP AFII+NNH ++FYLKTLT+ED+P H
Sbjct  69    ANLERWVSTITSLTSTTDTEFSVTFEWDESMGVPGAFIIRNNHHSQFYLKTLTIEDIPGH  128

Query  479   -GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
              G V+F C SWVYPA +Y ++R+FF+N+AYLP  TP PL+K+R++EL  L G G G+L E
Sbjct  129   DGPVNFVCNSWVYPAHRYAHDRVFFANKAYLPCHTPEPLRKFREQELKTLCGKGFGKLNE  188

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG PD G +YARP+LGG S++PYPRRGRT R   KTDP +ESR+ LL 
Sbjct  189   WDRVYDYAYYNDLGLPDDGPDYARPVLGG-SQFPYPRRGRTSRPHCKTDPKTESRLHLL-  246

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             +L++YVPRDE+FGH+K +DFL Y+LKSVAQ LLPE +SL D T  EFD+FQD+L++YEG 
Sbjct  247   NLNVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFQDVLDIYEGS  306

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP GPL + +   +P E+L+ELIR+DGE   KFP P VI+
Sbjct  307   IKLPSGPLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIK  348



>gb|KHN15782.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=858

 Score =   410 bits (1053),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/342 (58%), Positives = 257/342 (75%), Gaps = 6/342 (2%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             +K++KG+VVLM+K VLDF+D  A+++D + + LG+ VSL+L+S+   D   GL   R K 
Sbjct  11    SKRVKGRVVLMKKGVLDFHDIKANVLDRVHELLGKGVSLQLISATTPDPAKGLL--RGKV  68

Query  302   AYLDHWVLKNTVLASGESA-FKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH  478
             A L+ WV   T L S     F + FEW E  GVP AFII+NNH ++FYLKTLT+ED+P H
Sbjct  69    ANLERWVSTITSLTSTTDTEFSVTFEWDESMGVPGAFIIRNNHHSQFYLKTLTIEDIPGH  128

Query  479   -GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKE  655
              G V+F C SWVYPA +Y ++R+FF+N+AYLP  TP PL+K+R++EL  L G G G+L E
Sbjct  129   DGPVNFVCNSWVYPAHRYAHDRVFFANKAYLPCHTPEPLRKFREQELKTLCGKGFGKLNE  188

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG PD G +YARP+LGG S++PYPRRGRT R   KTDP +ESR+ LL 
Sbjct  189   WDRVYDYAYYNDLGLPDDGPDYARPVLGG-SQFPYPRRGRTSRPHCKTDPKTESRLHLL-  246

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             +L++YVPRDE+FGH+K +DFL Y+LKSVAQ LLPE +SL D T  EFD+FQD+L++YEG 
Sbjct  247   NLNVYVPRDEQFGHVKFSDFLAYSLKSVAQVLLPEIKSLCDKTINEFDTFQDVLDIYEGS  306

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP GPL + +   +P E+L+ELIR+DGE   KFP P VI+
Sbjct  307   IKLPSGPLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIK  348



>ref|XP_009108895.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Brassica 
rapa]
Length=889

 Score =   410 bits (1053),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/341 (57%), Positives = 259/341 (76%), Gaps = 5/341 (1%)
 Frame = +2

Query  131   IKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAYL  310
             I+G++V+M+KN+LDF D  AS++D + + LG++VSL L+SS+Q DL N  +G+  KAA+L
Sbjct  40    IEGEIVVMKKNLLDFKDTMASLLDRIHELLGRRVSLHLISSLQPDLANEKRGRLGKAAHL  99

Query  311   DHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNH--G  481
             + WV K  T + + E+AF + F+W E  G PAAF+IKN+H ++FYLK+LTL + P    G
Sbjct  100   EKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHRSQFYLKSLTLRNFPGGEGG  159

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG-ELKEW  658
              +HF C SW+YP+ +Y  +R+FFSNQAYLPS+TP  +K+ R++EL +LRG   G ELKEW
Sbjct  160   AIHFVCNSWIYPSHRYRSDRVFFSNQAYLPSETPELVKELREQELKNLRGEEKGGELKEW  219

Query  659   DRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTS  838
             DRVYDYAYYNDLG PDKG + ARP+LGG+ E+PYPRRG+TGR PTK+DP SESR+ LL +
Sbjct  220   DRVYDYAYYNDLGAPDKGPDSARPVLGGSLEFPYPRRGKTGRKPTKSDPRSESRLALL-N  278

Query  839   LDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGI  1018
             L+IYVPRDE+F H+K +DFL YALKSV Q L+PE  SL D T  EFDSF+D+ +LY+G I
Sbjct  279   LNIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASLCDKTINEFDSFEDVFHLYDGSI  338

Query  1019  KLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             KL  G  ++ + D IP EM +EL+R+DGE   KFP P V++
Sbjct  339   KLANGHTISKLRDIIPWEMFRELVRNDGERFLKFPLPDVLK  379



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =   409 bits (1052),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 252/342 (74%), Gaps = 7/342 (2%)
 Frame = +2

Query  125   KKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAA  304
             KK++G VVLM +  LD  +  AS++D   + +G+ VSL+L+S+  A+   G  GK  K A
Sbjct  31    KKVRGTVVLMEEECLDLTNVGASLLDRFHEVIGKGVSLQLISADHAE--PGCTGKLGKPA  88

Query  305   YLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHGE  484
             +L+ W+   T +++G++ F + F+W E  GVP AFIIKN H ++FYL+T+ LEDVP HGE
Sbjct  89    FLEKWISTLTSISAGDATFNVTFDWDESMGVPGAFIIKNYHHSQFYLRTVVLEDVPGHGE  148

Query  485   VHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWDR  664
             +HF C SWVYPA +Y Y+R+FF+N+ YLPS TP PL+ YR++EL+ LRG+G+G+LKEWDR
Sbjct  149   LHFVCNSWVYPAHRYKYDRVFFANKTYLPSNTPEPLRPYREQELLSLRGSGSGKLKEWDR  208

Query  665   VYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKT---DPNSESRIPLLT  835
             VYDY +YNDLG PDKG +Y RP+LGG+ EYPYPRRGRT R  TKT   DP SESR+P L 
Sbjct  209   VYDYRFYNDLGFPDKGPDYVRPVLGGSKEYPYPRRGRTSRRATKTGFADPMSESRLPPL-  267

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
              LDIY PRDE+F  +KL+DFL YA+KS+ Q L+PE  +LFD T  EFD+F+D+L LYEGG
Sbjct  268   GLDIYAPRDERFTPVKLSDFLAYAVKSLGQVLIPEIAALFDKTINEFDNFEDVLKLYEGG  327

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP    L  +   IP EMLKEL+RSDGE   KFP P VI+
Sbjct  328   IKLPDHH-LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIK  368



>ref|XP_006344625.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
Length=863

 Score =   409 bits (1050),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 257/340 (76%), Gaps = 2/340 (1%)
 Frame = +2

Query  122   TKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKA  301
             TK IKG VVLM+KN LD  D   ++VD + + LG KVSL+L+S+V  D+ N  +GK  K 
Sbjct  25    TKTIKGTVVLMKKNFLDLTDAKDAVVDQIDEILGHKVSLQLISAVNTDVANKGRGKLGKP  84

Query  302   AYLDHWVLKNTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVPNHG  481
             A+L+ W  K + L   ++ F + FEW+E+ GVP AF+IKN+H NEFYLKTLTL+DVP HG
Sbjct  85    AHLEGW--KISTLTERDATFSVNFEWNEEIGVPGAFLIKNSHHNEFYLKTLTLDDVPGHG  142

Query  482   EVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTGELKEWD  661
             +V F C SW+Y +  Y  +R+FF+NQ YLP++TPAPL+ YR+EEL +LRG GTG+ +EWD
Sbjct  143   KVCFVCNSWIYHSEYYKKDRVFFANQTYLPNETPAPLQYYREEELENLRGNGTGKREEWD  202

Query  662   RVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLTSL  841
             RVYDY  YNDLGDP+KG  + R ILGG+S+YPYPRRGRTGR PTK DP SESR+PL  +L
Sbjct  203   RVYDYDVYNDLGDPEKGETHVRKILGGSSDYPYPRRGRTGRPPTKIDPKSESRLPLRKTL  262

Query  842   DIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGGIK  1021
              IYVPRDE+F  LK++DF    LKS+ QFL+P F +LF+ TP EFDSF+D+  LYEGGIK
Sbjct  263   GIYVPRDERFSPLKMSDFAATGLKSIFQFLVPGFLALFNKTPFEFDSFKDMSKLYEGGIK  322

Query  1022  LPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             LP    +  I D++PLE+LKEL+RSDG+  FKFP PQVI+
Sbjct  323   LPSKSFMDKIRDHLPLELLKELLRSDGDYAFKFPMPQVIR  362



>ref|XP_010530359.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Tarenaya 
hassleriana]
Length=883

 Score =   409 bits (1051),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 253/346 (73%), Gaps = 3/346 (1%)
 Frame = +2

Query  110   ALSPTKKIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGK  289
             A      I G+VV+M+KNVLDF D  AS++D + + LG++VS++LVSSVQ D GNG +G+
Sbjct  29    AAGKVTTIHGEVVVMKKNVLDFKDVMASVLDRVHELLGRRVSIQLVSSVQPDPGNGRRGR  88

Query  290   RSKAAYLDHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLED  466
               KAA+L+ WV K  + + + E+AF I FEW E  G P+AF+IKN+H ++F+LK++TL +
Sbjct  89    LGKAAHLEKWVTKIKSAVTAEETAFAIAFEWDESMGTPSAFVIKNHHRSQFFLKSVTLHE  148

Query  467   VPN-HGEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG  643
             VP   G VHF C SW+YP  +Y Y+R+FFSNQAYLP++ P  LK+ R++EL +LRG G G
Sbjct  149   VPGGSGPVHFVCNSWIYPWHRYGYDRVFFSNQAYLPNEMPELLKEIREDELKNLRGNGNG  208

Query  644   ELKEWDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRI  823
             E KEWDRVYDY  +NDLG PDKG + ARP+LG + EYPYPRR RTGR PTK D  SESR+
Sbjct  209   ERKEWDRVYDYDVFNDLGSPDKGQDSARPVLGNSLEYPYPRRCRTGRKPTKVDSKSESRL  268

Query  824   PLLTSLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNL  1003
             PLL SLDIYVPRDE+F  +K +DF+ YALKSV Q ++PE  SL      EFDSF DI +L
Sbjct  269   PLL-SLDIYVPRDERFNMVKFSDFIAYALKSVTQVIVPEIGSLCSKNMNEFDSFDDIFSL  327

Query  1004  YEGGIKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             YEGGIK P   +++ I D +P EM +EL+R+DG+   K+P P +I+
Sbjct  328   YEGGIKHPDAHVISKIRDLLPWEMFRELVRNDGDQFLKYPMPSIIK  373



>gb|KFK39531.1| hypothetical protein AALP_AA3G256400 [Arabis alpina]
Length=882

 Score =   409 bits (1051),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 258/342 (75%), Gaps = 5/342 (1%)
 Frame = +2

Query  128   KIKGKVVLMRKNVLDFNDFNASIVDNLSDFLGQKVSLELVSSVQADLGNGLKGKRSKAAY  307
             KI+G+VV+M+KNVLDF D  AS++D + + LG++VSL+L+SS+Q D  N  +G+  KAA+
Sbjct  32    KIEGEVVVMKKNVLDFKDAMASLLDRVHELLGRRVSLQLISSLQPDPANEKRGRLGKAAH  91

Query  308   LDHWVLK-NTVLASGESAFKIEFEWSEDFGVPAAFIIKNNHPNEFYLKTLTLEDVP--NH  478
             L+ WV K  T + + E+AF + F+W E  G PAAF+IKN H ++FYLK+LTL D P    
Sbjct  92    LEKWVTKIKTSVTAEETAFAVTFDWDESMGPPAAFVIKNYHHSQFYLKSLTLRDFPGAQG  151

Query  479   GEVHFACFSWVYPASKYNYERIFFSNQAYLPSQTPAPLKKYRDEELVHLRGTGTG-ELKE  655
             G +HF C SW+YP  +Y  +R+FFSN+AYLPS+TP  +K+ R+EEL +LRG   G E KE
Sbjct  152   GPIHFVCNSWIYPNHRYRSDRVFFSNKAYLPSETPELVKELREEELKNLRGNEKGGEFKE  211

Query  656   WDRVYDYAYYNDLGDPDKGAEYARPILGGNSEYPYPRRGRTGRAPTKTDPNSESRIPLLT  835
             WDRVYDYAYYNDLG PDKG + ARP++GG+ E+PYPRRG+TGR PTK+DP SESR+ L+ 
Sbjct  212   WDRVYDYAYYNDLGAPDKGPDSARPVIGGSHEFPYPRRGKTGRKPTKSDPKSESRLALI-  270

Query  836   SLDIYVPRDEKFGHLKLADFLTYALKSVAQFLLPEFESLFDSTPTEFDSFQDILNLYEGG  1015
             +L+IYVPRDE+F H+K +DFL YALK+V Q L+PE  S+ D T  EFDSF+D+ +LY+G 
Sbjct  271   NLNIYVPRDERFSHVKFSDFLAYALKAVTQVLVPELASVCDKTINEFDSFEDVFHLYDGS  330

Query  1016  IKLPQGPLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQ  1141
             IKLP G  ++ + D +P EM +ELIR+DGE   KFP P V++
Sbjct  331   IKLPNGHTISKLRDVVPWEMFRELIRNDGEQFLKFPLPDVLK  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3246351156509