BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6052

Length=1229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           674   0.0      Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       623   0.0      Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   615   0.0      Ipomoea nil [qian niu]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             610   0.0      Nicotiana sylvestris
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       609   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             607   0.0      Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       607   0.0      Nicotiana tabacum [American tobacco]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           606   0.0      Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            604   0.0      Catharanthus roseus [chatas]
gb|AIY26016.1|  PAL                                                     595   0.0      Jasminum sambac [Arabian jasmine]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            591   0.0      Melissa officinalis [sweet balm]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             591   0.0      Sesamum indicum [beniseed]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             591   0.0      Solanum lycopersicum
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           590   0.0      Nicotiana attenuata
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             590   0.0      Nicotiana tomentosiformis
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             590   0.0      Plectranthus scutellarioides
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             587   0.0      Nicotiana sylvestris
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             587   0.0      Sesamum indicum [beniseed]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             586   0.0      Nelumbo nucifera [Indian lotus]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             585   0.0      Scutellaria viscidula [zhan mao huang qin]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    585   0.0      Lithospermum erythrorhizon
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             584   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        585   0.0      
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    585   0.0      Solanum lycopersicum
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              584   0.0      Ricinus communis
gb|AGY49231.1|  phenylalanine ammonia lyase                             584   0.0      Ricinus communis
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           583   0.0      Scutellaria baicalensis [Baikal skullcap]
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             583   0.0      Perilla frutescens [beefsteak-mint]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             583   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AIA66448.1|  PAL1                                                    583   0.0      Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    583   0.0      Capsicum annuum
gb|KJB16792.1|  hypothetical protein B456_002G248000                    582   0.0      Gossypium raimondii
gb|ABR14606.1|  phenylalanine ammonia-lyase                             582   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AER12109.1|  PAL                                                     582   0.0      Gossypium hirsutum [American cotton]
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    582   0.0      Solanum lycopersicum
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           581   0.0      Platycodon grandiflorus [balloon-flower]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           581   0.0      Coffea canephora [robusta coffee]
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                583   0.0      Erythranthe guttata [common monkey flower]
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     580   0.0      Petroselinum crispum
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            569   0.0      Phaseolus vulgaris [French bean]
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             580   0.0      
gb|AJO53274.1|  phenylalanine ammonia-lyase                             580   0.0      Pogostemon cablin
gb|AFK43896.1|  unknown                                                 567   0.0      Medicago truncatula
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             580   0.0      Gossypium arboreum [tree cotton]
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     580   0.0      Petroselinum crispum
gb|AEH02821.1|  phenylalanine ammonia lyase                             580   0.0      Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           579   0.0      Platycodon grandiflorus [balloon-flower]
gb|AJW77399.1|  phenylalanine ammonia-lyase                             580   0.0      Angelica sinensis [Chinese angelica]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             579   0.0      Solanum tuberosum [potatoes]
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            579   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        579   0.0      Solanum tuberosum [potatoes]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             579   0.0      Gossypium arboreum [tree cotton]
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            578   0.0      Daucus carota [carrots]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             578   0.0      Olea europaea
gb|ACF94716.1|  phenylalanine ammonia lyase                             579   0.0      Robinia pseudoacacia [black locust]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        579   0.0      Solanum tuberosum [potatoes]
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           580   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AIA24411.1|  phenylalanine ammonia-lyase                             578   0.0      Sinopodophyllum hexandrum [Himalayan mayapple]
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    577   0.0      Lithospermum erythrorhizon
gb|KJB36583.1|  hypothetical protein B456_006G166000                    578   0.0      Gossypium raimondii
ref|XP_012082374.1|  PREDICTED: phenylalanine ammonia-lyase             577   0.0      Jatropha curcas
gb|AFF60415.1|  phenylalanine ammonia lyase                             574   0.0      Pyrus pyrifolia [sha li]
gb|AGL81344.1|  phenylalanine ammonia lyase                             577   0.0      Pyrus communis
gb|AGL50914.1|  phenylalanine ammonia lyase                             576   0.0      Pyrus communis
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    576   0.0      
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           576   0.0      
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            576   0.0      Daucus carota [carrots]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     576   0.0      Petroselinum crispum
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       576   0.0      Digitalis lanata [Grecian foxglove]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           575   0.0      Scutellaria baicalensis [Baikal skullcap]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          575   0.0      Cynara cardunculus var. scolymus [artichoke]
gb|ABB70117.2|  phenylalanine ammonia lyase                             576   0.0      Pyrus communis
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           575   0.0      Coffea arabica [arabica coffee]
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   575   0.0      Rehmannia glutinosa [Chinese foxglove]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      575   0.0      
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 575   0.0      Pyrus x bretschneideri [bai li]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         575   0.0      Jatropha curcas
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    575   0.0      Solanum tuberosum [potatoes]
ref|XP_012082376.1|  PREDICTED: phenylalanine ammonia-lyase-like        575   0.0      Jatropha curcas
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    575   0.0      
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    575   0.0      
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        575   0.0      Solanum tuberosum [potatoes]
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       572   0.0      Helianthus annuus
gb|AGU91428.1|  phenylalanine ammonia-lyase                             573   0.0      Chrysanthemum boreale
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             573   0.0      Populus tomentosa [Chinese white poplar]
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    573   0.0      
gb|ABD42947.1|  phenylalanine ammonia lyase                             573   0.0      Acacia auriculiformis x Acacia mangium
ref|XP_007027354.1|  PHE ammonia lyase 1                                573   0.0      Theobroma cacao [chocolate]
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      573   0.0      
gb|AEA72280.1|  phenylalanine ammonia-lyase                             572   0.0      Angelica gigas
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        572   0.0      Cucumis melo [Oriental melon]
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      572   0.0      
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        572   0.0      Cucumis sativus [cucumbers]
ref|XP_004143356.2|  PREDICTED: phenylalanine ammonia-lyase-like        572   0.0      Cucumis sativus [cucumbers]
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   572   0.0      Populus tremuloides
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        572   0.0      Cucumis melo [Oriental melon]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     572   0.0      Glycine max [soybeans]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           571   0.0      Astragalus membranaceus
gb|AFP24940.1|  phenylalanine ammonia lyase                             571   0.0      Prunus salicina [Japanese plum]
gb|AFG30054.1|  phenylalanine ammonialyase                              571   0.0      Malus hybrid cultivar
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        571   0.0      Cicer arietinum [garbanzo]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         571   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             571   0.0      Prunus persica
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             570   0.0      Vitis vinifera
gb|AHA42445.1|  phenylalanine ammonia lyase                             564   0.0      Cannabis sativa
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     570   0.0      Prunus avium [gean]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            570   0.0      Lotus japonicus
gb|ACT32033.1|  phenylalanine ammonia-lyase                             570   0.0      Glycine soja [wild soybean]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             570   0.0      Citrus clementina [clementine]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             570   0.0      Arnebia euchroma
gb|AAZ29733.1|  phenylalanine ammonia lyase                             570   0.0      Trifolium pratense [peavine clover]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             570   0.0      Hibiscus cannabinus [bimli-jute]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              570   0.0      Vitis vinifera
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   570   0.0      Trifolium pratense [peavine clover]
ref|XP_011653013.1|  PREDICTED: phenylalanine ammonia-lyase-like        567   0.0      Cucumis sativus [cucumbers]
gb|ADO64252.1|  PAL                                                     569   0.0      Epimedium sagittatum
ref|XP_004152155.2|  PREDICTED: phenylalanine ammonia-lyase-like        565   0.0      Cucumis sativus [cucumbers]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   570   0.0      Citrus sinensis [apfelsine]
ref|XP_011657651.1|  PREDICTED: phenylalanine ammonia-lyase             569   0.0      Cucumis sativus [cucumbers]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             569   0.0      Vitis vinifera
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    569   0.0      
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           568   0.0      Prunus domestica
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             569   0.0      Phaseolus vulgaris [French bean]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           569   0.0      
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    569   0.0      Petroselinum crispum
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 568   0.0      Manihot esculenta [manioc]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             569   0.0      Gossypium arboreum [tree cotton]
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           569   0.0      Prunus mume [ume]
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             569   0.0      
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          568   0.0      Populus euphratica
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          569   0.0      Vitis vinifera
gb|AEX32784.1|  phenylalanine ammonia-lyase                             568   0.0      Vitis vinifera
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             568   0.0      Vitis vinifera
gb|AAR31107.1|  phenylalanine ammonia-lyase                             568   0.0      Quercus suber [cork oak]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        568   0.0      Medicago truncatula
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             568   0.0      Pyrus x bretschneideri [bai li]
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   568   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         568   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        567   0.0      Vitis vinifera
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     567   0.0      Daucus carota [carrots]
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             567   0.0      Cucumis melo [Oriental melon]
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             567   0.0      Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        567   0.0      Vitis vinifera
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             567   0.0      Gossypium arboreum [tree cotton]
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   567   0.0      Agastache rugosa
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        567   0.0      Vitis vinifera
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      567   0.0      Cucumis melo [Oriental melon]
gb|AJO53273.1|  phenylalanine ammonia-lyase                             566   0.0      Pogostemon cablin
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             566   0.0      Populus tomentosa [Chinese white poplar]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    566   0.0      Solanum lycopersicum
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    566   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        566   0.0      Nicotiana sylvestris
gb|KJB62426.1|  hypothetical protein B456_009G416300                    566   0.0      Gossypium raimondii
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           566   0.0      Populus tomentosa [Chinese white poplar]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        565   0.0      Cucumis melo [Oriental melon]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        565   0.0      Populus euphratica
gb|KJB46525.1|  hypothetical protein B456_007G373600                    565   0.0      Gossypium raimondii
gb|AEE81750.1|  phenylalanine ammonia lyase                             566   0.0      Morus alba var. multicaulis
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      565   0.0      
gb|AIB06732.1|  phenylalanine ammonia lyase                             565   0.0      Mangifera indica
gb|AGH13333.1|  phenylalanine ammonia-lyase                             565   0.0      Rhus chinensis
gb|AER58180.1|  phenylalanine ammonia lyase                             565   0.0      Cucumis sativus [cucumbers]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       565   0.0      Citrus limon [lemon]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            565   0.0      Lotus japonicus
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     565   0.0      Nicotiana sylvestris
gb|AGE10589.1|  phenylalanine amononia-lyase                            565   0.0      Lonicera japonica [Japanese honeysuckle]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             565   0.0      Epimedium sagittatum
gb|AHA42443.1|  phenylalanine ammonia lyase                             564   0.0      Cannabis sativa
gb|AIL23235.1|  phenylalanine ammonia-lyase                             565   0.0      Astragalus chrysochlorus
gb|AID16077.1|  phenylalanine ammonium lyase                            565   0.0      Morus alba
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             564   0.0      Vitis vinifera
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            564   0.0      Vigna radiata [mung bean]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     564   0.0      Vitis vinifera
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        563   0.0      Cucumis melo [Oriental melon]
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    559   0.0      Rhizophora mangle
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              564   0.0      Ricinus communis
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             564   0.0      Astragalus membranaceus
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    564   0.0      Solanum tuberosum [potatoes]
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         563   0.0      Populus trichocarpa [western balsam poplar]
gb|AAA34179.2|  phenylalanine ammonia lyase                             563   0.0      Solanum lycopersicum
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1           563   0.0      Cucumis sativus [cucumbers]
ref|XP_012093279.1|  PREDICTED: phenylalanine ammonia-lyase G2B         563   0.0      Jatropha curcas
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     563   0.0      Nicotiana tomentosiformis
gb|ACE95170.1|  phenylalanine ammonia-lyase                             563   0.0      Populus tomentosa [Chinese white poplar]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             563   0.0      Astragalus mongholicus
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     563   0.0      Nicotiana tomentosiformis
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            563   0.0      Gynura bicolor
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             563   0.0      Citrus clementina [clementine]
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       563   0.0      Stylosanthes humilis [alfafinha do nordeste]
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           563   0.0      Tarenaya hassleriana [spider flower]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   562   0.0      Populus tremuloides
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       562   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             562   0.0      Vitis vinifera
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        561   0.0      Cucumis melo [Oriental melon]
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        561   0.0      Cucumis melo [Oriental melon]
gb|AEX32790.1|  phenylalanine ammonia-lyase                             561   0.0      Vitis vinifera
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           561   0.0      Ageratina adenophora
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            561   0.0      Lotus japonicus
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        561   0.0      Vitis vinifera
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            560   0.0      Lotus japonicus
gb|AEC11891.1|  PAL1                                                    561   0.0      Petunia exserta
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 560   0.0      Manihot esculenta [manioc]
gb|AAV98199.1|  phenylalanine ammonialyase 1                            561   0.0      Petunia x hybrida [garden petunia]
gb|AHY94892.1|  phenylalanine ammonia lyase                             560   0.0      Prunella vulgaris
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            560   0.0      Populus sieboldii x Populus grandidentata
gb|ACC63889.1|  phenylalanine ammonia-lyase                             560   0.0      Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             560   0.0      Populus szechuanica
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         560   0.0      Populus trichocarpa [western balsam poplar]
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     555   0.0      Solanum tuberosum [potatoes]
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           560   0.0      Ageratina adenophora
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      560   0.0      Tarenaya hassleriana [spider flower]
gb|AAC18870.1|  phenylalanine ammonia lyase                             560   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    560   0.0      Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           559   0.0      Brassica rapa
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       559   0.0      Camellia sinensis [black tea]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                559   0.0      Medicago truncatula
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                559   0.0      Erythranthe guttata [common monkey flower]
gb|AJT59582.1|  phenylalanine ammonia lyase                             559   0.0      Boehmeria nivea [Chinese silk-plant]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           558   0.0      Manihot esculenta [manioc]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             559   0.0      Euphorbia pulcherrima
gb|ACT21093.1|  phenylalanine ammonia-lyase                             558   0.0      Camellia oleifera [abura-tsubaki]
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                559   0.0      Medicago truncatula
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    558   0.0      Populus sieboldii x Populus grandidentata
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        558   0.0      Morus notabilis
gb|AAZ29732.1|  phenylalanine ammonia lyase                             558   0.0      Trifolium pratense [peavine clover]
gb|AAZ29734.1|  phenylalanine ammonia lyase                             558   0.0      Trifolium pratense [peavine clover]
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    558   0.0      Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ACM44926.1|  phenylalanine ammonia-lyase                             558   0.0      Euphorbia pulcherrima
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             558   0.0      Populus euphratica
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             557   0.0      Phaseolus vulgaris [French bean]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             558   0.0      Trifolium pratense [peavine clover]
gb|ABC69916.1|  phenylalanine ammonia-lyase                             558   0.0      Brassica napus [oilseed rape]
gb|ADY02660.1|  phenylalanine ammonia lyase                             556   0.0      Parrya nudicaulis
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 558   0.0      Rubus idaeus [European raspberry]
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        557   0.0      Cicer arietinum [garbanzo]
gb|ADY02662.1|  phenylalanine ammonia lyase                             556   0.0      Parrya nudicaulis
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             557   0.0      
gb|ABN79671.2|  phenylalanine ammonia-lyase                             557   0.0      Rudbeckia hirta
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           557   0.0      Rhizophora mangle
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      557   0.0      Camelina sativa [gold-of-pleasure]
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       556   0.0      Pisum sativum [garden pea]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         556   0.0      Populus euphratica
gb|AAQ74878.1|  phenylalanine ammonia lyase                             556   0.0      Populus trichocarpa x Populus deltoides
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           556   0.0      Fragaria vesca subsp. vesca
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    555   0.0      
gb|ADI40166.1|  phenylalanine ammonia-lyase                             556   0.0      Morus alba
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      556   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             556   0.0      Capsella rubella
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     555   0.0      Solanum tuberosum [potatoes]
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            554   0.0      Lotus japonicus
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      555   0.0      
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           555   0.0      Camelina sativa [gold-of-pleasure]
gb|AEJ88223.1|  phenylalanine ammonia lyase                             555   0.0      Prunus persica
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             554   0.0      Citrus clementina [clementine]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       554   0.0      Ipomoea batatas [batate]
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             554   0.0      Camellia japonica [common camellia]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             554   0.0      Garcinia mangostana [mangosteen]
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      555   0.0      Tarenaya hassleriana [spider flower]
gb|ADA81868.1|  phenylalanine ammonia-lyase                             554   0.0      Brassica rapa subsp. chinensis [bok-choy]
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     553   0.0      Eucalyptus grandis [rose gum]
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    553   0.0      Phaseolus vulgaris [French bean]
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           553   0.0      Brassica rapa
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             553   0.0      Vitis vinifera
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    553   0.0      Rubus idaeus [European raspberry]
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             553   0.0      Eucalyptus grandis [rose gum]
prf||2001451A  Phe ammonia lyase                                        553   0.0   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       553   0.0      Pisum sativum [garden pea]
gb|ABC69917.1|  phenylalanine ammonia-lyase                             553   0.0      Brassica napus [oilseed rape]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       553   0.0      Trifolium subterraneum
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           552   0.0      Coffea canephora [robusta coffee]
gb|ACA30407.1|  phenylalanine ammonia-lyase                             552   0.0      Stylosanthes guianensis [stylo]
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             551   0.0      Gossypium arboreum [tree cotton]
emb|CDY66761.1|  BnaCnng52250D                                          545   0.0      Brassica napus [oilseed rape]
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          551   0.0      Cynara cardunculus var. scolymus [artichoke]
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             551   0.0      Populus tomentosa [Chinese white poplar]
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            551   0.0      Eucalyptus robusta [swamp messmate]
gb|AFP49807.1|  phenylalanine ammonialyase 4                            551   0.0      Coffea arabica [arabica coffee]
gb|AJO53272.1|  phenylalanine ammonia-lyase                             551   0.0      Pogostemon cablin
gb|AAM12956.1|  phenylalanine ammonia-lyase                             550   0.0      
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        550   0.0      
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            549   0.0      
gb|ABF50788.1|  phenylalanine ammonia-lyase                             550   0.0      
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        550   0.0      
gb|KJB73539.1|  hypothetical protein B456_011G238400                    549   0.0      
gb|AGE10591.1|  phenylalanine amononia-lyase                            548   0.0      
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             549   0.0      
gb|ACR15762.1|  phenylalanine ammonia-lyase                             549   0.0      
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           549   0.0      
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      549   0.0      
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      549   0.0      
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         548   0.0      
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      548   0.0      
gb|ADD12041.1|  phenylalanine ammonia lyase                             548   0.0      
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           548   0.0      
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             548   0.0      
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      548   0.0      
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       548   0.0      
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           545   0.0      
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           547   0.0      
gb|AIZ76766.1|  PAL2                                                    536   0.0      
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             546   0.0      
gb|AFG26322.1|  phenylalanine ammonia-lyase                             546   0.0      
emb|CAN61378.1|  hypothetical protein VITISV_032212                     545   0.0      
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            546   0.0      
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             546   0.0      
gb|AFI71896.1|  phenylalanine ammonia-lyase                             545   0.0      
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      545   0.0      
gb|AAX22055.1|  phenylalanine ammonia-lyase                             545   0.0      
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           545   0.0      
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      545   0.0      
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            545   0.0      
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    545   0.0      
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    544   0.0      
prf||2006271A  Phe ammonia lyase                                        545   0.0   
emb|CDX76219.1|  BnaA04g04830D                                          537   0.0      
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        546   0.0      
gb|AFP49806.1|  phenylalanine ammonialyase 1                            544   0.0      
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             544   0.0      
gb|AAX22053.1|  phenylalanine ammonia-lyase                             544   0.0      
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             543   0.0      
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             542   0.0      
gb|AAW78932.1|  phenylalanine-ammonia lyase                             543   0.0      
gb|ADN32766.1|  phenylalanine ammonia-lyase                             543   0.0      
gb|AAC18871.1|  phenylalanine ammonia lyase                             543   0.0      
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        543   0.0      
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           543   0.0      
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        542   0.0      
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        542   0.0      
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   541   0.0      
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        541   0.0      
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    541   0.0      
emb|CAB42793.1|  phenylalanine-ammonia lyase                            541   0.0      
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           541   0.0      
dbj|BAF96940.1|  phenylalanine ammonia lyase                            530   0.0      
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             542   0.0      
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        540   0.0      
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        540   0.0      
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            525   0.0      
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 540   0.0      
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        539   0.0      
gb|AAU08174.1|  phenylalanine ammonia-lyase                             539   0.0      
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             539   0.0      
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           539   0.0      
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             539   0.0      
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           539   0.0      
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    538   0.0      
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 539   0.0      
ref|XP_004143260.2|  PREDICTED: phenylalanine ammonia-lyase-like        538   0.0      
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    538   0.0      
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             538   0.0      
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        538   0.0      
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    538   0.0      
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             537   0.0      
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    537   0.0      
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         537   0.0      
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    537   0.0      
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        537   0.0      
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        536   0.0      
gb|ACZ36441.1|  phenylalanine ammonialyase                              536   0.0      
gb|AFP86474.1|  phenylalanine ammonia-lyase                             536   0.0      
gb|ADT63058.1|  phenylalanine ammonia-lyase                             535   0.0      
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            535   0.0      
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             535   0.0      
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      535   0.0      
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             534   0.0      
gb|ACM61988.1|  phenylalanine ammonia-lyase                             533   0.0      
gb|AGE10590.1|  phenylalanine amononia-lyase                            533   0.0      
emb|CAB42794.1|  phenylalanine-ammonia lyase                            532   2e-180   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             531   3e-180   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             531   3e-180   
gb|AKA60049.1|  phenylalanine ammonia-lyase                             532   3e-180   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           531   4e-180   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        532   4e-180   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           531   6e-180   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      531   6e-180   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             530   7e-180   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             530   8e-180   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             530   9e-180   
gb|ACG56647.1|  phenylalanine ammonia lyase                             529   3e-179   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             529   3e-179   
gb|ACG56648.1|  phenylalanine ammonia lyase                             529   3e-179   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             529   3e-179   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             529   4e-179   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             527   5e-179   
emb|CDY00922.1|  BnaC05g42780D                                          528   5e-179   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             528   7e-179   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             528   7e-179   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           526   8e-179   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              528   9e-179   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           527   2e-178   
emb|CDY08611.1|  BnaA05g28470D                                          526   4e-178   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             525   8e-178   
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        525   1e-177   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        524   2e-177   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    525   5e-177   
ref|XP_007016787.1|  PHE ammonia lyase 1                                522   2e-176   
emb|CDO99754.1|  unnamed protein product                                518   9e-176   
gb|ACR10243.1|  phenylalanine ammonia-lyase                             517   1e-175   
gb|KJB46526.1|  hypothetical protein B456_007G373700                    518   2e-175   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        516   2e-174   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        516   3e-174   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          516   5e-174   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             515   6e-174   
emb|CDX78161.1|  BnaA09g33560D                                          508   7e-174   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       514   1e-173   
emb|CDX73567.1|  BnaC08g24360D                                          507   1e-173   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        514   2e-173   
emb|CDX67566.1|  BnaA07g16060D                                          506   2e-173   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        514   2e-173   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        514   3e-173   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        514   3e-173   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        514   3e-173   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                513   3e-173   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        513   4e-173   
sp|P45731.1|PAL1_POPKI  RecName: Full=Phenylalanine ammonia-lyase G1    512   5e-173   
gb|AGA84059.1|  phenylalanine ammonia lyase                             513   6e-173   
emb|CDP20698.1|  unnamed protein product                                510   2e-172   
ref|XP_004149916.1|  PREDICTED: phenylalanine ammonia-lyase G4          512   2e-172   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        511   2e-172   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            512   3e-172   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             511   3e-172   
ref|XP_010464706.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    510   5e-172   
gb|ADY02661.1|  phenylalanine ammonia lyase                             509   6e-172   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             510   6e-172   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        510   8e-172   
gb|AIC66437.1|  phenylalanine ammonia lyase                             509   2e-171   
ref|XP_008456500.1|  PREDICTED: phenylalanine ammonia-lyase G4          509   2e-171   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            508   8e-171   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            502   9e-171   
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             506   9e-171   
ref|NP_001047482.1|  Os02g0626400                                       508   9e-171   
ref|XP_006846821.1|  PREDICTED: phenylalanine ammonia-lyase             507   1e-170   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            505   8e-170   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             504   1e-169   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             504   1e-169   
dbj|BAM28967.1|  phenylalanine ammonia lyase                            504   2e-169   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          504   2e-169   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          503   7e-169   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             503   7e-169   
ref|XP_009421282.1|  PREDICTED: phenylalanine ammonia-lyase-like        502   1e-168   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        502   2e-168   
dbj|BAJ88975.1|  predicted protein                                      501   2e-168   
ref|XP_010031967.1|  PREDICTED: phenylalanine ammonia-lyase-like        500   1e-167   
gb|AAR24505.1|  phenylalanine ammonia-lyase                             498   4e-167   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          498   4e-167   
gb|ACM47229.1|  phenylalanine ammonia-lyase                             498   4e-167   
gb|ACX31148.1|  phenylalanine ammonialyase                              495   4e-167   
ref|NP_001047483.2|  Os02g0626600                                       498   6e-167   
gb|ACM45574.1|  phenylalanine ammonia-lyase                             498   7e-167   
gb|EAY86765.1|  hypothetical protein OsI_08145                          497   9e-167   
gb|ACM45590.1|  phenylalanine ammonia-lyase                             497   1e-166   
ref|NP_001055608.1|  Os05g0427400                                       496   2e-166   
gb|ACN62413.1|  phenylalanine ammonia-lyase                             496   2e-166   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             496   2e-166   
gb|ACM45573.1|  phenylalanine ammonia-lyase                             495   5e-166   
ref|XP_006647544.1|  PREDICTED: phenylalanine ammonia-lyase-like        495   8e-166   
gb|ACM45589.1|  phenylalanine ammonia-lyase                             494   1e-165   
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       494   1e-165   
ref|XP_003575365.1|  PREDICTED: phenylalanine ammonia-lyase             493   2e-165   
gb|AGC23439.1|  phenylalanine ammonia-lyase                             493   2e-165   
ref|XP_003575400.1|  PREDICTED: phenylalanine ammonia-lyase-like        493   4e-165   
ref|XP_003575404.1|  PREDICTED: phenylalanine ammonia-lyase-like        493   4e-165   
sp|A2X7F7.1|PAL2_ORYSI  RecName: Full=Phenylalanine ammonia-lyase       493   4e-165   
ref|XP_002448194.1|  hypothetical protein SORBIDRAFT_06g022750          492   5e-165   
ref|NP_001047484.1|  Os02g0627100                                       493   5e-165   
gb|ACM16588.1|  phenylalanine ammonia-lyase                             492   1e-164   
ref|NP_001147922.1|  phenylalanine ammonia-lyase                        491   2e-164   
ref|NP_001151482.1|  phenylalanine ammonia-lyase                        491   2e-164   
gb|ACN35880.1|  unknown                                                 491   3e-164   
ref|XP_002871081.1|  phenyl alanine ammonia-lyase 3                     490   4e-164   
dbj|BAJ87762.1|  predicted protein                                      490   4e-164   
gb|ACM41719.1|  phenylalanine ammonia-lyase                             490   5e-164   
ref|XP_003580144.1|  PREDICTED: phenylalanine ammonia-lyase             490   5e-164   
gb|ABP96954.2|  phenylalanine ammonia-lyase                             490   6e-164   
gb|ACF86361.1|  unknown                                                 490   6e-164   
gb|EMT28136.1|  Phenylalanine ammonia-lyase                             490   7e-164   
ref|NP_001053326.1|  Os04g0518400                                       489   1e-163   
tpg|DAA36916.1|  TPA: phenylalanine ammonia-lyase                       489   1e-163   
dbj|BAJ87394.1|  predicted protein                                      489   1e-163   
gb|EMT28135.1|  Phenylalanine ammonia-lyase                             489   1e-163   
ref|XP_003575403.1|  PREDICTED: phenylalanine ammonia-lyase-like        489   1e-163   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            488   1e-163   
gb|EMT07187.1|  Phenylalanine ammonia-lyase                             494   1e-163   
ref|NP_001147433.1|  phenylalanine ammonia-lyase                        489   2e-163   
ref|XP_006652523.1|  PREDICTED: phenylalanine ammonia-lyase-like        489   2e-163   
ref|XP_003575238.1|  PREDICTED: phenylalanine ammonia-lyase-like        487   6e-163   
ref|XP_004491627.1|  PREDICTED: phenylalanine ammonia-lyase class...    488   6e-163   
emb|CAB97358.1|  phenylalanine ammonia-lyase                            471   1e-162   
gb|AFW72411.1|  phenylalanine ammonia-lyase                             486   2e-162   
ref|XP_009140249.1|  PREDICTED: phenylalanine ammonia-lyase 3           485   3e-162   
gb|EPS66416.1|  phenylalanine ammonia-lyase                             485   4e-162   
gb|AGZ95690.1|  phenylalanine ammonia-lyase                             484   7e-162   
dbj|BAJ85603.1|  predicted protein                                      484   7e-162   
gb|AAS48415.1|  phenylalanine lyase                                     484   1e-161   
ref|XP_003618076.1|  Phenylalanine ammonia-lyase                        483   2e-161   
ref|XP_003575240.1|  PREDICTED: phenylalanine ammonia-lyase-like        483   3e-161   
gb|ADD74179.1|  phenylalanine ammonia lyase                             475   3e-161   
gb|ADB97626.1|  phenylalanine ammonia-lyase                             482   1e-160   
gb|AGZ95689.1|  phenylalanine ammonia-lyase                             481   1e-160   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/338 (96%), Positives = 333/338 (99%), Gaps = 0/338 (0%)
 Frame = +2

Query  194   MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             MEGAIENGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ
Sbjct  1     MEGAIENGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  60

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIAARDNAVKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61    VAAIAARDNAVKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  120

Query  554   LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N
Sbjct  121   LQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNN  180

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ LTAEEAFKLAGVN GFFE
Sbjct  181   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLTAEEAFKLAGVNGGFFE  240

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAE M+GKPEFTDHL HKLK
Sbjct  241   LQPKEGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEAMNGKPEFTDHLTHKLK  300

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS++MKAAQKLHEMDPLQKP+
Sbjct  301   HHPGQIEAAAIMEHILDGSYYMKAAQKLHEMDPLQKPK  338



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/340 (90%), Positives = 318/340 (94%), Gaps = 3/340 (1%)
 Frame = +2

Query  194   MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             MEGAI NGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  +
Sbjct  1     MEGAIANGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTSLR  60

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
                IAARDNA K   S    A  ++SSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61    SPPIAARDNASKWS-SPRLPARRESSSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  119

Query  554   LQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQQELIRFLNAGIFGTGTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  120   LQQELIRFLNAGIFGTGTGASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  179

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ALTAEEAFKLAGV  GF
Sbjct  180   HNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALTAEEAFKLAGVQGGF  239

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HK
Sbjct  240   FELQPKEGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHK  299

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILD S++MKAAQKLHEMDPLQKP+
Sbjct  300   LKHHPGQIEAAAIMEHILDRSYYMKAAQKLHEMDPLQKPK  339



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/334 (89%), Positives = 315/334 (94%), Gaps = 2/334 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NGH N FC+KVDPLNWE+AADSL+GSHLDEVK MVAEFR PAVK+GG+TLTVAQVAAIA+
Sbjct  9     NGHQNGFCVKVDPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLTVAQVAAIAS  68

Query  392   RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
             RDNAV VELSE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  69    RDNAVTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  128

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC
Sbjct  129   RFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  188

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGL+TGRPNSKAVGPNG+ L AEEA +LAGVN GFFELQPK
Sbjct  189   LPLRGTITASGDLVPLSYIAGLITGRPNSKAVGPNGETLNAEEALRLAGVNGGFFELQPK  248

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSGMASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HKLKHHPG
Sbjct  249   EGLALVNGTAVGSGMASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPG  308

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  309   QIEAAAIMEHILDGSSYVKAAQKMHEMDPLQKPK  342



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/343 (86%), Positives = 317/343 (92%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1     MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  371   QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61    QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+ L AEEAF +AGVN
Sbjct  181   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAFGVAGVN  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL
Sbjct  241   SGFFELQPKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/343 (86%), Positives = 317/343 (92%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1     MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  371   QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61    QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+ L AEEAF++AGVN
Sbjct  181   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLNAEEAFRVAGVN  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL
Sbjct  241   SGFFELQPKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KA QKLHE DPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAPQKLHETDPLQKPK  343



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/343 (86%), Positives = 316/343 (92%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1     MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  371   QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61    QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++AGVN
Sbjct  181   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVN  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL
Sbjct  241   GGFFELQPKEGLALVNGTAVGSGLASMVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/343 (86%), Positives = 316/343 (92%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1     MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  371   QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61    QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++AGVN
Sbjct  181   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVN  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL
Sbjct  241   GGFFELQPKEGLALVNGTAVGSGLASMVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/343 (86%), Positives = 316/343 (92%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK MVAE+R P VK+GG+TLTVA
Sbjct  1     MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGGETLTVA  60

Query  371   QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             QVAAIAA+DNA  V VELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61    QVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++AGVN
Sbjct  181   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVN  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAV SEVLSAIFAEVM+GKPEFTDHL
Sbjct  241   GGFFELQPKEGLALVNGTAVGSGLASMVLFDANILAVFSEVLSAIFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  343



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/344 (87%), Positives = 315/344 (92%), Gaps = 9/344 (3%)
 Frame = +2

Query  200   GAIENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             G+ ENGH N     DFC+K DPLNW MAADSLKGSHLDEVKRMVAEFR P VK+GG+TLT
Sbjct  5     GSTENGHINNGEVLDFCLK-DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGGETLT  63

Query  365   VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             ++QVAAIAARD NAVKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  64    ISQVAAIAARDYNAVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  124   QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  183

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             K LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ +  E+AFK+AGV
Sbjct  184   KFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEIVNPEQAFKMAGV  243

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             NDG FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+GKPEFTDH
Sbjct  244   NDGLFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNGKPEFTDH  303

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA KLHEMDPLQKP+
Sbjct  304   LTHKLKHHPGQIEAAAIMEHILDGSGYVKAAHKLHEMDPLQKPK  347



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/344 (85%), Positives = 313/344 (91%), Gaps = 7/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ME A++N  SN    DFC+K DPLNW MAA++LKGSHLDEVKRMV EFR P VK+GG+TL
Sbjct  1     MEIALQNSDSNGKSMDFCVK-DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETL  59

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             TV+QVAAIAARDNAV VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60    TVSQVAAIAARDNAVTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  119

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120   QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             K LNHNITPCLP RGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ LT ++AFKLAGV
Sbjct  180   KFLNHNITPCLPPRGTITASGDLVPLSYIAGMLTGRPNSKAVGPSGQTLTPKDAFKLAGV  239

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             N GFFELQPKEGLALVNGTAVGSG+AS+VLFE N+LAVLSEVLSAIFAEVM+GKPEFTDH
Sbjct  240   NGGFFELQPKEGLALVNGTAVGSGLASIVLFETNVLAVLSEVLSAIFAEVMNGKPEFTDH  299

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  300   LTHKLKHHPGQIEAAAIMEHILDGSFYVKAAQKLHEMDPLQKPK  343



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/338 (86%), Positives = 311/338 (92%), Gaps = 5/338 (1%)
 Frame = +2

Query  209   ENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             ENGH  SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++QVA
Sbjct  3     ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTISQVA  62

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIAA+DNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  63    AIAAKDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  122

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  123   KELIRFLNAGIFGNGTETNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  182

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ LTAE+AFKLAGVN GFFE
Sbjct  183   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLTAEQAFKLAGVNGGFFE  242

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+ LFEANILAVLSEV+SAIFAEVM+GKPEFTDHL HKLK
Sbjct  243   LQPKEGLALVNGTAVGSGLASIALFEANILAVLSEVMSAIFAEVMNGKPEFTDHLTHKLK  302

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAAQKLH+MDPLQKP+
Sbjct  303   HHPGQIEAAAIMEHILDGSGYVKAAQKLHDMDPLQKPK  340



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/343 (84%), Positives = 313/343 (91%), Gaps = 5/343 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             M  A ENGH SN FC++   DPLNW  AA++LKGSHLDEVKRMV EFR P VK+GG+TLT
Sbjct  1     MAAATENGHHSNGFCVQKQKDPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             ++QVAAIA+RDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61    ISQVAAIASRDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  121   GGALQKELIRFLNAGIFGQGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
              LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+AL AEEAFKLAGV 
Sbjct  181   FLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNAEEAFKLAGVV  240

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+AS+ L+EANILAVLSEV+SA+FAEVM+GKPEFTDHL
Sbjct  241   GGFFELQPKEGLALVNGTAVGSGLASIALYEANILAVLSEVMSAVFAEVMNGKPEFTDHL  300

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAA+K+HEMDPLQKP+
Sbjct  301   THKLKHHPGQIEAAAIMEHILDGSSYVKAAEKMHEMDPLQKPK  343



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/342 (84%), Positives = 311/342 (91%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             M G I      DFCIKVDPLNWEMAA+SL+GSHLDEVK+MVAEFR P VK+GG+TLTVAQ
Sbjct  1     MAGVINGQQDLDFCIKVDPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGETLTVAQ  60

Query  374   VAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             VA++AA+ N   VKVEL E ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTKNG
Sbjct  61    VASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKNG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAG+FG GT   HTLP S+TRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  121   GALQKELIRFLNAGVFGNGTESCHTLPQSSTRAAMLVRINTLLQGYSGIRFEILEAITKL  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             +NHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF +AGVN 
Sbjct  181   INHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFHVAGVNG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+VLF+AN+LAV SEVLSAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIVLFDANVLAVFSEVLSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  342



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/345 (85%), Positives = 314/345 (91%), Gaps = 13/345 (4%)
 Frame = +2

Query  212   NGHSN---DF--CIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             NGH N   DF  C K    DPLNWEMA++SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4     NGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  368   AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64    AQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             KNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  124   KNGGALQKELIRFLNAGVFGNGTETNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  183

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++AG
Sbjct  184   TKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAG  243

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             VN GFFELQPKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTD
Sbjct  244   VNGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTD  303

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  304   HLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/343 (85%), Positives = 313/343 (91%), Gaps = 11/343 (3%)
 Frame = +2

Query  212   NGHSN-----DFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             NGH N     + C K  DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG++LTVAQ
Sbjct  4     NGHVNGGENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQ  63

Query  374   VAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             VAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTKN
Sbjct  64    VAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKN  123

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  124   GGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  183

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             L+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++AGVN
Sbjct  184   LINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGETLNAEEAFRVAGVN  243

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTDHL
Sbjct  244   GGFFELQPKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTDHL  303

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  304   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  346



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/342 (85%), Positives = 310/342 (91%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             M  A ENGH SN FC+K  DPLNW  AA++L+GSHLDEVK+MV EFR PAVK+GG+TLT+
Sbjct  1     MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLTI  60

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAAIAARDNAV VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61    AQVAAIAARDNAVAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121   GALQTELIRFLNAGIFGKGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L AEEAFKLAGV+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGSELNAEEAFKLAGVSG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+ L+EANIL+VLS V+SAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANILSVLSVVISAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  342



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/345 (84%), Positives = 311/345 (90%), Gaps = 13/345 (4%)
 Frame = +2

Query  212   NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             NGH N     + C K    DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4     NGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  368   AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64    AQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             KNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  124   KNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  183

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
              KL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAV PNG+ L AEEAF++AG
Sbjct  184   AKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVSPNGETLNAEEAFRVAG  243

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             VN GFFELQPKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM+GKPEFTD
Sbjct  244   VNGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVMNGKPEFTD  303

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  304   HLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/342 (83%), Positives = 313/342 (92%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             M  ++EN H SN FC++  DPLNW +AA++LKGSHLDEVK+MVAEFR P VK+GG+TLT+
Sbjct  1     MAPSLENDHHSNGFCVQQKDPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTI  60

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             +QVAAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61    SQVAAIAARDNGVAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG  T   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121   GALQKELIRFLNAGIFGNATESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+AL A+EAFKLAGV+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNADEAFKLAGVHG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+ L+EAN+LAVLSEV+SA+FAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANVLAVLSEVMSAVFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  342



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/334 (85%), Positives = 303/334 (91%), Gaps = 2/334 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG    FC++ DPLNW+MAA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA 
Sbjct  13    NGSIKSFCVQQDPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKLGGETLTISQVAAIAT  72

Query  392   RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
              D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  73    HDAGVKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  132

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+NITPC
Sbjct  133   RFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPC  192

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G  L A EAF LAGVNDGFFELQPK
Sbjct  193   LPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGHILNASEAFNLAGVNDGFFELQPK  252

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSG+ASMVLFE NILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPG
Sbjct  253   EGLALVNGTAVGSGLASMVLFETNILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPG  312

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQK+HE+DPLQKP+
Sbjct  313   QIEAAAIMEHILDGSSYVKAAQKIHEIDPLQKPK  346



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/342 (83%), Positives = 313/342 (92%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1     MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61    AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK 
Sbjct  121   GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AEEAFKLAGV+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+ L+EAN+LA+L+EV+SAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANVLALLAEVMSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKMHEMDPLQKPK  342



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/342 (83%), Positives = 311/342 (91%), Gaps = 5/342 (1%)
 Frame = +2

Query  194   MEGAIENGHSN--DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             ME  +ENG+    +FC+K DPLNWEMA++S+KGSHLDEVK MVAEFR P V++ G+TLT+
Sbjct  1     METIVENGNGKTMEFCMK-DPLNWEMASESMKGSHLDEVKNMVAEFRKPVVQLAGKTLTI  59

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
              QVAAIAARD+ V VEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60    GQVAAIAARDDGVTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  120   GALQKELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  179

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ + AEEAF+LAG++ 
Sbjct  180   LNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKINAEEAFRLAGIST  239

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSGMASMVL+EANILAVLSEV+SAIFAEVM+GKPEFTDHL 
Sbjct  240   GFFELQPKEGLALVNGTAVGSGMASMVLYEANILAVLSEVISAIFAEVMNGKPEFTDHLT  299

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  300   HKLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEMDPLQKPK  341



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/344 (83%), Positives = 306/344 (89%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ME A EN + N     FCI+ DPLNWE AA+SLKGSHLDEVKRMV EFR P V++GGQTL
Sbjct  1     MEFAQENCNGNGSLKSFCIQQDPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVRLGGQTL  60

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T++QVAAIA  D  VKV LSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61    TISQVAAIATHDAGVKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  542   NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGGALQKELIRFLNAGIFGNGVESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNS AVGP+GQ L A EAF LAG+
Sbjct  181   KLLNSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSVAVGPDGQNLNAAEAFSLAGI  240

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             N GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN+L VLSEVLSAIFAEVM GKPEFTDH
Sbjct  241   NGGFFELQPKEGLALVNGTAVGSGLASMVLFEANVLGVLSEVLSAIFAEVMQGKPEFTDH  300

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS+++KAAQKLHE+DPLQKP+
Sbjct  301   LTHKLKHHPGQIEAAAIMEHILDGSYYIKAAQKLHEIDPLQKPK  344



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/347 (83%), Positives = 311/347 (90%), Gaps = 13/347 (4%)
 Frame = +2

Query  206   IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6     VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  362   TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66    TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126   RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++
Sbjct  186   AITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRV  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEF
Sbjct  246   AGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   TDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/347 (83%), Positives = 311/347 (90%), Gaps = 13/347 (4%)
 Frame = +2

Query  206   IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6     VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  362   TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66    TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126   RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++
Sbjct  186   AITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRV  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEF
Sbjct  246   AGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   TDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/345 (83%), Positives = 312/345 (90%), Gaps = 7/345 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             M    ENG  ND    FC +  DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1     MAAMAENGSKNDSLESFCNMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  359   LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61    LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121   KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TKLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+++ A EAF+LAG
Sbjct  181   TKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAG  240

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             +  GFFELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTD
Sbjct  241   IESGFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTD  300

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  301   HLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  345



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/345 (83%), Positives = 311/345 (90%), Gaps = 7/345 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             M    ENG  ND    FC    DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1     MAAMAENGSKNDSLESFCNTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  359   LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61    LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121   KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TKLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+++ A EAF+LAG
Sbjct  181   TKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGESMDALEAFRLAG  240

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             +  GFFELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTD
Sbjct  241   IESGFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTD  300

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  301   HLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  345



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 313/342 (92%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1     MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61    AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA+TK 
Sbjct  121   GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEALTKF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AEEAFKLAGV+ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEELNAEEAFKLAGVSG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+ L+EAN+LA+L+EV+SAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANVLALLAEVMSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             H+LKHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  301   HELKHHPGQIEAAAIMEHILDGSAYVKAAQKMHEMDPLQKPK  342



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/323 (87%), Positives = 302/323 (93%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKG HLDEVKRMV EFR P VK+GG+TLT++QVAAIAARDNAV VEL+E
Sbjct  20    DPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNAVAVELAE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  80    SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSATRAAMLVRINTLLQGYSGIRFEI+EAITK LNHNITPCLPLRGTITASG
Sbjct  140   TESNHTLPHSATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG++L+AEEAFKLAGV+ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGESLSAEEAFKLAGVSGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+ L+EANIL VLSEV+SAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASIALYEANILGVLSEVMSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQKLHEMDPLQKP+
Sbjct  320   LDGSAYVKAAQKLHEMDPLQKPK  342



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/341 (84%), Positives = 309/341 (91%), Gaps = 6/341 (2%)
 Frame = +2

Query  203   AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2     AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIAA+DNAV VEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62    QVAAIAAKDNAVAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  122   ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFL  181

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAFKLAGV  G
Sbjct  182   NENITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGG  241

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS+ LF+ANILAVLSEV+SA+FAEVM+GKPEFTDHL H
Sbjct  242   FFELQPKEGLALVNGTAVGSGLASIALFDANILAVLSEVMSAVFAEVMNGKPEFTDHLTH  301

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  302   KLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEQDPLQKPK  342



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/334 (86%), Positives = 307/334 (92%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  400
             D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15    DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  401   ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
                 VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75    KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  572   RFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG GTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NITPC
Sbjct  135   RFLNAGVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPC  194

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGRPN+KAVGPNG+ L AEEAF++AGV+ GFFELQPK
Sbjct  195   LPLRGTITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPK  254

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHHPG
Sbjct  255   EGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPG  314

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  315   QIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/334 (86%), Positives = 307/334 (92%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  400
             D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15    DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  401   ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
                 VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75    KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  572   RFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG GTG  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NITPC
Sbjct  135   RFLNAGVFGNGTGSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPC  194

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGRPN+KAVGPNG+ L AEEAF++AGV+ GFFELQPK
Sbjct  195   LPLRGTITASGDLVPLSYIAGLLTGRPNAKAVGPNGEKLNAEEAFRVAGVSGGFFELQPK  254

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEFTDHL HKLKHHPG
Sbjct  255   EGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPG  314

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  315   QIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  348



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/342 (83%), Positives = 310/342 (91%), Gaps = 10/342 (3%)
 Frame = +2

Query  212   NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11    NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71    SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  131   AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  190

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L AEEAF++AG++ 
Sbjct  191   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDS  250

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFF LQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL 
Sbjct  251   GFFVLQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLT  310

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  311   HKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  352



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/341 (84%), Positives = 308/341 (90%), Gaps = 6/341 (2%)
 Frame = +2

Query  203   AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2     AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIAA+DNAV VEL E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62    QVAAIAAKDNAVAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  122   ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFL  181

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAFKLAGV  G
Sbjct  182   NENITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLNAEEAFKLAGVKGG  241

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS+ LF+ANILAVLSEV+SA+FAEVM+GKPEFTDHL H
Sbjct  242   FFELQPKEGLALVNGTAVGSGLASIALFDANILAVLSEVMSAVFAEVMNGKPEFTDHLTH  301

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  302   KLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEQDPLQKPK  342



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/342 (83%), Positives = 310/342 (91%), Gaps = 10/342 (3%)
 Frame = +2

Query  212   NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11    NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71    SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  131   AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  190

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L AEEAF++AG++ 
Sbjct  191   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDS  250

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFF LQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL 
Sbjct  251   GFFVLQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLT  310

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  311   HKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  352



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/347 (83%), Positives = 310/347 (89%), Gaps = 13/347 (4%)
 Frame = +2

Query  206   IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6     VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  362   TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66    TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126   RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEE F++
Sbjct  186   AITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEERFRV  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEF
Sbjct  246   AGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   TDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/339 (84%), Positives = 305/339 (90%), Gaps = 6/339 (2%)
 Frame = +2

Query  206   IENGHSND---FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             IENG  N+   FCIK DPLNW + A+SLKGSHL+EVKRMVAEFR P VK+GG+TLTV+QV
Sbjct  6     IENGQVNEAIEFCIK-DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGGETLTVSQV  64

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             A IAARDN VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  65    AGIAARDNGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILEAITK LNH
Sbjct  125   QKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILEAITKFLNH  184

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             N+TP LPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP GQ L AE+AF LAGV DGFF
Sbjct  185   NVTPVLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQVLNAEQAFGLAGVEDGFF  244

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNG AVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKL
Sbjct  245   ELQPKEGLALVNGAAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKL  304

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIME+ILDGS ++K A K+HEMDPLQKP+
Sbjct  305   KHHPGQIEAAAIMEYILDGSDYVKEAAKVHEMDPLQKPK  343



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/342 (83%), Positives = 309/342 (90%), Gaps = 8/342 (2%)
 Frame = +2

Query  206   IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK GG++LTVA
Sbjct  1     MENGHDECVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKFGGESLTVA  60

Query  371   QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61    QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  
Sbjct  121   GALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+A  AEEAF+LAG++ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLS VLSAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSVVLSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHELDPLQKPK  342



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/341 (84%), Positives = 312/341 (91%), Gaps = 7/341 (2%)
 Frame = +2

Query  203   AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             A ENGH    N FC++  DPLNW MAA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT++
Sbjct  82    AAENGHHAAGNGFCVQQNDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGETLTIS  141

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIAARDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G 
Sbjct  142   QVAAIAARDNAVAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  201

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  202   ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  261

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTA EAFKLAGV DG
Sbjct  262   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGETLTAVEAFKLAGV-DG  320

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS+ L+EAN+L++LSEV+SAIFAEVM+GKPEFTDHL H
Sbjct  321   FFELQPKEGLALVNGTAVGSGLASIALYEANVLSLLSEVMSAIFAEVMNGKPEFTDHLTH  380

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  381   KLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHETDPLQKPK  421



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/342 (83%), Positives = 309/342 (90%), Gaps = 6/342 (2%)
 Frame = +2

Query  200   GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             GAI NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6     GAITNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  365   VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66    ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  542   NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126   QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  
Sbjct  186   LNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEG  245

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL 
Sbjct  246   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLT  305

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  347



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/341 (81%), Positives = 306/341 (90%), Gaps = 7/341 (2%)
 Frame = +2

Query  206   IENGHSN-DFCI----KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             + N H N  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6     LTNAHQNCSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAA++  D  V+VELSE AR GVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66    QVAAVSGHDQGVRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLL
Sbjct  126   ALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLL  185

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ LTA++AF+LA +N  
Sbjct  186   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLTAKQAFELANINSE  245

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             F+ELQPKEGLALVNGTAVGSGMAS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL H
Sbjct  246   FYELQPKEGLALVNGTAVGSGMASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTH  305

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  306   KLKHHPGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  346



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/347 (83%), Positives = 309/347 (89%), Gaps = 13/347 (4%)
 Frame = +2

Query  206   IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6     VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  362   TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66    TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126   RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF +
Sbjct  186   AITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFHV  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NILAV+SEVLSAIFAEVM+GKPEF
Sbjct  246   AGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILAVMSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TD+L HKLKHHPGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  306   TDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  352



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/346 (82%), Positives = 309/346 (89%), Gaps = 8/346 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  355
             M  A ENGH N     FC+K   DPLNW  AA++LKGSHL+EVKRMV EFR P VK+GG+
Sbjct  1     MAAATENGHRNGAVNGFCVKAQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVKLGGE  60

Query  356   TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             +LT++QVAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  61    SLTISQVAAIAARDNAVAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  120

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIR LNAGIFG+GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKQGGALQKELIRSLNAGIFGSGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             ITK LN NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G  L AEEAFKL 
Sbjct  181   ITKFLNKNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGATLNAEEAFKLV  240

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             GVN GFFELQPKEGLALVNGTAVGSG+AS+ L+EANILA+LSEV+SAIFAEVM+GKPEFT
Sbjct  241   GVNGGFFELQPKEGLALVNGTAVGSGLASIALYEANILALLSEVMSAIFAEVMNGKPEFT  300

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  301   DHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKVHEMDPLQKPK  346



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/344 (82%), Positives = 307/344 (89%), Gaps = 7/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1     MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60    TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120   QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LAG+
Sbjct  180   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGI  239

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
                FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDH
Sbjct  240   GSDFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSEVMSAIFAEVMQGKPEFTDH  299

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  300   LTHKLKHHPGQIEAAAIMEHILDGSAYVKAAKKLHETDPLQKPK  343



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 309/342 (90%), Gaps = 10/342 (3%)
 Frame = +2

Query  212   NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  18    NGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  77

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             +QVAAIA RD  VKVELSE A AGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  78    SQVAAIATRDLGVKVELSEDAMAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  137

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  138   AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  197

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L AEEAF++AG++ 
Sbjct  198   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAEEAFRVAGIDS  257

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFF LQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL 
Sbjct  258   GFFVLQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLT  317

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  318   HKLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEMDPLQKPK  359



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/342 (83%), Positives = 308/342 (90%), Gaps = 6/342 (2%)
 Frame = +2

Query  200   GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6     GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  365   VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66    ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  542   NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126   QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  
Sbjct  186   LNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEG  245

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL 
Sbjct  246   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLT  305

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  347



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/335 (85%), Positives = 306/335 (91%), Gaps = 4/335 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NGH ND CIK DPLNW +AA++L GSHL+EVK+MV EF+NP VKIGG+TLTV+QVA IAA
Sbjct  15    NGHINDLCIK-DPLNWGVAAEALTGSHLNEVKKMVKEFKNPIVKIGGETLTVSQVAGIAA  73

Query  392   RDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  568
              DNA VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+EL
Sbjct  74    SDNASVKVELSESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGGALQKEL  133

Query  569   IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  742
             IRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N+TP
Sbjct  134   IRFLNAGIFGNGTEASHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTP  193

Query  743   CLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQP  922
             CLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTAE+AF  AGV  GFFELQP
Sbjct  194   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEILTAEKAFAQAGVEGGFFELQP  253

Query  923   KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  1102
             KEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  254   KEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  313

Query  1103  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  314   GQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  348



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/339 (83%), Positives = 308/339 (91%), Gaps = 5/339 (1%)
 Frame = +2

Query  203   AIENGHSND--FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             A  NGHS +  FC++ DPLNW  AA+ LKGSHLDEVK+MV EFR P V++GG+TLT+AQV
Sbjct  2     AYSNGHSKNGGFCVE-DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKTLTIAQV  60

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIA  D+ VKVELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  61    AAIATHDSGVKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKEGGAL  120

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPHS TRA+MLVRINTLLQGYSGIRFEILEAIT+ LNH
Sbjct  121   QKELIRFLNAGIFGNGTESSHTLPHSTTRASMLVRINTLLQGYSGIRFEILEAITEFLNH  180

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+GQ+LTA EAF+LAG++ GFF
Sbjct  181   NITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQSLTAAEAFELAGLSSGFF  240

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSGMAS+VLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKL
Sbjct  241   ELQPKEGLALVNGTAVGSGMASVVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKL  300

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS ++K A K+HEMDPLQKP+
Sbjct  301   KHHPGQIEAAAIMEHILDGSAYVKEAAKIHEMDPLQKPK  339



>gb|AJW77399.1| phenylalanine ammonia-lyase [Angelica sinensis]
Length=718

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/341 (84%), Positives = 310/341 (91%), Gaps = 9/341 (3%)
 Frame = +2

Query  212   NGHSN----DFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGH+N    D C+K  +PLNW +AA++L GSHLDEVKRMVAE+R P VK+GG+TLT++QV
Sbjct  9     NGHANGNGIDLCMKNEEPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLGGETLTISQV  68

Query  377   AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69    AAISARDDSGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  128

Query  554   LQQELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             LQ+ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  129   LQKELIRFLNAGIFGSGAQAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  188

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             NHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  G
Sbjct  189   NHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGG  248

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEV+SAIFAEVM GKPEFTDHL H
Sbjct  249   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVMSAIFAEVMQGKPEFTDHLTH  308

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309   KLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  349



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/353 (81%), Positives = 312/353 (88%), Gaps = 15/353 (4%)
 Frame = +2

Query  194   MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             M    +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1     MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  344   IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
             +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61    LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121   GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A
Sbjct  181   RFEILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNA  240

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             EEAF++AGV  GFFELQPKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM
Sbjct  241   EEAFRVAGVTGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVM  300

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +GKPEFTD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  301   NGKPEFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  353



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/336 (85%), Positives = 305/336 (91%), Gaps = 3/336 (1%)
 Frame = +2

Query  209   ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  388
             +NG   +FC+K DPLNW MAA+SLKGSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIA
Sbjct  12    QNGERAEFCVKGDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTVSQVAAIA  71

Query  389   ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
             A DNA VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  72    ASDNAGVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  131

Query  566   LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN+T
Sbjct  132   LIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNVT  191

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             P LPLRGTITASGD+VPLSYIAGLLTGR NSKAVGP G+ L AE+AF  AGV  GFFELQ
Sbjct  192   PFLPLRGTITASGDLVPLSYIAGLLTGRANSKAVGPTGEVLNAEKAFAEAGVEGGFFELQ  251

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  252   PKEGLALVNGTAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  311

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  312   PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  347



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/348 (82%), Positives = 309/348 (89%), Gaps = 15/348 (4%)
 Frame = +2

Query  209   ENGHSN--------DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +NGH N        D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  7     QNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  66

Query  359   LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  529
             LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  67    LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126

Query  530   RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  703
             RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  127   RRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  186

Query  704   EAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFK  883
             EAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSK VGPNG+ L AEEAF+
Sbjct  187   EAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKVVGPNGEKLNAEEAFR  246

Query  884   LAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPE  1063
             +AGV  GFFELQPKEGLALVNGTAVGS MAS+VLFE+NILAV+SEVLSAIFAEVM+GKPE
Sbjct  247   VAGVTGGFFELQPKEGLALVNGTAVGSAMASIVLFESNILAVMSEVLSAIFAEVMNGKPE  306

Query  1064  FTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             FTD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307   FTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/351 (81%), Positives = 311/351 (89%), Gaps = 13/351 (4%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  340
             ME   +NGH       FC         +DPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1     METITQNGHHKGSLESFCTASKGAGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  341   KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  520
             K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61    KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  521   TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRF  694
             TSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRF
Sbjct  121   TSHRRTKQGAALQKELIRFLNAGIFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  695   EILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEE  874
             EILEAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEE
Sbjct  181   EILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEE  240

Query  875   AFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHG  1054
             AF++AG++ GFF LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+G
Sbjct  241   AFRVAGIDSGFFVLQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNG  300

Query  1055  KPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KPEFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  301   KPEFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  351



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/338 (84%), Positives = 309/338 (91%), Gaps = 5/338 (1%)
 Frame = +2

Query  209   ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  385
             ENG+  D C+K  DPL+W +AA++LKGSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9     ENGNGVDLCMKKEDPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  386   AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  562
             +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69    SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  563   ELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  129   ELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  188

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  GFFE
Sbjct  189   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGGFFE  248

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLK
Sbjct  249   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLK  308

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309   HHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  346



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/340 (83%), Positives = 310/340 (91%), Gaps = 7/340 (2%)
 Frame = +2

Query  206   IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             +ENGHS+    +FCI+ DPLNW  AA+SLKGSHLDE+KRMV EFR P VK+GG+TLT++Q
Sbjct  6     VENGHSSGKLLNFCIE-DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLGGETLTISQ  64

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIA+RDNAVKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  65    VAAIASRDNAVKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  124

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT     LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  125   LQKELIRFLNAGIFGNGTESSQALPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  184

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
              NITPCLPLRGTI++SGD+VPLSYIAGLLTGR NSK VGP G++LTAEEAFKLAGVN GF
Sbjct  185   SNITPCLPLRGTISSSGDLVPLSYIAGLLTGRHNSKVVGPTGESLTAEEAFKLAGVNGGF  244

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS+VLF+AN+L VLSEVLSAIFAEVM+GKPEFTDHL HK
Sbjct  245   FELQPKEGLALVNGTAVGSGLASIVLFDANVLTVLSEVLSAIFAEVMNGKPEFTDHLTHK  304

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAA+ME+ILDGS ++KAAQKLHEMDPLQKP+
Sbjct  305   LKHHPGQIEAAAVMEYILDGSAYVKAAQKLHEMDPLQKPK  344



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/347 (81%), Positives = 307/347 (88%), Gaps = 7/347 (2%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  352
             T +        +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4     TRVSNGYHQSQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  353   QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             +TLT++QVAAIA RD  V +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR
Sbjct  64    ETLTISQVAAIATRDQDVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  123

Query  533   RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTK G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  124   RTKQGGALQKELIRFLNAGIFGNGAVSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  183

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+L
Sbjct  184   AITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQL  243

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AG+N  FFELQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEF
Sbjct  244   AGINSEFFELQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEF  303

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TDHL HKLKHHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  304   TDHLTHKLKHHPGQIEAAAIMEHILDGSSYMKDAKKLHEMDPLQKPK  350



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/353 (82%), Positives = 311/353 (88%), Gaps = 15/353 (4%)
 Frame = +2

Query  194   MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             M    +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MVAEFR P VK
Sbjct  1     MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVK  60

Query  344   IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
             +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61    LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121   GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A
Sbjct  181   RFEILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNA  240

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             EEAF  AGV+ GFFELQPKEGLALVNGTAVGSGMASMVLF++NILAV+SEVLSAIFAEVM
Sbjct  241   EEAFCAAGVSGGFFELQPKEGLALVNGTAVGSGMASMVLFDSNILAVMSEVLSAIFAEVM  300

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +GKPEFTD+L HKLKHHPGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  301   NGKPEFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  353



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/344 (83%), Positives = 311/344 (90%), Gaps = 4/344 (1%)
 Frame = +2

Query  188   TTMEGAIENGHS-NDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             TT   A ENGHS N FC+K  DPLNW  AA++L+GSHLD VKRMV EFR PAVK+GG+TL
Sbjct  48    TTSIMAAENGHSENGFCVKQSDPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGETL  107

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK
Sbjct  108   TIAQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTK  167

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHS+TRAAMLVRINTL+QGYSGIRFEILEA+ 
Sbjct  168   QGGALQKELIRFLNAGIFGNGTESNHTLPHSSTRAAMLVRINTLMQGYSGIRFEILEALA  227

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             K LNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTAE AFKLAGV
Sbjct  228   KFLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEPLTAEAAFKLAGV  287

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
               GFFELQPKEGLALVNGTAVGSG+AS+ L+EANILA+L+EV+SAIFAEVM+GKPEFTDH
Sbjct  288   AGGFFELQPKEGLALVNGTAVGSGLASIALYEANILALLAEVMSAIFAEVMNGKPEFTDH  347

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  348   LTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  391



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/328 (84%), Positives = 300/328 (91%), Gaps = 2/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FCIK DPLNW MAAD+LKGSHLDEVK+MV E+R   V++GG+TLT++QVAA+A+ D  VK
Sbjct  15    FCIKEDPLNWGMAADALKGSHLDEVKKMVKEYRQGVVRLGGETLTISQVAAVASHDQGVK  74

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  75    VELNESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  134

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             +FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA+TK L+HNITPCLPLRGT
Sbjct  135   VFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLDHNITPCLPLRGT  194

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AEEAF LAG+N GFFELQPKEGLALV
Sbjct  195   ITASGDLVPLSYIAGLLTGRPNSKAVGPKGETLNAEEAFTLAGINGGFFELQPKEGLALV  254

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFEANILAVLSEV+SAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  255   NGTAVGSGLASMVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  314

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  315   IMEHILDGSSYVKEAKKLHEMDPLQKPK  342



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/337 (83%), Positives = 307/337 (91%), Gaps = 4/337 (1%)
 Frame = +2

Query  206   IENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  382
             +ENG+   +FC+K DPLNW MAA+S+KGSHLDEVK+MVAEFR P V++ G+TLT+AQVAA
Sbjct  1     MENGNGKMEFCMK-DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVVQLAGKTLTIAQVAA  59

Query  383   IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  562
             IAARD+ V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  60    IAARDDGVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  119

Query  563   ELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNI  736
             ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN NI
Sbjct  120   ELIRFLNAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNI  179

Query  737   TPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFEL  916
             TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AEEAF+LAG++ GFFEL
Sbjct  180   TPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEKLNAEEAFRLAGISSGFFEL  239

Query  917   QPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKH  1096
             QPKEGLALVNGTAVGSGMASMVL+EANIL V+SEVLSA+FAEVM+GKPEFTDHL HKLKH
Sbjct  240   QPKEGLALVNGTAVGSGMASMVLYEANILGVMSEVLSAVFAEVMNGKPEFTDHLTHKLKH  299

Query  1097  HPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HPGQIEAAAIMEHILDGS ++KAA+ LHEMDPLQKP+
Sbjct  300   HPGQIEAAAIMEHILDGSGYVKAAELLHEMDPLQKPK  336



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/351 (81%), Positives = 311/351 (89%), Gaps = 13/351 (4%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  340
             ME   +NGH       FC         VDPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1     METITQNGHHKGSLESFCTASKGAGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  341   KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  520
             K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61    KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  521   TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRF  694
             TSHRRTK G ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRF
Sbjct  121   TSHRRTKQGAALQKELIRFLNAGVFGHGTESCHTLPHSATRAAMLVRINTLLQGYSGIRF  180

Query  695   EILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEE  874
             EILEAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEE
Sbjct  181   EILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAEE  240

Query  875   AFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHG  1054
             AF++AG++ GFF LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM+G
Sbjct  241   AFRVAGIDSGFFVLQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMNG  300

Query  1055  KPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KPEFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  301   KPEFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  351



>ref|XP_012082374.1| PREDICTED: phenylalanine ammonia-lyase [Jatropha curcas]
 gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 311/344 (90%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1     MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61    TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GP+G++L A EAF+LA +
Sbjct  181   KLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPSGESLDAVEAFRLADI  240

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             + GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSAIFAEVM+GKPEFTDH
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAIFAEVMNGKPEFTDH  300

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA++LHE+DPLQKP+
Sbjct  301   LTHKLKHHPGQIEAAAIMEHILDGSSYIKAAKQLHEIDPLQKPK  344



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 297/328 (91%), Gaps = 2/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
              CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D  VK
Sbjct  4     LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTGVK  63

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  64    VELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  123

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             +FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N+TPCLPLRGT
Sbjct  124   VFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPCLPLRGT  183

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             ITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N GFFELQPKEGLALV
Sbjct  184   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSGFFELQPKEGLALV  243

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPE+TDHL H LKHHPGQIEAAA
Sbjct  244   NGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEYTDHLTHSLKHHPGQIEAAA  303

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  304   IMEHILDGSSYVKAAKKLHEQDPLQKPK  331



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/341 (81%), Positives = 303/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVMHGKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMHGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/341 (81%), Positives = 303/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/339 (82%), Positives = 306/339 (90%), Gaps = 7/339 (2%)
 Frame = +2

Query  212   NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5     NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  65    AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+
Sbjct  125   QKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNN  184

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF+LA +N  FF
Sbjct  185   NVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFF  244

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKL
Sbjct  245   ELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKL  304

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  305   KHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  343



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/341 (81%), Positives = 303/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/338 (84%), Positives = 308/338 (91%), Gaps = 5/338 (1%)
 Frame = +2

Query  209   ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  385
             ENG+  D C+K  DPL+W +AA++L GSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9     ENGNGVDLCMKKEDPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  386   AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  562
             +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69    SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  563   ELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  129   ELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  188

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  GFFE
Sbjct  189   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGGFFE  248

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLK
Sbjct  249   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLK  308

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309   HHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  346



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/341 (84%), Positives = 309/341 (91%), Gaps = 9/341 (3%)
 Frame = +2

Query  212   NGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGH+N    D C+K  DPLNW +AA++L GSHLDEVKRMVAE+R P VK+ G+TLT++QV
Sbjct  9     NGHANGNGLDLCMKKEDPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEGETLTISQV  68

Query  377   AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69    AAISARDDSGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  128

Query  554   LQQELIRFLNAGIFGTGT---GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             LQ+ELIRFLNAGIFG+G     +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  129   LQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  188

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             NHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  G
Sbjct  189   NHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGVTLSPEEAFKLAGVEGG  248

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL H
Sbjct  249   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTH  308

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309   KLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  349



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 309/344 (90%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             M   +ENGH  +N FC+K  DPLNW  AA+ LKGSHLDEVKRMV EFR   VK+GG+TLT
Sbjct  1     MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLT  60

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             ++QVAAIAARDN V V+L+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61    ISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE ITK
Sbjct  121   GGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILETITK  180

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
              LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L AE+AFKLAG N
Sbjct  181   FLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLNAEQAFKLAGAN  240

Query  899   DG-FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
              G FFELQPKEGLALVNGTAVGSG+AS+ L+EANIL++L+EV+SA+FAEVM+GKPEFTDH
Sbjct  241   SGLFFELQPKEGLALVNGTAVGSGLASIALYEANILSLLAEVMSAVFAEVMNGKPEFTDH  300

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  301   LTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKMHEMDPLQKPK  344



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/339 (82%), Positives = 306/339 (90%), Gaps = 5/339 (1%)
 Frame = +2

Query  206   IENGHSND--FCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             +ENGH N   FC+K  DPLNW  AA++L+GSHLDEVKRMVAEFR P VK+GG+TLT++QV
Sbjct  1     MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGETLTISQV  60

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61    AAIAARDNGVVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  557   QQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE ITK LNH
Sbjct  121   QKELIRFLNAGIFGKGTESEHTLPHTATRAAMLVRINTLLQGYSGIRFEILETITKFLNH  180

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NITPCLPLRGTITASGD+VPLSYIAG LTGRPNS+AVGP G+AL AEEAFKLAG + GFF
Sbjct  181   NITPCLPLRGTITASGDLVPLSYIAGFLTGRPNSRAVGPTGEALNAEEAFKLAGASGGFF  240

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSG+AS+ L+EAN+L +LSEV+SA+FAEVM+GKPEFTDHL HKL
Sbjct  241   ELQPKEGLALVNGTAVGSGLASIALYEANVLTLLSEVMSAVFAEVMNGKPEFTDHLTHKL  300

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS ++KAAQK+HEMDPLQKP+
Sbjct  301   KHHPGQIEAAAIMEHILDGSAYVKAAQKMHEMDPLQKPK  339



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/336 (84%), Positives = 305/336 (91%), Gaps = 4/336 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9     NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  392   RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
               ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69    AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  566   LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN N+T
Sbjct  129   LIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNTNVT  188

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             PCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AE+AF LAGV+ GFFELQ
Sbjct  189   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEILNAEKAFSLAGVSGGFFELQ  248

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249   PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIME+ILDGS ++KAAQKLHEMDPLQKP+
Sbjct  309   PGQIEAAAIMEYILDGSDYVKAAQKLHEMDPLQKPK  344



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/341 (81%), Positives = 303/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINCG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVMHGKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMHGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 308/342 (90%), Gaps = 8/342 (2%)
 Frame = +2

Query  206   IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK+GG++LTVA
Sbjct  1     MENGHDEGVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKLGGESLTVA  60

Query  371   QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61    QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   H LPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  
Sbjct  121   GALQKELIRFLNAGIFGNGTETCHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITTF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+A  AEEAF+LAG++ 
Sbjct  181   LNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEAFNAEEAFRLAGLSG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFF LQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLS VLSAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFLLQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSVVLSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHELDPLQKPK  342



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/340 (84%), Positives = 307/340 (90%), Gaps = 7/340 (2%)
 Frame = +2

Query  206   IENGH--SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             +ENGH  SN  C++   DPLNW  AA+SLKGSHLDEVKRMV EFR PAVK+GG++LT+AQ
Sbjct  1     MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLDEVKRMVEEFRKPAVKLGGESLTIAQ  60

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  61    VAAIAARDNAVAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  120

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   H LPHSATRAAMLVRINTLLQGYSGIRFEILEA+TK LN
Sbjct  121   LQKELIRFLNAGIFGNGTESNHALPHSATRAAMLVRINTLLQGYSGIRFEILEALTKFLN  180

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+AL A EAF LAGV+ GF
Sbjct  181   HNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEALNAGEAFSLAGVS-GF  239

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS+ L++ANILAVLSEV S IFAEVM+GKPEFTDHL HK
Sbjct  240   FELQPKEGLALVNGTAVGSGLASIALYDANILAVLSEVTSVIFAEVMNGKPEFTDHLTHK  299

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  300   LKHHPGQIEAAAIMEHILDGSAYVKAAQKLHETDPLQKPK  339



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/340 (82%), Positives = 306/340 (90%), Gaps = 8/340 (2%)
 Frame = +2

Query  212   NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5     NGHQNGSFCLSTAKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65    VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  125   LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  184

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LA +N  F
Sbjct  185   NNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEF  244

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HK
Sbjct  245   FELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHK  304

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  305   LKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  344



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/340 (81%), Positives = 302/340 (89%), Gaps = 7/340 (2%)
 Frame = +2

Query  209   ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11    QNGHQNRVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71    VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  131   LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  190

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L+A EAF+L G+N GF
Sbjct  191   NNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLSASEAFELVGINCGF  250

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HK
Sbjct  251   FELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHK  310

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   LKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  350



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 309/344 (90%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1     MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61    TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GP G++L A EAF LAG+
Sbjct  181   KLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPTGESLDAVEAFCLAGI  240

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             + GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSAIFAEVM+GKPEFTDH
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAIFAEVMNGKPEFTDH  300

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA++ HE+DPLQKP+
Sbjct  301   LTHKLKHHPGQIEAAAIMEHILDGSSYIKAAKQSHEIDPLQKPK  344



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/348 (81%), Positives = 312/348 (90%), Gaps = 15/348 (4%)
 Frame = +2

Query  209   ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3     QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  359   LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  529
             LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63    LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  530   RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  703
             RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  123   RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  182

Query  704   EAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFK  883
             EAITKL+N NITPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF+
Sbjct  183   EAITKLINSNITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLDADEAFR  242

Query  884   LAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPE  1063
             +AGV+ GFFELQPKEGLALVNGTAVGSGMAS+VL+++NILAV+SEVLSAIFAEVM+GKPE
Sbjct  243   VAGVSGGFFELQPKEGLALVNGTAVGSGMASIVLYDSNILAVMSEVLSAIFAEVMNGKPE  302

Query  1064  FTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             FTD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  303   FTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  350



>ref|XP_012082376.1| PREDICTED: phenylalanine ammonia-lyase-like [Jatropha curcas]
Length=713

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 309/344 (90%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1     MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61    TVAQVAAIASHDADVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  121   QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  180

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GP G++L A EAF LAG+
Sbjct  181   KLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPTGESLDAVEAFCLAGI  240

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
             + GFFELQPKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSAIFAEVM+GKPEFTDH
Sbjct  241   DSGFFELQPKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAIFAEVMNGKPEFTDH  300

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA++ HE+DPLQKP+
Sbjct  301   LTHKLKHHPGQIEAAAIMEHILDGSSYIKAAKQSHEIDPLQKPK  344



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/353 (80%), Positives = 309/353 (88%), Gaps = 15/353 (4%)
 Frame = +2

Query  194   MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             M   + NGH+N      D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1     MASIVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  344   IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
             +GG+TLT+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61    LGGETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             G TSHRRT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121   GDTSHRRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A
Sbjct  181   RFEILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNA  240

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             EEAF++AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NIL V+SEVLSAIFAEVM
Sbjct  241   EEAFRVAGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILVVMSEVLSAIFAEVM  300

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +GKPEFTD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  301   NGKPEFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  353



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/347 (81%), Positives = 308/347 (89%), Gaps = 13/347 (4%)
 Frame = +2

Query  206   IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6     VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  362   TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             T+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFG TSHR
Sbjct  66    TIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILE
Sbjct  126   RTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKL+N NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF++
Sbjct  186   AITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFRV  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AGV  GFFELQPKEGLALVNGTAVGSGMASMVLFE+NIL V+SEVLSAIFAEVM+GKPEF
Sbjct  246   AGVTSGFFELQPKEGLALVNGTAVGSGMASMVLFESNILVVMSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TD+L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  306   TDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  352



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/334 (84%), Positives = 305/334 (91%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  400
             D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21    DLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  401   ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
                 VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  81    KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELI  140

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NITPC
Sbjct  141   RFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPC  200

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPN + L AEEAF++AGV  GFFELQPK
Sbjct  201   LPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNREKLNAEEAFRVAGVTGGFFELQPK  260

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSGMAS+VL+++NILAV+SEVLSAIFAEVM+GKPEFTD+L HKLKHHPG
Sbjct  261   EGLALVNGTAVGSGMASIVLYDSNILAVMSEVLSAIFAEVMNGKPEFTDYLTHKLKHHPG  320

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  321   QIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/336 (84%), Positives = 302/336 (90%), Gaps = 5/336 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG +N FCIK DPLNW +AA++L GSHLDEVK+MV EFR P VK+GG+TLTV+QVA I+A
Sbjct  8     NGSANGFCIK-DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISA  66

Query  392   --RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
                 N VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+E
Sbjct  67    AGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKE  126

Query  566   LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+NIT
Sbjct  127   LIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNIT  186

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             PCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AE AF  AGV  GFFELQ
Sbjct  187   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEVLNAESAFAQAGVEGGFFELQ  246

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247   PKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307   PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  342



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/341 (83%), Positives = 309/341 (91%), Gaps = 8/341 (2%)
 Frame = +2

Query  206   IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             ++NGH+N    + CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+Q
Sbjct  1     MDNGHANGVAKELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQ  59

Query  374   VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             VA IAA +NA VKVEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG 
Sbjct  60    VAGIAASENAGVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGG  119

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  120   ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFL  179

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+GQ L AE+AF LAGV+ G
Sbjct  180   NTNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGQILNAEKAFSLAGVDGG  239

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL H
Sbjct  240   FFELQPKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTH  299

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIME+ILDGS ++KAA K+HEMDPLQKP+
Sbjct  300   KLKHHPGQIEAAAIMEYILDGSDYVKAAAKVHEMDPLQKPK  340



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/323 (85%), Positives = 297/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P +K+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L A EAF LAG+N GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQKLHE+DPLQKP+
Sbjct  320   LDGSSYVKAAQKLHEIDPLQKPK  342



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/341 (81%), Positives = 301/341 (88%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/336 (83%), Positives = 301/336 (90%), Gaps = 7/336 (2%)
 Frame = +2

Query  221   SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  385
             ++ FC+       DPLNW +AA+SLKGSHLDEVKRMV EFR P V++GG+TLT++QVAAI
Sbjct  11    ADSFCLSGGVAAADPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQVAAI  70

Query  386   AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
             AA D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  71    AAHDQGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQKE  130

Query  566   LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHNIT
Sbjct  131   LIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNIT  190

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             PCLPLRGTIT SGD+VPLSYIAGLLTGRPNSKAVG +G+ LT +EAF+LAG++  FF LQ
Sbjct  191   PCLPLRGTITTSGDLVPLSYIAGLLTGRPNSKAVGTSGELLTPKEAFQLAGIDSDFFGLQ  250

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIF EVM GKPEFTDHL HKLKHH
Sbjct  251   PKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFTEVMQGKPEFTDHLTHKLKHH  310

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIMEHILDGS +MKAAQKLHE+DPLQKP+
Sbjct  311   PGQIEAAAIMEHILDGSSYMKAAQKLHEIDPLQKPK  346



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/353 (80%), Positives = 309/353 (88%), Gaps = 15/353 (4%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCIK---------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  334
             ME   +NG  N     FC           VDPLNW   A+SLKGSHLDEVKRMVAE+R P
Sbjct  1     METIAQNGRQNGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKP  60

Query  335   AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
             +VK+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGF
Sbjct  61    SVKLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGF  120

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGI
Sbjct  121   GATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGI  180

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAITKLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G++L A
Sbjct  181   RFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGESLDA  240

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             +EAF +AG++ GFF LQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSE+LSAIFAEVM
Sbjct  241   QEAFCVAGIDTGFFVLQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEILSAIFAEVM  300

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +GKPEFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  301   NGKPEFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  353



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/341 (81%), Positives = 301/341 (88%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11    QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71    QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK L
Sbjct  131   ALQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFL  190

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G+N G
Sbjct  191   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGINSG  250

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL H
Sbjct  251   FFELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTH  310

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/329 (84%), Positives = 302/329 (92%), Gaps = 2/329 (1%)
 Frame = +2

Query  227   DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-N  400
             D CI K DPL+W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT++QVAAI+ARD +
Sbjct  2     DLCINKEDPLSWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLTISQVAAISARDGS  61

Query  401   AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  580
              V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  62    GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFL  121

Query  581   NAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRG  760
             NAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN NITPCLPLRG
Sbjct  122   NAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNITPCLPLRG  181

Query  761   TITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLAL  940
             TITASGD+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  GFFELQPKEGLAL
Sbjct  182   TITASGDLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQPKEGLAL  241

Query  941   VNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAA  1120
             VNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHHPGQIEAA
Sbjct  242   VNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAA  301

Query  1121  AIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  302   AIMEHILDGSAYVKAAQKLHEMDPLQKPK  330



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/323 (85%), Positives = 298/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  20    DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  80    SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  139

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITASG
Sbjct  140   AESNHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA+GPNG++L A+EAF+ AG+  GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAIGPNGESLDAKEAFQQAGIPSGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  320   LDGSSYMKTAKKLHEMDPLQKPK  342



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/342 (82%), Positives = 305/342 (89%), Gaps = 8/342 (2%)
 Frame = +2

Query  206   IENGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             I NG  N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+
Sbjct  6     ITNGSQNGSFCLSTTKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTI  65

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAA+A  D  V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  66    AQVAAVAGHDLGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQG  125

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  126   GALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKL  185

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LA +N 
Sbjct  186   LNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINS  245

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
              FFELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL 
Sbjct  246   EFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLT  305

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  306   HKLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  347



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/336 (82%), Positives = 303/336 (90%), Gaps = 3/336 (1%)
 Frame = +2

Query  209   ENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  385
             +NG     CI   DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  9     KNGSVESLCIGSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  68

Query  386   AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
             A RD  V VELSE +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69    ATRDTDVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  566   LIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG+G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NIT
Sbjct  129   LIRFLNAGIFGSGAESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNIT  188

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             PCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+ +TA+EAF+ A +  GFFELQ
Sbjct  189   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGERITAKEAFQQADIPSGFFELQ  248

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  249   PKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHH  308

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  309   PGQIEAAAIMEHILDGSSYMKTAKKLHEIDPLQKPK  344



>ref|XP_004143356.2| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/337 (82%), Positives = 301/337 (89%), Gaps = 4/337 (1%)
 Frame = +2

Query  209   ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  382
             +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12    QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  383   IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  562
             IA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72    IATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  563   ELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNI  736
             ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN N+
Sbjct  132   ELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENV  191

Query  737   TPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFEL  916
             TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+ L AE AFK AG+   FFEL
Sbjct  192   TPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSSFFEL  251

Query  917   QPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKH  1096
             QPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKH
Sbjct  252   QPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKH  311

Query  1097  HPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  312   HPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  348



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/323 (85%), Positives = 297/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIGVKVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA+GPNG+ LTA EAF LAG+N GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKALGPNGEPLTAAEAFTLAGINGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA+MEHI
Sbjct  260   GSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAVMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQKLHE+DPLQKP+
Sbjct  320   LDGSSYVKAAQKLHEIDPLQKPE  342



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/337 (82%), Positives = 302/337 (90%), Gaps = 4/337 (1%)
 Frame = +2

Query  209   ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  382
             +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12    QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  383   IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  562
             IA RD+ V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72    IATRDSDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  563   ELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNI  736
             ELIRFLNAGIFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLN N+
Sbjct  132   ELIRFLNAGIFGNGAESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNENV  191

Query  737   TPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFEL  916
             TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GPNG+ L AE AFK AG+  GFFEL
Sbjct  192   TPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAIGPNGETLDAEAAFKQAGIPSGFFEL  251

Query  917   QPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKH  1096
             QPKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPE+TDHL HKLKH
Sbjct  252   QPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEYTDHLTHKLKH  311

Query  1097  HPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  312   HPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  348



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/340 (82%), Positives = 305/340 (90%), Gaps = 8/340 (2%)
 Frame = +2

Query  212   NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5     NGHQNGSFCLSTAKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65    VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  125   LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  184

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCL LRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LA +N  F
Sbjct  185   NNVTPCLDLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFELASINSEF  244

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HK
Sbjct  245   FELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHK  304

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  305   LKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  344



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/341 (82%), Positives = 307/341 (90%), Gaps = 9/341 (3%)
 Frame = +2

Query  212   NGHSNDFCIK------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             N +   FC+K       DPLNW +AA+S+KGSHLDEVKRMV E+R P V++GG+TLT++Q
Sbjct  9     NFNGGSFCLKNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGETLTISQ  68

Query  374   VAAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             VAAIA A D+ V+VELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  69    VAAIAGAYDDGVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  128

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLP +ATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  129   ALQKELIRFLNAGIFGNGTESSHTLPQTATRAAMLVRINTLLQGYSGIRFEILEAITKLL  188

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LAG+NDG
Sbjct  189   NNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKEAFQLAGINDG  248

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGS +AS+VLF+ANIL VLSEVLSAIFAEVM GKPEFTDHL H
Sbjct  249   FFELQPKEGLALVNGTAVGSALASIVLFDANILVVLSEVLSAIFAEVMQGKPEFTDHLTH  308

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KA +KLHEMDPLQKP+
Sbjct  309   KLKHHPGQIEAAAIMEHILDGSSYVKADKKLHEMDPLQKPK  349



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/341 (79%), Positives = 305/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8     QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68    QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  551   ALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128   ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ L+A EAF+  G+N G
Sbjct  188   NNNVTPCLPLRGTITASGDLVPLSYIAGMLTGRPNSKAVGPDGQTLSAAEAFEFVGINSG  247

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLF+ NILA+LSE+LSAIFAEVM GKPEFTDHL H
Sbjct  248   FFELQPKEGLALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTH  307

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  308   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  348



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 301/338 (89%), Gaps = 6/338 (2%)
 Frame = +2

Query  200   GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18    GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74    AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  134   KELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNSN  193

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPL Y+AGLLTGRPNSKAVGPNGQ L A EAF+L G++ GFFE
Sbjct  194   VTPCLPLRGTITASGDLVPLPYVAGLLTGRPNSKAVGPNGQTLNASEAFELVGIDSGFFE  253

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  254   LQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHKLK  313

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  314   HHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/344 (81%), Positives = 310/344 (90%), Gaps = 6/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             MEGA+ NGH+   FC+     DPLNW +AADS+KGSHLDEVKRMV E+RNP V+IGG+TL
Sbjct  3     MEGALSNGHAQPTFCLTKTLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGGETL  62

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  63    TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  122

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  123   QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  182

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LA +
Sbjct  183   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFELASI  242

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
                FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LA+LSEV+SAIFAEVM GKPEFTDH
Sbjct  243   GSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLALLSEVMSAIFAEVMQGKPEFTDH  302

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEH+LDGS ++KAA+KLH+ DPLQKP+
Sbjct  303   LTHKLKHHPGQIEAAAIMEHVLDGSAYVKAAKKLHDTDPLQKPK  346



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/323 (85%), Positives = 296/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20    DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L A EAF LAG+N GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQKLHE+DPLQKP+
Sbjct  320   LDGSSYVKAAQKLHEIDPLQKPK  342



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/341 (79%), Positives = 305/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8     QNGHQNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68    QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  551   ALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128   ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ L+A EAF+  G+N G
Sbjct  188   NNNVTPCLPLRGTITASGDLVPLSYIAGMLTGRPNSKAVGPDGQTLSAAEAFEFVGINSG  247

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLF+ NILA+LSE+LSAIFAEVM GKPEFTDHL H
Sbjct  248   FFELQPKEGLALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTH  307

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  308   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  348



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/328 (84%), Positives = 298/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW +AA+ LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVT  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAG  133

Query  590   IFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP LPLRGT
Sbjct  134   IFGNGTDSCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPSLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             ITASGD+VPLSYIAGLLTGRPNSKAVGP G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   ITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFEANVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12    FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71    VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHS+TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+N+TPCLPLRGT
Sbjct  131   IFGHGTESCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNNVTPCLPLRGT  190

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             ITASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA+EAFK+A +N  FFELQPKEGLALV
Sbjct  191   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTAKEAFKVADINSSFFELQPKEGLALV  250

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+AS VLFEANILAVL+EVLSAIFAEV+ GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  251   NGTAVGSGVASTVLFEANILAVLAEVLSAIFAEVIQGKPEFTDHLTHKLKHHPGQIEAAA  310

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  311   IMEHILDGSSYVKEAKKLHEMDPLQKPK  338



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/341 (79%), Positives = 305/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8     QNGHKNGSVELPELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68    QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  551   ALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128   ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ L+A EAF+  G+N G
Sbjct  188   NNNVTPCLPLRGTITASGDLVPLSYIAGMLTGRPNSKAVGPDGQTLSAAEAFEFVGINSG  247

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLF+ NILA+LSE+LSAIFAEVM GKPEFTDHL H
Sbjct  248   FFELQPKEGLALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTH  307

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  308   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  348



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 307/339 (91%), Gaps = 6/339 (2%)
 Frame = +2

Query  209   ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10    ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70    AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q ELIRFLNAGIFG GT   HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+
Sbjct  130   QLELIRFLNAGIFGNGTETSHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINN  189

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NITPCLPLRGT+TASGD+VPLSYIAGLLTGR NSKAVGP+G+ + A+EAF+LAG++ GFF
Sbjct  190   NITPCLPLRGTVTASGDLVPLSYIAGLLTGRQNSKAVGPSGEVVNAKEAFQLAGIDTGFF  249

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSG+AS+VLF+AN+LA+L+EVLSAIFAEVM GKPEFTDHL HKL
Sbjct  250   ELQPKEGLALVNGTAVGSGLASIVLFDANVLAILAEVLSAIFAEVMQGKPEFTDHLTHKL  309

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  310   KHHPGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  348



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/339 (82%), Positives = 304/339 (90%), Gaps = 7/339 (2%)
 Frame = +2

Query  212   NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5     NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AA+A  D+ V VELSE AR GVKASS+WVMNSMNN TDSYGVTTGFGATSHRRTK G AL
Sbjct  65    AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRRTKQGGAL  124

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEA TKLLN+
Sbjct  125   QKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEANTKLLNN  184

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF+LA +N  FF
Sbjct  185   NVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEVLNAKEAFELASINSEFF  244

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKL
Sbjct  245   ELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKL  304

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  305   KHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  343



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/343 (81%), Positives = 300/343 (87%), Gaps = 11/343 (3%)
 Frame = +2

Query  212   NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             NG +ND          C   DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG++LT
Sbjct  9     NGINNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLT  68

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69    IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK
Sbjct  129   GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITK  188

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
              LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L   EAF LAGV 
Sbjct  189   FLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVT  248

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL
Sbjct  249   SGFFELQPKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHL  308

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  309   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  351



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/342 (82%), Positives = 310/342 (91%), Gaps = 6/342 (2%)
 Frame = +2

Query  194   MEGAIE--NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             ME  +E  NG S +FC++ DPLNWEMAA+S+KGSHLDEVKRMVAEFR P V++ G+TLT+
Sbjct  1     METIVEKGNGKSMEFCMQ-DPLNWEMAAESMKGSHLDEVKRMVAEFRKPVVQLAGKTLTI  59

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
              QVA+IAA D+ VKVEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60    GQVASIAAHDDGVKVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFL+AGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  120   GALQKELIRFLDAGIFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  179

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN NITP LPLRGTI++SGD+VPLSYIAGLLTGRPNS+ VGP G+ L AEEAF+LAG+++
Sbjct  180   LNSNITPFLPLRGTISSSGDLVPLSYIAGLLTGRPNSR-VGPKGEKLNAEEAFRLAGISN  238

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSGMASMVL+EA ILAVLSEV+SAIFAEVM+GKPEFTDHL 
Sbjct  239   GFFELQPKEGLALVNGTAVGSGMASMVLYEATILAVLSEVISAIFAEVMNGKPEFTDHLT  298

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  299   HKLKHHPGQIEAAAIMEHILDGSGYVKAAQKLHEMDPLQKPK  340



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/344 (82%), Positives = 308/344 (90%), Gaps = 7/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1     MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60    TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120   QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LAG+
Sbjct  180   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGI  239

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
                FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDH
Sbjct  240   GSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSEVMSAIFAEVMQGKPEFTDH  299

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  300   LTHKLKHHPGQIEAAAIMEHILDGSAYVKAAKKLHETDPLQKPK  343



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/324 (85%), Positives = 300/324 (93%), Gaps = 2/324 (1%)
 Frame = +2

Query  242   VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  421
             VDPLNW +AA+SLKGSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  23    VDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  82

Query  422   EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  601
             E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRT  G ALQ+ELIRFLNAGIFG 
Sbjct  83    EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFGN  142

Query  602   GT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITAS  775
             GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH ITPCLPLRGTITAS
Sbjct  143   GTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHGITPCLPLRGTITAS  202

Query  776   GDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTA  955
             GD+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF+LAG++ GFF LQPKE LALVNGTA
Sbjct  203   GDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFRLAGIDSGFFVLQPKESLALVNGTA  262

Query  956   VGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEH  1135
             VGSG+ASMVLFEANIL+VLSE+LSAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEH
Sbjct  263   VGSGLASMVLFEANILSVLSEILSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEH  322

Query  1136  ILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IL+GS ++KAAQKLHEMDPLQKP+
Sbjct  323   ILEGSSYVKAAQKLHEMDPLQKPK  346



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/328 (84%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/344 (82%), Positives = 308/344 (90%), Gaps = 7/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1     MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60    TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120   QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LAG+
Sbjct  180   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGI  239

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
                FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDH
Sbjct  240   GSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSEVMSAIFAEVMQGKPEFTDH  299

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  300   LTHKLKHHPGQIEAAAIMEHILDGSAYVKAAKKLHETDPLQKPK  343



>ref|XP_011653013.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/338 (81%), Positives = 300/338 (89%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG    FC    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7     ANQNGSMESFCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67    AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG G+   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127   KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  187   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFE  246

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  247   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  306

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/338 (81%), Positives = 303/338 (90%), Gaps = 2/338 (1%)
 Frame = +2

Query  200   GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             G++   +S   C+  DPLNW MAA+S+KGSHLDEVKRMV E+R   V++GG++LT++QVA
Sbjct  2     GSLVQENSIALCLNKDPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVA  61

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA+ D  V VEL+E +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  62    AIASHDQGVMVELNESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQ  121

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LNHN
Sbjct  122   KELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHN  181

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L A+EAF LAG++ GFFE
Sbjct  182   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEPLNAQEAFTLAGIDTGFFE  241

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEV+SAIFAEVM GKPEFTDHL HKLK
Sbjct  242   LQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLTHKLK  301

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHIL GS ++KAA+KLHEMDPLQKP+
Sbjct  302   HHPGQIEAAAIMEHILAGSSYVKAAEKLHEMDPLQKPK  339



>ref|XP_004152155.2| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 299/338 (88%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7     ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67    AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG G+   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127   KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  187   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFE  246

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  247   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  306

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/343 (80%), Positives = 299/343 (87%), Gaps = 11/343 (3%)
 Frame = +2

Query  212   NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9     NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69    IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK
Sbjct  129   GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITK  188

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
              LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L   EAF LAGV 
Sbjct  189   FLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQVLNPTEAFNLAGVT  248

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL
Sbjct  249   SGFFELQPKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHL  308

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  309   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  351



>ref|XP_011657651.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis sativus]
 gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/323 (85%), Positives = 298/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD+ V VELSE
Sbjct  17    DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDSDVIVELSE  76

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77    SARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITASG
Sbjct  137   AESDHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASG  196

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG++  A+EAF+ AG+  GFFELQPKEGLALVNGTAV
Sbjct  197   DLVPLSYIAGLLTGRPNSKAVGPNGESFDAKEAFQQAGIPSGFFELQPKEGLALVNGTAV  256

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  257   GSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  316

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  317   LDGSSYMKTAKKLHEMDPLQKPK  339



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/348 (80%), Positives = 308/348 (89%), Gaps = 15/348 (4%)
 Frame = +2

Query  209   ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3     QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  359   LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  529
             LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63    LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  530   RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  703
             RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  123   RRTKNGGALQKELIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  182

Query  704   EAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFK  883
             EAITKL+N NITPCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGPNG+ L AEEA +
Sbjct  183   EAITKLINSNITPCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNAEEALR  242

Query  884   LAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPE  1063
             +AGV+ GFFELQPKEGLALVNGTAV SGMAS+V+FE+NILAV+SEVLSAIFAEVM+GKPE
Sbjct  243   VAGVSGGFFELQPKEGLALVNGTAVASGMASIVVFESNILAVMSEVLSAIFAEVMNGKPE  302

Query  1064  FTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             FTD+L HKLKHHPGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  303   FTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  350



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/332 (81%), Positives = 302/332 (91%), Gaps = 2/332 (1%)
 Frame = +2

Query  218   HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  397
              S++ CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D
Sbjct  4     ESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHD  63

Query  398   NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  577
             + VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  64    SGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIRF  123

Query  578   LNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLP  751
             LNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK LN+N+TPCLP
Sbjct  124   LNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFLNNNVTPCLP  183

Query  752   LRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEG  931
             LRGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ L+A EAF+  G+N GFFELQPKEG
Sbjct  184   LRGTITASGDLVPLSYIAGMLTGRPNSKAVGPDGQTLSAAEAFEFVGINSGFFELQPKEG  243

Query  932   LALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQI  1111
             LALVNGTAVGSG+AS VLF+ NILA+LSE+LSAIFAEVM GKPEFTDHL HKLKHHPGQI
Sbjct  244   LALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQI  303

Query  1112  EAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  304   EAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  335



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 305/340 (90%), Gaps = 6/340 (2%)
 Frame = +2

Query  206   IENGHSNDFCI----KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6     LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66    VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILE+ITKLLN
Sbjct  126   LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILESITKLLN  185

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ LTA++AF+LA +N  F
Sbjct  186   NNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEVLTAKQAFELANINSEF  245

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             +ELQPKEGLALVNGTAVGSGMAS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HK
Sbjct  246   YELQPKEGLALVNGTAVGSGMASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHK  305

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  306   LKHHPGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  345



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/338 (81%), Positives = 301/338 (89%), Gaps = 6/338 (2%)
 Frame = +2

Query  200   GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18    GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74    AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  134   KELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLNSN  193

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TP LPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+L G++ GFFE
Sbjct  194   VTPXLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGQTLNASEAFELVGIDSGFFE  253

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  254   LQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHKLK  313

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  314   HHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  351



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/342 (82%), Positives = 305/342 (89%), Gaps = 8/342 (2%)
 Frame = +2

Query  200   GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6     GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  365   VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66    ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  542   NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  126   QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  185

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN NITPCLPLRGTIT   D+VPLSYIAGLLTGRPNSKAVGP G  L+ EEAFKLAGV  
Sbjct  186   LNQNITPCLPLRGTITX--DLVPLSYIAGLLTGRPNSKAVGPTGVILSPEEAFKLAGVEG  243

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVL+EV+SAIFAEVM GKPEFTDHL 
Sbjct  244   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLT  303

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  304   HKLKHHPGQIEAAAIMEHILDGSAYVKAAQKLHEMDPLQKPK  345



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/339 (82%), Positives = 308/339 (91%), Gaps = 7/339 (2%)
 Frame = +2

Query  209   ENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             +NGH N      C   DPLNW +AA+S+ GSHLDEVK+MVAEFR P VK+GG+TLTVAQV
Sbjct  6     QNGHQNGSLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGETLTVAQV  65

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIA R++ ++VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G AL
Sbjct  66    AAIA-RESGLQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  557   QQELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG  T + HTL HSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH
Sbjct  125   QRELIRFLNAGIFGNKTESCHTLSHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  184

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L A++AF  AG++ GFF
Sbjct  185   NITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDAQQAFHSAGIDSGFF  244

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSEVLSAIFAEVM+GKPEFTDHL HKL
Sbjct  245   ELQPKEGLALVNGTAVGSGLASMVLFEANVLAVLSEVLSAIFAEVMNGKPEFTDHLTHKL  304

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  305   KHHPGQIEAAAIMEHILDGSSYIKAAKKLHEIDPLQKPK  343



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/324 (85%), Positives = 301/324 (93%), Gaps = 2/324 (1%)
 Frame = +2

Query  242   VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  421
             VDPLNW +AA+SL+GSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29    VDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  422   EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  601
             E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89    EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  602   G--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITAS  775
             G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN+TPCLPLRGTITAS
Sbjct  149   GIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITAS  208

Query  776   GDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTA  955
             GD+VPLSYIAGLLTGRPNSKAVGPN + L A+EAF +AG+N GFF LQPKEGLALVNGTA
Sbjct  209   GDLVPLSYIAGLLTGRPNSKAVGPNEEPLDAQEAFHVAGINSGFFVLQPKEGLALVNGTA  268

Query  956   VGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEH  1135
             VGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEH
Sbjct  269   VGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEH  328

Query  1136  ILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IL+GS ++KAA+KLHEMDPLQKP+
Sbjct  329   ILEGSSYVKAAKKLHEMDPLQKPK  352



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/341 (79%), Positives = 305/341 (89%), Gaps = 8/341 (2%)
 Frame = +2

Query  209   ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8     QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA  D+ VKVELSE A+AGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68    QVAAIATHDSGVKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  551   ALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAMLVRINTLLQGYSGIRFEILE ITK L
Sbjct  128   ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFL  187

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAG+LTGRPNSKAVGP+GQ L+A EAF+  G+N G
Sbjct  188   NNNVTPCLPLRGTITASGDLVPLSYIAGMLTGRPNSKAVGPDGQTLSAAEAFEFVGINSG  247

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS VLF+ NILA+LSE+LSAIFAEVM GKPEFTDHL H
Sbjct  248   FFELQPKEGLALVNGTAVGSGLASTVLFDTNILALLSEILSAIFAEVMQGKPEFTDHLTH  307

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  308   KLKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  348



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/345 (81%), Positives = 307/345 (89%), Gaps = 12/345 (3%)
 Frame = +2

Query  209   ENGHSN-----DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             +NGH N     D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+V
Sbjct  7     QNGHINGEVAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSV  66

Query  368   AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             AQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRT
Sbjct  67    AQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRT  126

Query  539   KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             KNG ALQ+ELIRFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  127   KNGGALQKELIRFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  186

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TKL+N NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAV PNG+ L AEEAF +AG
Sbjct  187   TKLINSNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVRPNGEKLNAEEAFCVAG  246

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             ++ GFFELQPKEGLALVNGTAVGS MAS+VLFE+NILAV+SEVLSAIFAEVM+GKPEFTD
Sbjct  247   ISSGFFELQPKEGLALVNGTAVGSAMASIVLFESNILAVMSEVLSAIFAEVMNGKPEFTD  306

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +L HKLKHHPGQIEAAAIMEHILDGS ++K AQKLHEMDPL+KP+
Sbjct  307   YLTHKLKHHPGQIEAAAIMEHILDGSSYVKVAQKLHEMDPLKKPK  351



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/323 (85%), Positives = 296/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20    DPLNWGMVAESLKGSHLDEVKRMINEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSA+RAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESTHTLPHSASRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L A EAF LAG+N GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGETLAAAEAFTLAGINGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             L+GS ++KAAQKLHE+DPLQKP+
Sbjct  320   LNGSSYVKAAQKLHEIDPLQKPK  342



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 297/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32    DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92    EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSATRA+MLVRINTLLQGYSGIRFEILEAITKL+NHNITPCLPLRGTI+ASG
Sbjct  152   TESCHTLPHSATRASMLVRINTLLQGYSGIRFEILEAITKLINHNITPCLPLRGTISASG  211

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLL GR + KAVGPNG+ L+AEEAF++AG+  GFFELQPKEGLALVNGTAV
Sbjct  212   DLVPLSYIAGLLLGRSSCKAVGPNGEPLSAEEAFRVAGIKGGFFELQPKEGLALVNGTAV  271

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  272   GSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  331

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQKLHEMDPLQKP+
Sbjct  332   LDGSSYIKAAQKLHEMDPLQKPK  354



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/328 (83%), Positives = 299/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIQSGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEV SAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVSSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/340 (81%), Positives = 304/340 (89%), Gaps = 2/340 (1%)
 Frame = +2

Query  194   MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             ME    NG S + C   DPLNW +AA+ LKGSHLDEVKRMV EFR P VK GG++LT+AQ
Sbjct  1     MEYCNGNGSSVNSCKSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLVKPGGKSLTIAQ  60

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIA++D A+KVEL+E ARAGVKASSDWVM SM+ G DSYGVTTGFGATSHRRTK G A
Sbjct  61    VAAIASQDGAIKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGFGATSHRRTKQGGA  120

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEI+EAITK LN
Sbjct  121   LQRELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLN  180

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG++L A +AF+LAG++ GF
Sbjct  181   HNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLDATKAFELAGIDGGF  240

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+ASMVLFEAN+ AV +EVLSAIFAEVM GKPEFTDHL HK
Sbjct  241   FELQPKEGLALVNGTAVGSGLASMVLFEANVQAVFAEVLSAIFAEVMQGKPEFTDHLTHK  300

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  301   LKHHPGQIEAAAIMEHILDGSAYIKAAQKLHEIDPLQKPK  340



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/344 (82%), Positives = 307/344 (89%), Gaps = 7/344 (2%)
 Frame = +2

Query  194   MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  361
             MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1     MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  362   TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  541
             T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60    TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  542   NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  715
              G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT
Sbjct  120   QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAIT  179

Query  716   KLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGV  895
             KLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LAG+
Sbjct  180   KLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFQLAGI  239

Query  896   NDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDH  1075
                FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDH
Sbjct  240   GSDFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLSEVMSAIFAEVMQGKPEFTDH  299

Query  1076  LIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             L HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  300   LTHKLKHHPGQIEAAAIMEHILDGSAYVKAAKKLHETDPLQKPK  343



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/340 (80%), Positives = 299/340 (88%), Gaps = 7/340 (2%)
 Frame = +2

Query  209   ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11    QNGHQNGVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71    VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINT LQGYSGIRFEILEAITK LN
Sbjct  131   LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTFLQGYSGIRFEILEAITKFLN  190

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP GQ L+A EAF+L G+N GF
Sbjct  191   NNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQTLSASEAFELVGINCGF  250

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HK
Sbjct  251   FELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHK  310

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAA+KLH  DPLQKP+
Sbjct  311   LKHHPGQIEAAAIMEHILDGSSYVKAAKKLHGQDPLQKPK  350



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/336 (83%), Positives = 304/336 (90%), Gaps = 5/336 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG  N+ CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  8     NGVVNELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  66

Query  392   RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  565
              +++  VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  67    ANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  126

Query  566   LIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNIT  739
             LIRFLNAGIFG GT   HTLPHSATRAAM+VRINTLLQGYSGIRFEILEAITK LN+NIT
Sbjct  127   LIRFLNAGIFGNGTETSHTLPHSATRAAMIVRINTLLQGYSGIRFEILEAITKFLNNNIT  186

Query  740   PCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQ  919
             PCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L AE+AF  AGV  GFFELQ
Sbjct  187   PCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGEVLNAEKAFAAAGVEGGFFELQ  246

Query  920   PKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHH  1099
             PKEGLALVNGTAVGSGMASMVLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHH
Sbjct  247   PKEGLALVNGTAVGSGMASMVLFDANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHH  306

Query  1100  PGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  307   PGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  342



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/343 (80%), Positives = 304/343 (89%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTLT+
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/330 (84%), Positives = 300/330 (91%), Gaps = 4/330 (1%)
 Frame = +2

Query  224   NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  403
             N  C++ DPLNW MAA++L GSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIAA   +
Sbjct  12    NGLCMQKDPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQLGGETLTVSQVAAIAA--GS  69

Query  404   VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  583
             VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLN
Sbjct  70    VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLN  129

Query  584   AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  757
             AGIFG+G  + + LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN NITPCLPLR
Sbjct  130   AGIFGSGNDSSNILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNITPCLPLR  189

Query  758   GTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLA  937
             GTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTA EAFKLAGV+ GFFELQPKEGLA
Sbjct  190   GTITASGDLVPLSYIAGLLTGRPNSKAVGPTGENLTAAEAFKLAGVDGGFFELQPKEGLA  249

Query  938   LVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEA  1117
             LVNGTAVGSGMASMVLFE NILAVL+EV+SAIFAEVM GKPEFTDHL HKLKHHPGQIEA
Sbjct  250   LVNGTAVGSGMASMVLFETNILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEA  309

Query  1118  AAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AAIMEHILDGS ++KAA+K HEMDPLQKP+
Sbjct  310   AAIMEHILDGSSYVKAAEKQHEMDPLQKPK  339



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 297/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  17    DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  76

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77    SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITASG
Sbjct  137   AESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASG  196

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA+GPNG+   A+EAF+ AG+  GFFELQPKEGLALVNGTAV
Sbjct  197   DLVPLSYIAGLLTGRPNSKAIGPNGENFDAKEAFQQAGIPSGFFELQPKEGLALVNGTAV  256

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  257   GSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  316

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  317   LDGSSYMKTAKKLHEMDPLQKPK  339



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPLVRLGGETLTISQVAAIAGREGDVS  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYI+GLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYISGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHE+DPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEIDPLQKPK  341



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 299/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVN  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/349 (79%), Positives = 308/349 (88%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  346
             M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1     MAAITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  347   GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61    GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G++L AEEAF
Sbjct  181   LEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             ++AG++ GFF LQPKEGLALVNGTAVGSG+ASMVLFEAN+LAVLSE+LSA+FAEVM+GKP
Sbjct  241   RVAGIDSGFFMLQPKEGLALVNGTAVGSGLASMVLFEANVLAVLSEILSAVFAEVMNGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  301   EFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  349



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/338 (82%), Positives = 306/338 (91%), Gaps = 6/338 (2%)
 Frame = +2

Query  212   NGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             NGH   +N FC+K  DPLNW  AA+SLKGSHL+EVKRMV EFR P VK+GG+TLT++QVA
Sbjct  10    NGHNNGANGFCVKQNDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGETLTISQVA  69

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  70    AIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQ  129

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAGIFG  T   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN N
Sbjct  130   KELIRFLNAGIFGNATESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQN  189

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTAE+AFKLAGV  GFF+
Sbjct  190   VTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEPLTAEQAFKLAGVTGGFFD  249

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+ LF+AN+LAVLS V+S +FAEVM+GKPEFTDHL HKLK
Sbjct  250   LQPKEGLALVNGTAVGSGLASIALFDANVLAVLSVVMSPVFAEVMNGKPEFTDHLTHKLK  309

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  310   HHPGQIEAAAIMEHILDGSGYVKAAQKLHEIDPLQKPK  347



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 299/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHS TRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSTTRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/343 (80%), Positives = 306/343 (89%), Gaps = 10/343 (3%)
 Frame = +2

Query  209   ENGHSN--DFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             E+G+ N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3     ESGYQNGVEFCIGARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63    ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQRELIRFLNAGVFGRGTESSHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG++L A+EAFK AG+ 
Sbjct  183   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQAGIP  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+AS+VLFEANILAVL+E++SAIFAEVM GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASIVLFEANILAVLAEIMSAIFAEVMQGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  345



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/342 (83%), Positives = 312/342 (91%), Gaps = 4/342 (1%)
 Frame = +2

Query  194   MEGAIENGH-SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             M  A+ENGH SN  C+K  DPLNW  AADSLKGSHLDEVK+MV EFR   VK+GG+TLT+
Sbjct  1     MAPAVENGHFSNGLCVKQSDPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGETLTI  60

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAAIAARDNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  61    AQVAAIAARDNAVAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQG  120

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK 
Sbjct  121   GALQKELIRFLNAGIFGKGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKF  180

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L +EEAFKLAGV  
Sbjct  181   LNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEDLNSEEAFKLAGVTG  240

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+AS+ L+EAN+L++L+EV+SAIFAEVM+GKPEFTDHL 
Sbjct  241   GFFELQPKEGLALVNGTAVGSGLASIALYEANVLSLLAEVMSAIFAEVMNGKPEFTDHLT  300

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDG+ ++KAAQK+HEMDPLQKP+
Sbjct  301   HKLKHHPGQIEAAAIMEHILDGNSYVKAAQKMHEMDPLQKPK  342



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/343 (80%), Positives = 303/343 (88%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTLT+
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  345



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/334 (83%), Positives = 301/334 (90%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  397
             D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2     DLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  398   --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
               N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62    KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  572   RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NITPC
Sbjct  122   RFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPC  181

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF +AG++ GFFELQPK
Sbjct  182   LPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCVAGISGGFFELQPK  241

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGS MAS+VLFE+NI AV+SEVLSAIF EVM+GKPEFTD+L HKLKHHPG
Sbjct  242   EGLALVNGTAVGSAMASIVLFESNIFAVMSEVLSAIFTEVMNGKPEFTDYLTHKLKHHPG  301

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  302   QIEAAAIMEHILDGSSYVKVAQKLHEMDPLQKPK  335



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/340 (80%), Positives = 299/340 (88%), Gaps = 7/340 (2%)
 Frame = +2

Query  209   ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             +NGH N       CIK  PLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11    QNGHQNGVSESPLCIKKAPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGV TGFGATSHRRT  G A
Sbjct  71    VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVPTGFGATSHRRTNKGAA  130

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  131   LQKELIRFLNAGVFGSATESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  190

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             +N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP GQ L+A EAF+L G+N GF
Sbjct  191   NNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTGQTLSASEAFELVGINCGF  250

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS VLFE NILA+L+E+LSAIFAEVM GKPEFTDHL HK
Sbjct  251   FELQPKEGLALVNGTAVGSGLASTVLFETNILALLAEILSAIFAEVMQGKPEFTDHLTHK  310

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  311   LKHHPGQIEAAAIMEHILDGSSYVKAAKKLHEQDPLQKPK  350



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/340 (83%), Positives = 303/340 (89%), Gaps = 8/340 (2%)
 Frame = +2

Query  212   NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGHS+ +FCIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9     NGHSSQEFCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  377   AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAIA R    VKVELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69    AAIAGRSGTEVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  129   LQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  188

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
              NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A ++F+ AG+  GF
Sbjct  189   SNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLDAVQSFQRAGIETGF  248

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HK
Sbjct  249   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHK  308

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++K A+K+HE+DPLQKP+
Sbjct  309   LKHHPGQIEAAAIMEHILDGSSYVKEAKKIHEVDPLQKPK  348



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/324 (84%), Positives = 300/324 (93%), Gaps = 2/324 (1%)
 Frame = +2

Query  242   VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  421
             VDPLNW +AA SL+GSHLDEVKRMVAE+R   VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29    VDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  422   EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  601
             E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89    EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  602   G--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITAS  775
             G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN+TPCLPLRGTITAS
Sbjct  149   GIESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNVTPCLPLRGTITAS  208

Query  776   GDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTA  955
             GD+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF +AG++ GFF LQPKEGLALVNGTA
Sbjct  209   GDLVPLSYIAGLLTGRPNSKAVGPNGEPLDAQEAFHVAGIDSGFFVLQPKEGLALVNGTA  268

Query  956   VGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEH  1135
             VGSG+ASMVLFEANILAVLSE+LSAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEH
Sbjct  269   VGSGLASMVLFEANILAVLSEILSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEH  328

Query  1136  ILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IL+GS ++KAA+KLHEMDPLQKP+
Sbjct  329   ILEGSSYVKAAKKLHEMDPLQKPK  352



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/346 (80%), Positives = 307/346 (89%), Gaps = 8/346 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             ME   +NGH N      CI ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1     METVTKNGHQNGSLESLCINQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  359   LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61    LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             ITKLLN+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A EAFK A
Sbjct  181   ITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPSGEVLDAVEAFKTA  240

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             G+  GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFT
Sbjct  241   GIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFT  300

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  301   DHLTHKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/338 (80%), Positives = 300/338 (89%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG S   C+   DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2     ACQNGSSESLCMNGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62    AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG G+   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  122   KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  181

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  182   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFE  241

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  242   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  301

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  302   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  339



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/343 (80%), Positives = 303/343 (88%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ LT+
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLTI  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASDVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/349 (78%), Positives = 307/349 (88%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  346
             M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1     MAAITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  347   GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61    GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G++L AEEAF
Sbjct  181   LEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPDGKSLNAEEAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             ++AG++ GFF LQPKEGLALVNGTAVGSG+ASMVLFEAN+L VLSE+LSA+FAEVM+GKP
Sbjct  241   RVAGIDSGFFMLQPKEGLALVNGTAVGSGLASMVLFEANVLVVLSEILSAVFAEVMNGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHEMDPLQKP+
Sbjct  301   EFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYVKAAKKLHEMDPLQKPK  349



>gb|AEE81750.1| phenylalanine ammonia lyase [Morus alba var. multicaulis]
Length=726

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/341 (79%), Positives = 307/341 (90%), Gaps = 2/341 (1%)
 Frame = +2

Query  191   TMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             ++EG   +  SN   +  D LNW  AA+++KGSHL+EVK+MV E+R PAV +GG+TLT++
Sbjct  17    SLEGICTSNGSNGGIVSGDALNWGAAAEAMKGSHLEEVKKMVEEYRKPAVNLGGETLTIS  76

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA++D+ VKVELSE AR GVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  77    QVAAIASQDSGVKVELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGG  136

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ TRAA+LVRINTLLQGYSGIRFEILEA+TKLL
Sbjct  137   ALQKELIRFLNAGIFGNGTESCHTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLL  196

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N N+TPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA +AFK+AG+N G
Sbjct  197   NSNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSG  256

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL H
Sbjct  257   FFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTH  316

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  317   KLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  357



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/335 (83%), Positives = 298/335 (89%), Gaps = 4/335 (1%)
 Frame = +2

Query  212   NGH-SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  388
             NG+ S  FCI  DPLNW  +A+SLKGSHLDEVKRMV EFR P V++GG+TLT+AQVAAIA
Sbjct  11    NGNGSPGFCI-TDPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTIAQVAAIA  69

Query  389   ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  568
              RD  VKVELSE AR  VKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  70    NRDAGVKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGAALQKEL  129

Query  569   IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  742
             IRFLNAG+FG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN NITP
Sbjct  130   IRFLNAGVFGQGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNVNITP  189

Query  743   CLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQP  922
             CLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+AL   EAF  AG+N GFFELQP
Sbjct  190   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGEALNPTEAFSRAGINGGFFELQP  249

Query  923   KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  1102
             KEGLALVNGTAVGSG+AS+VLFEAN+ AVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  250   KEGLALVNGTAVGSGLASLVLFEANVQAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  309

Query  1103  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  310   GQIEAAAIMEHILDGSSYIKAAQKLHEMDPLQKPK  344



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 295/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT+ QV AIA+ D+ V+VELSE
Sbjct  16    DPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAIASHDSGVRVELSE  75

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV+ASSDWVM SM NGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  76    TARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  135

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNHNITPCLPLRGTITASG
Sbjct  136   TESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNITPCLPLRGTITASG  195

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYI GLLTGRPNSKAVGPNGQ L A  AF+LAG++ GFFELQPKEGLALVNGTAV
Sbjct  196   DLVPLSYIVGLLTGRPNSKAVGPNGQVLNASAAFQLAGISSGFFELQPKEGLALVNGTAV  255

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS VLFEANILA+LSEVLSAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  256   GSGLASTVLFEANILAILSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  315

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             L GS ++KAAQKLHE+DPLQKP+
Sbjct  316   LAGSGYVKAAQKLHEIDPLQKPK  338



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 294/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+SLKGSHLDEVKRMV E R P VK+GG+TLT+ QV AIA  D+ ++VELSE
Sbjct  16    DPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAIANHDSGLRVELSE  75

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              AR GV+ASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76    AARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSATRAAMLVRINTLLQGYSGIRF+ILEAITK LNHNITPCLPLRGTITASG
Sbjct  136   TESCHTLPHSATRAAMLVRINTLLQGYSGIRFDILEAITKFLNHNITPCLPLRGTITASG  195

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNGQ L A EAF+LAG+  GFFELQPKEGLALVNGTAV
Sbjct  196   DLVPLSYIAGLLTGRPNSKAVGPNGQVLDASEAFQLAGITSGFFELQPKEGLALVNGTAV  255

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM+GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  256   GSGLASMVLFEANVLAILSEVLSAIFAEVMNGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  315

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             L GS ++KAAQKLHE+DPLQKP+
Sbjct  316   LAGSGYVKAAQKLHEIDPLQKPK  338



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/338 (81%), Positives = 299/338 (88%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7     ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67    AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG G+   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHN
Sbjct  127   KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITNLLNHN  186

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  187   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGEILDAKVAFEQAGIDSGFFE  246

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  247   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  306

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/343 (80%), Positives = 297/343 (87%), Gaps = 11/343 (3%)
 Frame = +2

Query  212   NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9     NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69    IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVR+NTLLQGYSGIRFEILE ITK
Sbjct  129   GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRVNTLLQGYSGIRFEILETITK  188

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
              LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVG NGQ L   EAF LAGV 
Sbjct  189   FLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGSNGQVLNPTEAFNLAGVT  248

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+A+ VLFEANILA++SEVLSAIFAEVM+GKPEFTDHL
Sbjct  249   SGFFELQPKEGLALVNGTAVGSGLAATVLFEANILAIMSEVLSAIFAEVMNGKPEFTDHL  308

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE DPLQKP+
Sbjct  309   THKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHETDPLQKPK  351



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 300/323 (93%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPL+W +AA+S+KGSHL+EVKRMVAE+R P VK+GG+TLT+AQVAAIAA +  V VEL E
Sbjct  13    DPLSWGVAAESMKGSHLNEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANEQGVSVELCE  72

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G
Sbjct  73    SARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNG  132

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+NITPCLPLRGT+TASG
Sbjct  133   TESTHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNITPCLPLRGTVTASG  192

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGP+G+ L A+ AF+LAG++ GFFELQPKEGLALVNGTAV
Sbjct  193   DLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKNAFQLAGIDSGFFELQPKEGLALVNGTAV  252

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLF+AN+LA+L+EVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  253   GSGLASIVLFDANVLAILAEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  312

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MKAA+KLHE+DPLQKP+
Sbjct  313   LDGSSYMKAAKKLHEVDPLQKPK  335



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/341 (82%), Positives = 302/341 (89%), Gaps = 9/341 (3%)
 Frame = +2

Query  212   NGH--SNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             NGH  S +FCIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+ Q
Sbjct  9     NGHNASQEFCIKGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVRLGGETLTIGQ  68

Query  374   VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             VAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G 
Sbjct  69    VAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGA  128

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  129   ALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  188

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A +AF+ AG++ G
Sbjct  189   NNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAVKAFQWAGIDTG  248

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLA+VNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL H
Sbjct  249   FFELQPKEGLAMVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTH  308

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  309   KLKHHPGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  349



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/346 (82%), Positives = 302/346 (87%), Gaps = 13/346 (4%)
 Frame = +2

Query  206   IENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             +ENGH N       C+K DPLNW +AA+ +KGSHLDEVKRMVAEFRNP VK+GG+ LT++
Sbjct  1     MENGHRNGGXVSXLCVK-DPLNWGVAAEGMKGSHLDEVKRMVAEFRNPVVKLGGEGLTIS  59

Query  371   QVAAIAA-----RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             QVAAIA+         VKVEL EGAR  VKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  60    QVAAIASAGGGETSAGVKVELWEGARERVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  119

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAMLVRINTLLQGYSG RFEILEA
Sbjct  120   TKQGGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGXRFEILEA  179

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             ITK LNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ LTAE AF LA
Sbjct  180   ITKFLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPAGEILTAEAAFGLA  239

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             GV  GFFELQPKEGLALVNGTAVGSGMASMVLFEANILA+LSEVLSAIFAEVM GKPEFT
Sbjct  240   GVTGGFFELQPKEGLALVNGTAVGSGMASMVLFEANILALLSEVLSAIFAEVMQGKPEFT  299

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  300   DHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAEKLHEMDPLQKPK  345



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/334 (81%), Positives = 302/334 (90%), Gaps = 2/334 (1%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG  +  C+K DPLNW +AA+SL+GSHLDEVKRMV EF  P VK+ GQ+LT++QVAA+A 
Sbjct  14    NGSIDGLCMKSDPLNWGLAAESLQGSHLDEVKRMVNEFHKPIVKLEGQSLTISQVAAVAM  73

Query  392   RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
             R + ++VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  74    RADGIEVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQKELI  133

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG GT   HTLP +ATRAAMLVRINTLLQGYSGIRFEI+EAITK LN+NITPC
Sbjct  134   RFLNAGVFGNGTESTHTLPQTATRAAMLVRINTLLQGYSGIRFEIMEAITKFLNNNITPC  193

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAG+LTGRPNSKAVGP G+ALTA+EAF LAG+  GFFELQPK
Sbjct  194   LPLRGTITASGDLVPLSYIAGILTGRPNSKAVGPKGEALTAQEAFNLAGIETGFFELQPK  253

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSG+ASMVLF+ANILA+LSEV+SAIFAEVM GKPEFTDHL HKLKHHPG
Sbjct  254   EGLALVNGTAVGSGLASMVLFDANILALLSEVISAIFAEVMQGKPEFTDHLTHKLKHHPG  313

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++K+AQKLHE DPLQKP+
Sbjct  314   QIEAAAIMEHILDGSSYVKSAQKLHETDPLQKPK  347



>gb|AHA42443.1| phenylalanine ammonia lyase [Cannabis sativa]
Length=707

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/328 (83%), Positives = 300/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12    FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71    VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  590   IFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG GT   HTLPHS+TRA +LVRINTLLQGYSGIRFEILEA+ KLLN+N+TPCLPLRGT
Sbjct  131   IFGHGTESCHTLPHSSTRAGLLVRINTLLQGYSGIRFEILEAMAKLLNNNVTPCLPLRGT  190

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             ITASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA+EAFK+A +N  FFELQPKEGLALV
Sbjct  191   ITASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTAKEAFKVADINSSFFELQPKEGLALV  250

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+AS VLFEANILAVL+EVLSAIFAEV+ GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  251   NGTAVGSGVASTVLFEANILAVLAEVLSAIFAEVIQGKPEFTDHLTHKLKHHPGQIEAAA  310

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  311   IMEHILDGSSYVKEAKKLHEMDPLQKPK  338



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 310/349 (89%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  346
             MEG   NGH SN     +FCI     DPLNW +AA+++KGSHLDEVKRMV ++RNP VKI
Sbjct  1     MEGEGANGHVSNNVTEAEFCITKTGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVVKI  60

Query  347   GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             GG+TLTVAQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61    GGETLTVAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLN+NITPCLPLRGTITASGD+ PLSYIAGLLTGRPNSKAVGP+G+ L A+EAF
Sbjct  181   LEAITKLLNNNITPCLPLRGTITASGDLAPLSYIAGLLTGRPNSKAVGPSGEILNAKEAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             +LA ++  FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVL+EV+SAIFAEVM GKP
Sbjct  241   ELANIDSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLAEVMSAIFAEVMQGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HKLKHHPGQIEAAAIMEHILDGS ++ AA+KLH++DPLQKP+
Sbjct  301   EFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVLAAKKLHDVDPLQKPK  349



>gb|AID16077.1| phenylalanine ammonium lyase [Morus alba]
Length=726

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/341 (79%), Positives = 306/341 (90%), Gaps = 2/341 (1%)
 Frame = +2

Query  191   TMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             ++EG   +  +N   +  D LNW  AA+++KGSHL+EVKRMV E+R PAV +GG+TLT++
Sbjct  17    SLEGICTSSGNNGGIVSGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNLGGETLTIS  76

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA++D  VKVELSE AR GVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  77    QVAAIASQDGGVKVELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGG  136

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ TRAA+LVRINTLLQGYSGIRFEILEA+TKLL
Sbjct  137   ALQKELIRFLNAGIFGNGTESCHTLPHTTTRAALLVRINTLLQGYSGIRFEILEAMTKLL  196

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N N+TPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA +AFK+AG+N G
Sbjct  197   NGNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSG  256

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL H
Sbjct  257   FFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTH  316

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  317   KLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEIDPLQKPK  357



>ref|XP_002267953.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 297/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  19    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVSVELSE  78

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79    TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  138

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP+SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TASG
Sbjct  139   TESCHTLPYSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASG  198

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALVNGTAV
Sbjct  199   DLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAV  258

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  259   GSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  318

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K A+KLHEMDPLQKP+
Sbjct  319   LDGSSYVKEAKKLHEMDPLQKPK  341



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/341 (80%), Positives = 304/341 (89%), Gaps = 7/341 (2%)
 Frame = +2

Query  206   IENGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             + NG+ N  FC       DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6     LTNGNQNGSFCFTSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVA ++A D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66    QVAGVSAHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLL
Sbjct  126   ALQKELIRFLNAGIFGNGTESCHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLL  185

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A++AF+ A +N  
Sbjct  186   NNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGELLNAKQAFQSANINSD  245

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+AS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL H
Sbjct  246   FFELQPKEGLALVNGTAVGSGLASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTH  305

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS +MK A+KLHE+DPLQKP+
Sbjct  306   KLKHHPGQIEAAAIMEHILDGSSYMKDAKKLHEIDPLQKPK  346



>emb|CAN77065.1| hypothetical protein VITISV_009233 [Vitis vinifera]
Length=707

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 296/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  16    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREXDVSVELSE  75

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76    TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TASG
Sbjct  136   TESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASG  195

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYI GLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALVNGTAV
Sbjct  196   DLVPLSYIXGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAV  255

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  256   GSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  315

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K A+KLHEMDPLQKP+
Sbjct  316   LDGSSYVKEAKKLHEMDPLQKPK  338



>ref|XP_008449236.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=705

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 294/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14    DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDIDVTVELSE  73

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  74    SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  133

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTL  SATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG
Sbjct  134   VESSHTLSRSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  193

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPN ++L A EAF+ AG+  GFFELQPKEGLALVNGTAV
Sbjct  194   DLVPLSYIAGLLTGRPNSKAVGPNEESLDANEAFQRAGIPSGFFELQPKEGLALVNGTAV  253

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLFEANILA+LSE+LSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  254   GSGLASIVLFEANILAILSEILSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  313

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  314   LDGSSYMKTAKKLHEMDPLQKPK  336



>gb|ABI93975.1| putative phenylalanine ammonia-lyase, partial [Rhizophora mangle]
Length=579

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 304/340 (89%), Gaps = 7/340 (2%)
 Frame = +2

Query  209   ENGHSNDFCI----KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             +NG  +  C     + DPLNW +AA+SLKGSHLDEVKRMVAE+R   VK+GG+TLT+AQV
Sbjct  10    QNGSLDSLCTTKPPRHDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTIAQV  69

Query  377   AAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAI+   D+ + VEL+E ARAGVKASSDWVM+ M  GTDSYGVTTGFGATSHRRTK G A
Sbjct  70    AAISRGVDSGITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTKQGSA  129

Query  554   LQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  130   LQRELIRFLNAGIFGHGTDSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  189

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD++PLSYIAGLLTGRPNSKA+GP+GQ+L A EAF+LAG+  GF
Sbjct  190   HNITPCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGF  249

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+ASMVLFEANILAVL+E+LSAIFAEVM+GKPEFTDHL HK
Sbjct  250   FELQPKEGLALVNGTAVGSGLASMVLFEANILAVLAEMLSAIFAEVMNGKPEFTDHLTHK  309

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS +MK A+++HEMDPLQKP+
Sbjct  310   LKHHPGQIEAAAIMEHILDGSSYMKEAKRIHEMDPLQKPK  349



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/332 (82%), Positives = 295/332 (89%), Gaps = 6/332 (2%)
 Frame = +2

Query  230   FCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  397
             FC       DPLNW M ADSLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA RD
Sbjct  19    FCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLTIAQVTAIANRD  78

Query  398   NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  577
               +KVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  79    AGIKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRF  138

Query  578   LNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLP  751
             LNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NHN+TP LP
Sbjct  139   LNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNVTPSLP  198

Query  752   LRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEG  931
             LRGTITASGD+VPLSYIAGLL GRPNSK VGPNG++L   EAF LAG+N GFF+LQPKEG
Sbjct  199   LRGTITASGDLVPLSYIAGLLIGRPNSKCVGPNGESLDPTEAFTLAGINSGFFDLQPKEG  258

Query  932   LALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQI  1111
             LALVNGTAVGSG+ASMVLFEAN+L +LSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQI
Sbjct  259   LALVNGTAVGSGLASMVLFEANVLGILSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQI  318

Query  1112  EAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  319   EAAAIMEHILDGSSYIKAAQKLHEVDPLQKPK  350



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 309/349 (89%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  346
             MEG   NGH SN     ++CI     DPLNW +AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1     MEGEGANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  347   GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61    GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF
Sbjct  181   LEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             +LA +   FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVL+EV+SAIFAEVM GKP
Sbjct  241   QLANIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLAEVMSAIFAEVMQGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HK KHHPGQIEAAAIMEHILDGS ++ AA+KLH++DPLQKP+
Sbjct  301   EFTDHLTHKQKHHPGQIEAAAIMEHILDGSSYVLAAKKLHDVDPLQKPK  349



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/348 (80%), Positives = 307/348 (88%), Gaps = 15/348 (4%)
 Frame = +2

Query  209   ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+ G+T
Sbjct  7     QNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLEGET  66

Query  359   LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  529
             LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFG TSH
Sbjct  67    LTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  126

Query  530   RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  703
             RRTKNG+ALQ++LIRFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEIL
Sbjct  127   RRTKNGNALQKDLIRFLNAGVFGNGTELSHTLPHSATRAAMLVRINTLLQGYSGIRFEIL  186

Query  704   EAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFK  883
             EAITKL+N NITPCLPLRG+ITASGD+VPLSYI GLLTGRPNSKAVGPNG+ L AEEA +
Sbjct  187   EAITKLINSNITPCLPLRGSITASGDLVPLSYIVGLLTGRPNSKAVGPNGEKLNAEEALR  246

Query  884   LAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPE  1063
             +AGV+ GFFELQPKEGLALVNGTAV SGMAS+V+FE+NILAV+SEVLSAIFAEVM+GKPE
Sbjct  247   VAGVSGGFFELQPKEGLALVNGTAVASGMASIVVFESNILAVMSEVLSAIFAEVMNGKPE  306

Query  1064  FTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             FTD+L HKLKHHPGQIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  307   FTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAQKLHEMDPLQKPK  354



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/346 (79%), Positives = 306/346 (88%), Gaps = 8/346 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             ME   +NG+ N      C+ ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1     METVTKNGYQNGSLESLCVNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  359   LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61    LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             IT+LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP G+ L A EAFK A
Sbjct  181   ITRLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAA  240

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             G+  GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFT
Sbjct  241   GIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFT  300

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  301   DHLTHKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/334 (82%), Positives = 300/334 (90%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  397
             D C K   DPLNWEMAADSL+ SHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2     DLCKKSINDPLNWEMAADSLRQSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  398   --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
               N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62    KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  572   RFLNAGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NITPC
Sbjct  122   RFLNAGVFGNGIESFHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPC  181

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGPNG+ L AEEAF +AG++ GFFELQPK
Sbjct  182   LPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPNGEKLNAEEAFCVAGISGGFFELQPK  241

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGS MAS+VLFE+NI AV+SEVLSAIF EVM+GKPEFTD+L HKLKHHPG
Sbjct  242   EGLALVNGTAVGSAMASIVLFESNIFAVMSEVLSAIFTEVMNGKPEFTDYLTHKLKHHPG  301

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++K AQKLHEMDPLQKP+
Sbjct  302   QIEAAAIMEHILDGSSYVKVAQKLHEMDPLQKPK  335



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1 [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/343 (80%), Positives = 303/343 (88%), Gaps = 10/343 (3%)
 Frame = +2

Query  209   ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  364
             E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3     ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  365   VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63    ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAG+FG GT   HTLPH ATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLNHN+TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG++L A+EAFK A + 
Sbjct  183   LLNHNVTPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKAIGPNGESLDAKEAFKQASIP  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+AS+VLFEANILAVL+E++SAIFAEVM GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASIVLFEANILAVLAEIMSAIFAEVMQGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  345



>ref|XP_012093279.1| PREDICTED: phenylalanine ammonia-lyase G2B [Jatropha curcas]
 gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 294/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW   A+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+AQV AIA RD  VKVELSE
Sbjct  21    DPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIAQVTAIANRDAGVKVELSE  80

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  81    AARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  140

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK +NHNITPCLPLRGTITASG
Sbjct  141   TETCHILPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFINHNITPCLPLRGTITASG  200

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLL GRPNSK+VGPNG++L   EAF+LAG++ GFFELQPKEGLALVNGTAV
Sbjct  201   DLVPLSYIAGLLIGRPNSKSVGPNGESLDPSEAFELAGIDSGFFELQPKEGLALVNGTAV  260

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+L+EVLS IFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  261   GSGLASMVLFEANVLAILAEVLSGIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  320

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAA+KLHE+DPLQKP+
Sbjct  321   LDGSAYVKAAKKLHELDPLQKPK  343



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/340 (82%), Positives = 301/340 (89%), Gaps = 8/340 (2%)
 Frame = +2

Query  212   NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             NGHS+ + CIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9     NGHSDQELCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  377   AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAIA R    V VELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69    AAIAGRSGTEVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  129   LQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  188

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
              NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A +AF+ AG+  GF
Sbjct  189   SNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPDGELLDAVQAFQRAGIETGF  248

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSA+FAEVM GKPEFTDHL HK
Sbjct  249   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSALFAEVMQGKPEFTDHLTHK  308

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++K A+K+HE+DPLQKP+
Sbjct  309   LKHHPGQIEAAAIMEHILDGSSYVKEAKKIHEVDPLQKPK  348



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/343 (80%), Positives = 302/343 (88%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTLT+
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGI FEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGICFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIE AAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIETAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 308/349 (88%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  346
             MEG   NGH SN     +FCI     DPLNW  AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1     MEGEGANGHVSNHATEAEFCISKTGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  347   GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61    GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRT+ G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTRQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLN+NIT CLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF
Sbjct  181   LEAITKLLNNNITSCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             +LA +   FFELQPKEGLALVNGTAVGSG+AS+VLFEAN+LAVL+EV+SAIFAEVM GKP
Sbjct  241   QLANIGSEFFELQPKEGLALVNGTAVGSGLASIVLFEANVLAVLAEVMSAIFAEVMQGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HKLKHHPGQIEAAAIMEHILDGS ++ AA+KLH++DPLQKP+
Sbjct  301   EFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVLAAKKLHDVDPLQKPK  349



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/342 (82%), Positives = 302/342 (88%), Gaps = 10/342 (3%)
 Frame = +2

Query  212   NGHSN---DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             NGH+N   + CIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+A
Sbjct  9     NGHNNASQELCIKGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVQLGGETLTIA  68

Query  371   QVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             QVAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G
Sbjct  69    QVAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQG  128

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL
Sbjct  129   AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  188

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA G NG+ L A  AF+LAG++ 
Sbjct  189   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGANGELLDAVMAFQLAGIDT  248

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL 
Sbjct  249   GFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLT  308

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++K A+K+HEMDPLQKP+
Sbjct  309   HKLKHHPGQIEAAAIMEHILDGSSYVKEAKKIHEMDPLQKPK  350



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/334 (83%), Positives = 301/334 (90%), Gaps = 5/334 (1%)
 Frame = +2

Query  218   HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  397
             H +D CIK D LNW +AA++L GSHLDEVK+MVAEFRNP VKIGG+TLTV+QVA IAA  
Sbjct  25    HVHDLCIK-DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQVAGIAAAS  83

Query  398   NA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
             ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  84    DSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELI  143

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N+TPC
Sbjct  144   RFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNVTPC  203

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGTITASGD+VPLSYIAGLLTGR NSKAVGP G+ L AE+AF  AGV  GFFELQPK
Sbjct  204   LPLRGTITASGDLVPLSYIAGLLTGRSNSKAVGPTGEILNAEQAFAKAGVEGGFFELQPK  263

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPG
Sbjct  264   EGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPG  323

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  324   QIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  357



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/345 (79%), Positives = 301/345 (87%), Gaps = 7/345 (2%)
 Frame = +2

Query  194   MEGAIENGH-----SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             ME + EN       S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+T
Sbjct  1     MEASHENQSGGNIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGET  60

Query  359   LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             LT+AQVAA+A+RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRT
Sbjct  61    LTIAQVAAVASRDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRT  120

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             K G ALQ+ELIRFLNAGIFG GT   H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  121   KQGAALQKELIRFLNAGIFGKGTESCHMLPHTATRAAMLVRINTLLQGYSGIRFEILEAI  180

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TK LN NITPCLPLR +ITASGD+VP SYIAGLLTGRPNS AVGPNG++L A EAF  AG
Sbjct  181   TKFLNRNITPCLPLRASITASGDLVPFSYIAGLLTGRPNSVAVGPNGESLNAAEAFSQAG  240

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             ++ GFFELQPKEGLALVNGT VG+G+AS+VLFEANIL VLSEVLSAIFAE MHGKPEFTD
Sbjct  241   IDGGFFELQPKEGLALVNGTGVGAGLASIVLFEANILTVLSEVLSAIFAEAMHGKPEFTD  300

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHE+DPLQKP+
Sbjct  301   HLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEIDPLQKPK  345



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/323 (84%), Positives = 296/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA++LKGSHLDEVKRMV+E+R P V +GGQTLT++QVAAIAA D  V V+LSE
Sbjct  24    DPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAIAANDQGVSVQLSE  83

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              +RAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  84    ASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  143

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T    TLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITASG
Sbjct  144   TETNCTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASG  203

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L A+EAF+ AG+   FFELQPKEGLALVNGT V
Sbjct  204   DLVPLSYIAGLLTGRPNSKAVGPNGETLNAKEAFQAAGIGSDFFELQPKEGLALVNGTPV  263

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  264   GSGLASVVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  323

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAA+KLHE+DPLQKP+
Sbjct  324   LDGSSYVKAAKKLHEIDPLQKPK  346



>ref|XP_010528074.1| PREDICTED: phenylalanine ammonia-lyase 1 [Tarenaya hassleriana]
Length=720

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/324 (84%), Positives = 294/324 (91%), Gaps = 3/324 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI-AARDNAVKVELS  421
             DPLNW  AA+ +KGSHL+EVKRMV EFR P V++GG+TLT+ QVAAI AA ++  KVELS
Sbjct  28    DPLNWGAAAEEMKGSHLEEVKRMVEEFRRPVVRLGGETLTIGQVAAISAAGNDGAKVELS  87

Query  422   EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  601
             E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+
Sbjct  88    EAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGS  147

Query  602   GT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITAS  775
                  HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT LLNHNI PCLPLRGTITAS
Sbjct  148   AAEKSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSLLNHNIAPCLPLRGTITAS  207

Query  776   GDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTA  955
             GD+VPLSYIAGLLTGRPNSKA GPNG+ LTAEEAFKLAG+  GFF+LQPKEGLALVNGTA
Sbjct  208   GDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFKLAGITSGFFDLQPKEGLALVNGTA  267

Query  956   VGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEH  1135
             VGSG+ASMVLFEAN+LAVL+EVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEH
Sbjct  268   VGSGLASMVLFEANVLAVLAEVLSAIFAEVMTGKPEFTDHLTHKLKHHPGQIEAAAIMEH  327

Query  1136  ILDGSHFMKAAQKLHEMDPLQKPQ  1207
             ILDGS +MK AQK+HEMDPLQKP+
Sbjct  328   ILDGSSYMKLAQKIHEMDPLQKPK  351



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/343 (80%), Positives = 302/343 (88%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ LT+
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLTI  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTG PNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/346 (79%), Positives = 305/346 (88%), Gaps = 8/346 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             ME   +NG+ N      C+ + DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1     METVTKNGYQNGSLESLCVNQRDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  359   LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61    LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             IT+LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP G+ L A EAFK A
Sbjct  181   ITRLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFKAA  240

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             G+  GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFT
Sbjct  241   GIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFT  300

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  301   DHLTHKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/328 (82%), Positives = 296/328 (90%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREGDVS  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGVKASSDWVM SM  G DSYGVTTGFGATSHRRTK G ALQ+ELIR LNAG
Sbjct  74    VELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHSATRAAMLVRIN+LLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSATRAAMLVRINSLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLSYIAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEG ALV
Sbjct  194   VTASGDLVPLSYIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGFALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDG  ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGISYVKEAKKLHEMDPLQKPK  341



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/338 (80%), Positives = 298/338 (88%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7     ANQNGSVESLCNSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67    AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG G+   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  127   KELIRFLNSGIFGNGSESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  186

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  187   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFE  246

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  247   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  306

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/338 (80%), Positives = 299/338 (88%), Gaps = 3/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
             A +NG +   C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7     ANQNGSTESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67    AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  560   QELIRFLNAGIFG--TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLN+GIFG  + + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  LLNHN
Sbjct  127   KELIRFLNSGIFGNESESNHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIANLLNHN  186

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA+GPNG+ L A+ AF+ AG++ GFFE
Sbjct  187   VTPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAIGPNGETLDAKAAFEQAGIDSGFFE  246

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSE+LSAIFAEVM GKPEFTDHL HKLK
Sbjct  247   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEILSAIFAEVMQGKPEFTDHLTHKLK  306

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS +MK A+KLHEMDPLQKP+
Sbjct  307   HHPGQIEAAAIMEHILDGSSYMKTAKKLHEMDPLQKPK  344



>gb|AEX32790.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/328 (83%), Positives = 298/328 (91%), Gaps = 3/328 (1%)
 Frame = +2

Query  230   FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  409
             FC+  DPLNW MAA++LK SHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15    FCVS-DPLNWGMAAETLKESHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  410   VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  589
             VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74    VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  590   IFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  763
             IFG G  + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT
Sbjct  134   IFGNGRESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT  193

Query  764   ITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALV  943
             +TASGD+VPLS IAGLLTGRPNSKAVGP+G+ + AEEAFK+AG+  GFFELQPKEGLALV
Sbjct  194   VTASGDLVPLSDIAGLLTGRPNSKAVGPSGEVVNAEEAFKMAGIESGFFELQPKEGLALV  253

Query  944   NGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAA  1123
             NGTAVGSG+ASMVLFE N+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAA
Sbjct  254   NGTAVGSGLASMVLFETNVLAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAA  313

Query  1124  IMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             IMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  314   IMEHILDGSSYVKEAKKLHEMDPLQKPK  341



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/345 (82%), Positives = 307/345 (89%), Gaps = 9/345 (3%)
 Frame = +2

Query  200   GAIE-NGH---SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             G+IE NG     N FC+K DPLNW + A+SLKGSHLDEVKRMV EFRNP VK+GG+TLTV
Sbjct  2     GSIEFNGDQNIDNYFCVKGDPLNWGVVAESLKGSHLDEVKRMVTEFRNPVVKLGGETLTV  61

Query  368   AQVAAIA--ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             +QVAAIA  A D++ +KVELSE AR GVKASS+WVM SMN GTDSYGVTTGFGATSHRRT
Sbjct  62    SQVAAIAVAATDSSNIKVELSESAREGVKASSEWVMESMNKGTDSYGVTTGFGATSHRRT  121

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             K G ALQ+ELIRFLNAGIFG+GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  122   KEGGALQKELIRFLNAGIFGSGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  181

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TK LNHNITP LPLRGTITASGD+VPLSYIAGLLTGR NSKAVGP G+ L AE+AF  AG
Sbjct  182   TKFLNHNITPVLPLRGTITASGDLVPLSYIAGLLTGRSNSKAVGPAGEILNAEKAFSEAG  241

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             V DGFFELQPKEGLALVNGTAVG GMAS+VLFEAN+LA+LSEVLSA+FAEVM GKPEFTD
Sbjct  242   VADGFFELQPKEGLALVNGTAVGFGMASIVLFEANVLALLSEVLSAVFAEVMQGKPEFTD  301

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HL HKLKHHPGQIEAAAIM++ILDGS F+KAAQK+HEMDPLQKP+
Sbjct  302   HLAHKLKHHPGQIEAAAIMKYILDGSDFVKAAQKVHEMDPLQKPK  346



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/352 (79%), Positives = 306/352 (87%), Gaps = 19/352 (5%)
 Frame = +2

Query  209   ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10    ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70    AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  557   QQELIR-------------FLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIR  691
             Q ELIR             FLNAGIFG GT   HTLP  ATRAAMLVRINTLLQGYSGIR
Sbjct  130   QLELIRIKVVDVNMFLFFRFLNAGIFGNGTETSHTLPQPATRAAMLVRINTLLQGYSGIR  189

Query  692   FEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAE  871
             FEILEAITKL+N+NITPCLPLRGT+TASGD+VPLSYIAGLLTGR NSKAVGP+G+ L A+
Sbjct  190   FEILEAITKLINNNITPCLPLRGTVTASGDLVPLSYIAGLLTGRQNSKAVGPSGKVLNAK  249

Query  872   EAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMH  1051
             EAF+ AG++ GFFELQPKEGLALVNGTAVGSG+AS+VLF+ANILA+LSEVLSAIFAEVM 
Sbjct  250   EAFQSAGIDSGFFELQPKEGLALVNGTAVGSGLASIVLFDANILAILSEVLSAIFAEVMQ  309

Query  1052  GKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GKPEFTDHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE+DPLQKP+
Sbjct  310   GKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYMKAAKKLHEVDPLQKPK  361



>ref|XP_003633985.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 295/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V VELSE
Sbjct  19    DPLNWGVAAEALKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVSVELSE  78

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79    TARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  138

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGT+TASG
Sbjct  139   RESCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTVTASG  198

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLL GRPNSKAVGP+G  + AEEAFK+AG+  GFFELQPKEGLALVNGTAV
Sbjct  199   DLVPLSYIAGLLIGRPNSKAVGPSGDVVNAEEAFKMAGIESGFFELQPKEGLALVNGTAV  258

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LAVLSEVLSA+FAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  259   GSGLASMVLFETNVLAVLSEVLSAVFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  318

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K A+KLHEMDPLQKP+
Sbjct  319   LDGSSYVKEAKKLHEMDPLQKPK  341



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/321 (83%), Positives = 298/321 (93%), Gaps = 2/321 (1%)
 Frame = +2

Query  251   LNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSEGA  430
             L+W +AA+S+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQVAAIAA D  V VEL E A
Sbjct  1     LSWGVAAESMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANDQGVSVELCESA  60

Query  431   RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTGT-  607
             RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG GT 
Sbjct  61    RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNGTE  120

Query  608   -GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDI  784
               HTLP  ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+NITPCLPLRGT+TASGD+
Sbjct  121   TNHTLPQPATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNITPCLPLRGTVTASGDL  180

Query  785   VPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAVGS  964
             VPLSYIAGLLTGR NSKAVGP+G+ + A+EAF+LAG++ GFFELQPKEGLALVNGTAVGS
Sbjct  181   VPLSYIAGLLTGRQNSKAVGPSGEVVNAKEAFQLAGIDSGFFELQPKEGLALVNGTAVGS  240

Query  965   GMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHILD  1144
             G+AS+VLF+AN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHILD
Sbjct  241   GLASIVLFDANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILD  300

Query  1145  GSHFMKAAQKLHEMDPLQKPQ  1207
             GS +MKAA+KLH++DPLQKP+
Sbjct  301   GSSYMKAAKKLHDVDPLQKPK  321



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 307/349 (88%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  349
             ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1     MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  350   GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61    GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A +AF
Sbjct  181   LEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLNAVKAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             + AG++ GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSEVLSAIFAEVM GKP
Sbjct  241   QRAGIDTGFFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEVLSAIFAEVMQGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTD+L HKLKHHPGQIEAAAIMEHILDGS ++K A+ +HEMDPLQKP+
Sbjct  301   EFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAKIVHEMDPLQKPK  349



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 298/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19    DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79    EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTL H+ATRAAMLVRINTLLQGYSGIRFEILEAITK +N+N+TP LPLRGTITASG
Sbjct  139   QESCHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFINNNVTPRLPLRGTITASG  198

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSK++GPNG++L A EAFKLAG+N GFFELQPKEGLALVNGTAV
Sbjct  199   DLVPLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGGFFELQPKEGLALVNGTAV  258

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEH+
Sbjct  259   GSGLASMVLFEANVLAVLSEVLSAIFAEVMLGKPEFTDHLTHKLKHHPGQIEAAAIMEHV  318

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQK+HE+DPLQKP+
Sbjct  319   LDGSSYIKAAQKVHEIDPLQKPK  341



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 307/349 (88%), Gaps = 11/349 (3%)
 Frame = +2

Query  194   MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  349
             ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1     MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  350   GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  526
             G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61    GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  527   HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEI
Sbjct  121   HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEI  180

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ L A +AF
Sbjct  181   LEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGELLDAVKAF  240

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             + AG++ GFFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSEVLSAIFAEVM GKP
Sbjct  241   QRAGIDTGFFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEVLSAIFAEVMQGKP  300

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTD+L HKLKHHPGQIEAAAIMEHILDGS ++K A+ +HEMDPLQKP+
Sbjct  301   EFTDYLTHKLKHHPGQIEAAAIMEHILDGSSYVKEAKIVHEMDPLQKPK  349



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/340 (81%), Positives = 305/340 (90%), Gaps = 5/340 (1%)
 Frame = +2

Query  203   AIENGH--SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             A ENGH  SN FC+K  DPLNW  AA+S+ GSHL EVKRMV EFR P V++GG+TLT++Q
Sbjct  2     AAENGHHASNGFCVKQSDPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETLTISQ  61

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GT SYGVTTGFGATSHRRTK G A
Sbjct  62    VAAIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRRTKQGGA  121

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  122   LQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  181

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
              NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G++LTAE+AFKLAGV+ GF
Sbjct  182   TNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGESLTAEQAFKLAGVSGGF  241

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+A+M L+ AN+LAVLS V+SA+FAEVM+GKPEFTDHL HK
Sbjct  242   FELQPKEGLALVNGTAVGSGLATMALYNANLLAVLSVVMSAVFAEVMNGKPEFTDHLTHK  301

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAA IMEHIL+GS ++K A KLHE DPLQKP+
Sbjct  302   LKHHPGQIEAAVIMEHILEGSGYVKEAAKLHETDPLQKPK  341



>dbj|BAA21643.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=715

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/343 (79%), Positives = 301/343 (88%), Gaps = 3/343 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L +
Sbjct  3     TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNLII  62

Query  368   AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  544
             AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63    AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  545   GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  718
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK
Sbjct  123   GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK  182

Query  719   LLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVN  898
             LLN+NITPCLPLRGTITASGD+VPLSYIAGLLTG PNSKA GPNG+ L A EAFK AG++
Sbjct  183   LLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGSPNSKATGPNGEVLDAVEAFKAAGID  242

Query  899   DGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHL  1078
              GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE++SAIFAEVM+GKPEFTDHL
Sbjct  243   SGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELISAIFAEVMNGKPEFTDHL  302

Query  1079  IHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHEMDPLQKP+
Sbjct  303   THKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHEMDPLQKPK  345



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 293/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L+  EAF  AG++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSSYVKEAQKLHEIDPLQKPK  342



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 293/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L+  EAF  AG++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSAYVKEAQKLHEIDPLQKPK  342



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 294/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34    DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94    TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN+NITP LPLRGTITASG
Sbjct  154   KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNNNITPSLPLRGTITASG  213

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA GPNG+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGTAV
Sbjct  214   DLVPLSYIAGLLTGRPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAV  273

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  274   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  333

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK AQKLHEMDPLQKP+
Sbjct  334   LDGSSYMKLAQKLHEMDPLQKPK  356



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/323 (84%), Positives = 293/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L+  EAF  AG++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSAYVKEAQKLHEIDPLQKPK  342



>sp|P31426.1|PAL2_SOLTU RecName: Full=Phenylalanine ammonia-lyase 2, partial [Solanum 
tuberosum]
Length=590

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/334 (81%), Positives = 299/334 (90%), Gaps = 7/334 (2%)
 Frame = +2

Query  227   DFCIKVD--PLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  400
             + C K +  PLNWEMAADSL+GS LD+VK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21    NLCKKQNYLPLNWEMAADSLRGSKLDQVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  401   ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  571
                 V+VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKNG  LQ+ LI
Sbjct  81    KSNGVRVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGTLQKNLI  140

Query  572   RFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPC  745
             RFLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL+N NI+PC
Sbjct  141   RFLNAGVFGIGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNISPC  200

Query  746   LPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPK  925
             LPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGP G  L AEEAF++AGV  GFFELQPK
Sbjct  201   LPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPTGSKLDAEEAFRVAGVTGGFFELQPK  260

Query  926   EGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPG  1105
             EGLALVNGTAVGS MAS+VLFE+NILAV+ EVLSAIFAEVM+GKPEFTD+L HKLKHHPG
Sbjct  261   EGLALVNGTAVGSAMASIVLFESNILAVMFEVLSAIFAEVMNGKPEFTDYLTHKLKHHPG  320

Query  1106  QIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             QIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  321   QIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  354



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/339 (83%), Positives = 299/339 (88%), Gaps = 6/339 (2%)
 Frame = +2

Query  206   IENGHSND-FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  382
             + NG  ND FCIK DPLNW  AA  L GSHLDEVK+MVAEFR P VK+GG+TLTVAQVA 
Sbjct  14    VVNGVVNDPFCIK-DPLNWGAAAAELTGSHLDEVKKMVAEFRKPVVKLGGETLTVAQVAG  72

Query  383   IAARD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             IAA D  +AVKVELSE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  73    IAAADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  132

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+
Sbjct  133   QKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNN  192

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NITPCLPLRGTITASG +VPLSYIAGLLTGRPNSKAVGP G+ L AE AF  AGV  GFF
Sbjct  193   NITPCLPLRGTITASGGLVPLSYIAGLLTGRPNSKAVGPTGEILNAETAFARAGVEGGFF  252

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             ELQPKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVL AIFAEVM GKPEFTDHL HKL
Sbjct  253   ELQPKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLPAIFAEVMQGKPEFTDHLTHKL  312

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQ+EAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  313   KHHPGQMEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  351



>ref|XP_010553331.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Tarenaya hassleriana]
Length=725

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/339 (81%), Positives = 296/339 (87%), Gaps = 4/339 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             AI  G     C     DPLNW +AA+ +KGSHLDEVKRMV E R P V++GG+TLT+ QV
Sbjct  18    AINGGGLEKLCESPTADPLNWGVAAEQMKGSHLDEVKRMVEEHRRPVVRLGGETLTIGQV  77

Query  377   AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  556
             AAIA+  + VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG AL
Sbjct  78    AAIASAVDGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVAL  137

Query  557   QQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNH  730
             Q+ELIRFLNAGIFG+ T   HTLP S TRAAMLVRINTLLQGYSGIRFEILEAIT LLNH
Sbjct  138   QKELIRFLNAGIFGSATEKSHTLPQSTTRAAMLVRINTLLQGYSGIRFEILEAITSLLNH  197

Query  731   NITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFF  910
             NI PCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GPNG+ LTAEEAF+ AG+  GFF
Sbjct  198   NIAPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPNGETLTAEEAFRSAGITSGFF  257

Query  911   ELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKL  1090
             +LQPKEGLALVNGTAVGSG+ASMVLF+AN+LAVLSEVLSAIFAEVM GKPEFTDHL HKL
Sbjct  258   DLQPKEGLALVNGTAVGSGLASMVLFDANVLAVLSEVLSAIFAEVMTGKPEFTDHLTHKL  317

Query  1091  KHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KHHPGQIEAAAIMEHILDGS +MK AQK+HEMDPLQKP+
Sbjct  318   KHHPGQIEAAAIMEHILDGSSYMKLAQKIHEMDPLQKPK  356



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 294/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34    DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94    TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN+NITP LPLRGTITASG
Sbjct  154   KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNNNITPSLPLRGTITASG  213

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA GPNG+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGTAV
Sbjct  214   DLVPLSYIAGLLTGRPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAV  273

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAA+MEHI
Sbjct  274   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAVMEHI  333

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK AQKLHEMDPLQKP+
Sbjct  334   LDGSSYMKLAQKLHEMDPLQKPK  356



>gb|ABY89690.1| phenylalanine ammonialyase 1 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/330 (82%), Positives = 293/330 (89%), Gaps = 2/330 (1%)
 Frame = +2

Query  224   NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  403
             N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24    NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  404   VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  583
             VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84    VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  584   AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  757
             AGIFG+   T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLR
Sbjct  144   AGIFGSTKETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLR  203

Query  758   GTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLA  937
             GTITASGD+VPLSYIAGLLTGRPNSKA GPNG+AL AEEAFK+AGV  GFF+LQPKEGLA
Sbjct  204   GTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLA  263

Query  938   LVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEA  1117
             LVNGTAVGSGMASMVLFEAN+L+VL+EVLSA+FAEVM GKPEFTDHL H+LKHHPGQIEA
Sbjct  264   LVNGTAVGSGMASMVLFEANVLSVLAEVLSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEA  323

Query  1118  AAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AAIMEHILDGS +MK AQKLHEMDPLQKP+
Sbjct  324   AAIMEHILDGSSYMKLAQKLHEMDPLQKPK  353



>ref|XP_009141625.1| PREDICTED: phenylalanine ammonia-lyase 1 [Brassica rapa]
Length=722

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/330 (82%), Positives = 293/330 (89%), Gaps = 2/330 (1%)
 Frame = +2

Query  224   NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  403
             N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24    NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  404   VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  583
             VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84    VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  584   AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  757
             AGIFG+   T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLR
Sbjct  144   AGIFGSTKETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLR  203

Query  758   GTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLA  937
             GTITASGD+VPLSYIAGLLTGRPNSKA GPNG+AL AEEAFK+AGV  GFF+LQPKEGLA
Sbjct  204   GTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLA  263

Query  938   LVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEA  1117
             LVNGTAVGSGMASMVLFEAN+L+VL+EVLSA+FAEVM GKPEFTDHL H+LKHHPGQIEA
Sbjct  264   LVNGTAVGSGMASMVLFEANVLSVLAEVLSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEA  323

Query  1118  AAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AAIMEHILDGS +MK AQKLHEMDPLQKP+
Sbjct  324   AAIMEHILDGSSYMKLAQKLHEMDPLQKPK  353



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/342 (81%), Positives = 302/342 (88%), Gaps = 3/342 (1%)
 Frame = +2

Query  188   TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             T +   + +G S  FC+K DPLNW +AA+++KGSHL+EVK MV EFR P V++GG+TLT+
Sbjct  5     TAIGNGVGSGGSPGFCLK-DPLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLGGETLTI  63

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             +QVAAIA R + V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  64    SQVAAIAVRGSEVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEG  123

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT   HTLP SATRAAMLVRINTLLQGYSGIRFEILEAI+K 
Sbjct  124   GALQKELIRFLNAGIFGNGTESCHTLPQSATRAAMLVRINTLLQGYSGIRFEILEAISKF  183

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGR NSKAVGP G+ L  +EAF+LAGV  
Sbjct  184   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRHNSKAVGPTGEILHPKEAFRLAGVEG  243

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
             GFFELQPKEGLALVNGTAVGSG+ASMVLFEANILAVLSEVLSAIFAEVM GKPEFTDHL 
Sbjct  244   GFFELQPKEGLALVNGTAVGSGLASMVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLT  303

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  304   HKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  345



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/353 (78%), Positives = 308/353 (87%), Gaps = 14/353 (4%)
 Frame = +2

Query  191   TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  334
             T+  AI    +N+ FC+           + DPLNW +AA+++KGSH+DEVKRMV E+R P
Sbjct  3     TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKP  62

Query  335   AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
              V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63    VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGI
Sbjct  123   GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGI  182

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAITKLLN+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A
Sbjct  183   RFEILEAITKLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPSGEILNA  242

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             +EAFKLAG+N  F ELQPKEGLALVNGTAVGSG+AS+VL EANILAVLSEVLSAIFAEVM
Sbjct  243   KEAFKLAGINAEFLELQPKEGLALVNGTAVGSGLASIVLLEANILAVLSEVLSAIFAEVM  302

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              GKPEFTDHL HKLKHHPGQIEAAAIMEHILDGS ++KA +KLHEMDPLQKP+
Sbjct  303   QGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKADKKLHEMDPLQKPK  355



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/340 (83%), Positives = 305/340 (90%), Gaps = 5/340 (1%)
 Frame = +2

Query  203   AIENGH--SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             A ENGH  SN +C+K  DPLNW +AA+ LKGSHLDEVKRMV EFR P V +GG+TLT+AQ
Sbjct  6     ATENGHHNSNGYCVKQKDPLNWGLAAEGLKGSHLDEVKRMVEEFRKPVVNLGGKTLTIAQ  65

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAAIAA DNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  66    VAAIAATDNAVAVELAEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  125

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   H LPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN
Sbjct  126   LQKELIRFLNAGIFGNGTESSHMLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLN  185

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD+VPLSYIAG LTGRPNSKAVGP G+ LTA+EAF LAGV  GF
Sbjct  186   HNITPCLPLRGTITASGDLVPLSYIAGFLTGRPNSKAVGPKGEPLTADEAFTLAGVAGGF  245

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS+ L+EAN+L++LSEV+SAIFAEVM+GKPEFTDHL HK
Sbjct  246   FELQPKEGLALVNGTAVGSGLASIALYEANVLSLLSEVMSAIFAEVMNGKPEFTDHLTHK  305

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS ++KAA KLHE DPLQKP+
Sbjct  306   LKHHPGQIEAAAIMEHILDGSAYVKAAAKLHETDPLQKPK  345



>gb|AJT59582.1| phenylalanine ammonia lyase [Boehmeria nivea]
Length=728

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 297/325 (91%), Gaps = 2/325 (1%)
 Frame = +2

Query  239   KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVEL  418
             + D LNW  AA+++KGSHL+EVKRMVAE+R P V++GG+TLT+AQVAAIA  D  V+VEL
Sbjct  34    RADALNWGEAAEAMKGSHLEEVKRMVAEYRKPVVRLGGETLTIAQVAAIAGHDAGVRVEL  93

Query  419   SEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFG  598
             SE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG
Sbjct  94    SEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFG  153

Query  599   TG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  772
              G  T HTLPHSATRAA+LVRINTLLQGYSGIRFEILEA+TKLLNHN+TPCLPLRGTITA
Sbjct  154   NGSETCHTLPHSATRAALLVRINTLLQGYSGIRFEILEAMTKLLNHNVTPCLPLRGTITA  213

Query  773   SGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGT  952
             SGD+VPLSYIAGLLTGRPNSKAVGP GQ L+A EAF+ AG++ GFFELQPKEGLALVNGT
Sbjct  214   SGDLVPLSYIAGLLTGRPNSKAVGPEGQTLSATEAFEAAGIHSGFFELQPKEGLALVNGT  273

Query  953   AVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIME  1132
             AVGSGMAS VLFEAN+LAVLSEV+SAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIME
Sbjct  274   AVGSGMASTVLFEANVLAVLSEVISAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIME  333

Query  1133  HILDGSHFMKAAQKLHEMDPLQKPQ  1207
             H+LDGS ++KAA+KLHE DPLQKP+
Sbjct  334   HVLDGSAYIKAAKKLHETDPLQKPK  358



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 298/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19    DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79    EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               + HTL H+ATRAAMLVRINTLLQGYSGIRFEILEAITK +N+N+TP LPLRGTITASG
Sbjct  139   QESCHTLSHTATRAAMLVRINTLLQGYSGIRFEILEAITKFINNNVTPRLPLRGTITASG  198

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSK++GPNG++L A EAFKLAG+N GFFELQPKEGLALVNGTAV
Sbjct  199   DLVPLSYIAGLLTGRPNSKSLGPNGESLDAAEAFKLAGINGGFFELQPKEGLALVNGTAV  258

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEH+
Sbjct  259   GSGLASMVLFEANVLAVLSEVLSAIFAEVMLGKPEFTDHLTHKLKHHPGQIEAAAIMEHV  318

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAAQK+HE+DPLQKP+
Sbjct  319   LDGSSYIKAAQKVHEIDPLQKPK  341



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/347 (79%), Positives = 306/347 (88%), Gaps = 10/347 (3%)
 Frame = +2

Query  197   EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6     QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  359   LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66    LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTK G ALQ+ELIRFLNAGIFG GT   H LPHSAT+AAM+VRINTLLQGYSGIRFEILE
Sbjct  126   RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKLLN NITPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA GPNG++L A++AF  
Sbjct  186   AITKLLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKATGPNGESLDAQQAFSE  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AG++ G FELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSEVLSAIFAEVM+GKPEF
Sbjct  246   AGIDSGLFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TDHL HKLKHHPGQIEAAAIMEHILDGS ++KAA+K+HEMDPLQKP+
Sbjct  306   TDHLTHKLKHHPGQIEAAAIMEHILDGSGYVKAAKKVHEMDPLQKPK  352



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 304/340 (89%), Gaps = 5/340 (1%)
 Frame = +2

Query  194   MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  373
             ME   ENG+ N   IK DPL+WE+AADS+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1     MEFCHENGNGNGHVIK-DPLSWELAADSMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  374   VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  60    VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  554   LQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPHS+TRAAMLVRINTLLQGYSGIRFEILEA+TKL+N
Sbjct  118   LQKELIRFLNAGIFGNGTESCHTLPHSSTRAAMLVRINTLLQGYSGIRFEILEALTKLIN  177

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD+VPLSYIAG+LTGRPNSK VGP G+ L A EAF+ AG++ GF
Sbjct  178   HNITPCLPLRGTITASGDLVPLSYIAGVLTGRPNSKCVGPTGEPLDATEAFRRAGIDGGF  237

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+AS+VLF+AN+LAVLS VLSAIFAEVM GKPEFTDHL HK
Sbjct  238   FELQPKEGLALVNGTAVGSGLASIVLFDANVLAVLSVVLSAIFAEVMQGKPEFTDHLTHK  297

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEH+LDGS ++KAAQKLHEMDPLQKP+
Sbjct  298   LKHHPGQIEAAAIMEHVLDGSSYVKAAQKLHEMDPLQKPK  337



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/353 (78%), Positives = 308/353 (87%), Gaps = 14/353 (4%)
 Frame = +2

Query  191   TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  334
             T+  AI    +N+ FC+           + DPLNW +AA+++KGSHLDEVKRMV E+R P
Sbjct  3     TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKP  62

Query  335   AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  514
              V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63    VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  515   GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGI  688
             GATSHRRTK G ALQ+ELIRFLNAGIFG G+   HTLPH+ATRAAMLVRINTLLQGYSGI
Sbjct  123   GATSHRRTKQGGALQKELIRFLNAGIFGKGSESSHTLPHTATRAAMLVRINTLLQGYSGI  182

Query  689   RFEILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTA  868
             RFEILEAIT LLN+N+TPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A
Sbjct  183   RFEILEAITNLLNNNVTPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPSGEILNA  242

Query  869   EEAFKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVM  1048
             +EAFKLAG+N  F ELQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM
Sbjct  243   KEAFKLAGINAEFLELQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVM  302

Query  1049  HGKPEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
              GKPEFTDHL HKLKHHPGQIEAAAIMEHILDGS ++KA +KLHEMDPLQKP+
Sbjct  303   QGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKADKKLHEMDPLQKPK  355



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 293/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+RNP VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITK++NHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRTNTLLQGYSGIRFEMLEAITKMINHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ LT  EAF  AG++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGEPLTPAEAFTQAGIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQI AAAIMEHI
Sbjct  260   GSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIVAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSAYVKEAQKLHEIDPLQKPK  342



>ref|XP_010107520.1| Phenylalanine ammonia-lyase [Morus notabilis]
 gb|EXC16202.1| Phenylalanine ammonia-lyase [Morus notabilis]
Length=725

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/341 (79%), Positives = 305/341 (89%), Gaps = 3/341 (1%)
 Frame = +2

Query  191   TMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             ++EG   +  +N   +  D LNW  AA+++KGSHL+EVKRMV E+R PAV +GG+TLT++
Sbjct  17    SLEGICTSNGNNGGVVSGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNLGGETLTIS  76

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA+ D  VKVELSE AR GVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  77    QVAAIASHDCGVKVELSEAAREGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  136

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATR+A+LVRINTLLQGYSGIRFEILEA+TKLL
Sbjct  137   ALQKELIRFLNAGIFGNGTESCHTLPHTATRSALLVRINTLLQGYSGIRFEILEAMTKLL  196

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N N+TPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA +AFK+AG+N G
Sbjct  197   NSNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSG  256

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+ASMVLF+ANIL+VLSE+LSAIFAEVM GKPEFTDHL H
Sbjct  257   FFELQPKEGLALVNGTAVGSGLASMVLFDANILSVLSEILSAIFAEVMQGKPEFTDHLTH  316

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILDGS +MKAA KLHE+DPLQKP+
Sbjct  317   KLKHHPGQIEAAAIMEHILDGSSYMKAA-KLHEIDPLQKPK  356



>gb|AAZ29732.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=724

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/335 (82%), Positives = 303/335 (90%), Gaps = 6/335 (2%)
 Frame = +2

Query  218   HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  388
             H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  22    HANANNMKVNGADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIA  81

Query  389   ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  568
             A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  82    AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  140

Query  569   IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  742
             IRFLNAGIFG GT   H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITP
Sbjct  141   IRFLNAGIFGNGTESNHILPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITP  200

Query  743   CLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQP  922
             CLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A+EAF+LAG+N  FFELQP
Sbjct  201   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPSGEILNAKEAFQLAGINADFFELQP  260

Query  923   KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  1102
             KEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  261   KEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  320

Query  1103  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  321   GQIEAAAIMEHILDGSAYVKAAKKLHEIDPLQKPK  355



>gb|AAZ29734.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/335 (82%), Positives = 303/335 (90%), Gaps = 6/335 (2%)
 Frame = +2

Query  218   HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  388
             H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23    HANANNMKVNGADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIA  82

Query  389   ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  568
             A D A  VELSE ARAGVKASSDW+M SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83    AHDGAT-VELSESARAGVKASSDWIMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  569   IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  742
             IRFLNAGIFG GT   H LPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+NITP
Sbjct  142   IRFLNAGIFGNGTESNHILPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITP  201

Query  743   CLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQP  922
             CLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP+G+ L A+EAF+LAG+N  FFELQP
Sbjct  202   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPSGEILNAKEAFQLAGINADFFELQP  261

Query  923   KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  1102
             KEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  262   KEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  321

Query  1103  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  322   GQIEAAAIMEHILDGSAYVKAAKKLHEIDPLQKPK  356



>gb|ABY89691.1| phenylalanine ammonialyase 2 protein [Brassica rapa subsp. oleifera]
Length=722

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/330 (82%), Positives = 292/330 (88%), Gaps = 2/330 (1%)
 Frame = +2

Query  224   NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  403
             N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24    NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  404   VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  583
             VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84    VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  584   AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  757
             AGIFG+   T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT   N+NITP LPLR
Sbjct  144   AGIFGSTKETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFFNNNITPSLPLR  203

Query  758   GTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLA  937
             GTITASGD+VPLSYIAGLLTGRPNSKA GPNG+AL AEEAFK+AGV  GFF+LQPKEGLA
Sbjct  204   GTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKEGLA  263

Query  938   LVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEA  1117
             LVNGTAVGSGMASMVLFEAN+L+VL+EVLSA+FAEVM GKPEFTDHL H+LKHHPGQIEA
Sbjct  264   LVNGTAVGSGMASMVLFEANVLSVLAEVLSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEA  323

Query  1118  AAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AAIMEHILDGS +MK AQKLHEMDPLQKP+
Sbjct  324   AAIMEHILDGSSYMKLAQKLHEMDPLQKPK  353



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/347 (79%), Positives = 305/347 (88%), Gaps = 10/347 (3%)
 Frame = +2

Query  197   EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6     QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  359   LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  532
             LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66    LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  533   RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILE  706
             RTK G ALQ+ELIRFLNAGIFG GT   H LPHSAT+AAM+VRINTLLQGYSGIRFEILE
Sbjct  126   RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMIVRINTLLQGYSGIRFEILE  185

Query  707   AITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKL  886
             AITKLLN NITPCLPLRGTITASGD+VPLSYIAGLLTGR NSKA GPNG++L A++AF  
Sbjct  186   AITKLLNTNITPCLPLRGTITASGDLVPLSYIAGLLTGRSNSKATGPNGESLDAQQAFSE  245

Query  887   AGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEF  1066
             AG++ G FELQPKEGLALVNGTAVGSG ASMVLF+ANILAVLSEVLSAIFAEVM+GKPEF
Sbjct  246   AGIDSGLFELQPKEGLALVNGTAVGSGSASMVLFDANILAVLSEVLSAIFAEVMNGKPEF  305

Query  1067  TDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             TDHL HKLKHHPGQIEAAAIMEHILDGS ++KAA+K+HEMDPLQKP+
Sbjct  306   TDHLTHKLKHHPGQIEAAAIMEHILDGSGYVKAAKKVHEMDPLQKPK  352



>ref|XP_011010447.1| PREDICTED: phenylalanine ammonia-lyase [Populus euphratica]
Length=715

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/346 (79%), Positives = 304/346 (88%), Gaps = 8/346 (2%)
 Frame = +2

Query  194   MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  358
             ME   +NG+ N      C  ++DPL+W +AA+++KGSHLDEVKRMVA++R   VK+GG+T
Sbjct  1     METVTKNGYQNGSLESLCSNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKSVVKLGGET  60

Query  359   LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  535
             LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61    LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  536   TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  709
             TK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEA
Sbjct  121   TKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEA  180

Query  710   ITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLA  889
             ITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP G+ L A EAF+ A
Sbjct  181   ITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKATGPTGEVLDAAEAFEAA  240

Query  890   GVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFT  1069
             G+  GFFELQPKEGLALVNGTAVGSG+ASMVLFE N+LAVLSE+LSAIFAEVM+GKPEFT
Sbjct  241   GIESGFFELQPKEGLALVNGTAVGSGLASMVLFETNVLAVLSELLSAIFAEVMNGKPEFT  300

Query  1070  DHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             DHL HKLKHHPGQIEAAAIMEHILDGS +MKAA+KLHE DPLQKP+
Sbjct  301   DHLTHKLKHHPGQIEAAAIMEHILDGSAYMKAAKKLHETDPLQKPK  346



>ref|XP_007144370.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
 gb|ESW16364.1| hypothetical protein PHAVU_007G150500g [Phaseolus vulgaris]
Length=712

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/342 (80%), Positives = 302/342 (88%), Gaps = 8/342 (2%)
 Frame = +2

Query  203   AIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             A  NG  + FC+       DPLNW  AA++L GSHLDEVKRMVAE+R PAV++GGQTLT+
Sbjct  3     ATPNG-KDAFCVTAANAAGDPLNWAAAAEALSGSHLDEVKRMVAEYRKPAVRLGGQTLTI  61

Query  368   AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  547
             AQVAA AA D  +KVEL+E ARA VKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  62    AQVAATAAHDQGLKVELAESARACVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQG  121

Query  548   HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKL  721
              ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVR+NTLLQGYSGIRFEILEAITKL
Sbjct  122   GALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRVNTLLQGYSGIRFEILEAITKL  181

Query  722   LNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVND  901
             LN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EAF+LA +  
Sbjct  182   LNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEAFELANIGS  241

Query  902   GFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLI  1081
              FFELQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSEV+SAIFAEVM GKPEFTDHL 
Sbjct  242   EFFELQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVISAIFAEVMQGKPEFTDHLT  301

Query  1082  HKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE+DPLQKP+
Sbjct  302   HKLKHHPGQIEAAAIMEHILDGSSYIKAAKKLHEIDPLQKPK  343



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/335 (82%), Positives = 302/335 (90%), Gaps = 6/335 (2%)
 Frame = +2

Query  218   HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  388
             H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23    HANANNMKVNGADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGKTLTISQVAAIA  82

Query  389   ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  568
             A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83    AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  569   IRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITP  742
             IRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN+N+TP
Sbjct  142   IRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTP  201

Query  743   CLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQP  922
             CLPLRGTITASGD+VPLSYIAGLLTGRPNSKA GP G+ L A++AF+LAG+N  FFELQP
Sbjct  202   CLPLRGTITASGDLVPLSYIAGLLTGRPNSKAHGPTGEVLNAKQAFQLAGINTEFFELQP  261

Query  923   KEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHP  1102
             KEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHP
Sbjct  262   KEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHP  321

Query  1103  GQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             GQIEAAAIMEHILDGS ++K A+KLHEMDPLQKP+
Sbjct  322   GQIEAAAIMEHILDGSAYVKDAKKLHEMDPLQKPK  356



>gb|ABC69916.1| phenylalanine ammonia-lyase [Brassica napus]
Length=722

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/330 (82%), Positives = 292/330 (88%), Gaps = 2/330 (1%)
 Frame = +2

Query  224   NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  403
             N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24    NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  404   VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  583
             VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84    VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  584   AGIFGTG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLR  757
             AGIFG+   T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLR
Sbjct  144   AGIFGSTKETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLR  203

Query  758   GTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLA  937
             GTITASGD+VPLSYIAGLLTGRPNSKA GPNG+AL AEEAFK+AGV  GFF+LQPKE LA
Sbjct  204   GTITASGDLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGVTSGFFDLQPKESLA  263

Query  938   LVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEA  1117
             LVNGTAVGSGMASMVLFEAN+L+VL+EVLSA+FAEVM GKPEFTDHL H+LKHHPGQIEA
Sbjct  264   LVNGTAVGSGMASMVLFEANVLSVLAEVLSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEA  323

Query  1118  AAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             AAIMEHILDGS +MK AQKLHEMDPLQKP+
Sbjct  324   AAIMEHILDGSSYMKLAQKLHEMDPLQKPK  353



>gb|ADY02660.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 292/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  2     DPLNWGAAAEQMKGSHLDEVKRMVEEFRRPFVNLGGETLTIGQVAAISTVGNGVKVELSE  61

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  62    TARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  121

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLRGTITASG
Sbjct  122   KETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASG  181

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA GPNG+AL AEEAFK+AG++ GFF+LQPKEGLALVNGTAV
Sbjct  182   DLVPLSYIAGLLTGRPNSKATGPNGEALNAEEAFKMAGISSGFFDLQPKEGLALVNGTAV  241

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  242   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  301

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  302   LDGSSYMKLAKKLHEMDPLQKPK  324



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/350 (78%), Positives = 301/350 (86%), Gaps = 13/350 (4%)
 Frame = +2

Query  197   EGAIENGHSND-FCIKV----------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             +  I+NG  +D  CIK           DPLNW  AA+S+ GSHLDEV+RMVAE+R P VK
Sbjct  12    QNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVK  71

Query  344   IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  523
             +GG+TLT++QVAAIA  D+ VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  72    LGGETLTISQVAAIANHDSGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  131

Query  524   SHRRTKNGHALQQELIRFLNAGIF--GTGTGHTLPHSATRAAMLVRINTLLQGYSGIRFE  697
             SHRRTK G ALQ+ELIRFLNAG+   GT + HTLPHSATRAAMLVRINTLLQGYSGIRFE
Sbjct  132   SHRRTKQGAALQKELIRFLNAGVLRNGTESAHTLPHSATRAAMLVRINTLLQGYSGIRFE  191

Query  698   ILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEA  877
             ILEAI+K LNHNITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP G+ L A EA
Sbjct  192   ILEAISKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPKGETLNAAEA  251

Query  878   FKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGK  1057
             F   G++ GFFELQPKEGLALVNGTAVGSG+AS VLFE NILA+LSE+LSAIFAEVM GK
Sbjct  252   FAQVGISSGFFELQPKEGLALVNGTAVGSGLASTVLFETNILALLSEILSAIFAEVMQGK  311

Query  1058  PEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PEFTDHL HKLKHHPGQIEAAAIMEHILDGS ++KAA+KLHE DPLQKP+
Sbjct  312   PEFTDHLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAEKLHEQDPLQKPK  361



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/323 (82%), Positives = 296/323 (92%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA  D+ V VELSE
Sbjct  32    DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIATHDHGVTVELSE  91

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              +R GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  92    SSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  151

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAIT LLN+NITPCLPLRGTITASG
Sbjct  152   TESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITNLLNNNITPCLPLRGTITASG  211

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGP+G+ L A++AF++AG+N  FFELQPKEGLALVNGTAV
Sbjct  212   DLVPLSYIAGLLTGRPNSKAVGPSGEVLNAKQAFQMAGINSEFFELQPKEGLALVNGTAV  271

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GS +AS+VLF+ANILAVLSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  272   GSALASIVLFDANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  331

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++KAA+KLHE DPLQKP+
Sbjct  332   LDGSSYVKAAKKLHETDPLQKPK  354



>gb|ADY02662.1| phenylalanine ammonia lyase [Parrya nudicaulis]
Length=693

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/323 (83%), Positives = 292/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  2     DPLNWGAAAEQMKGSHLDEVKRMVEEFRRPFVNLGGETLTIGQVAAISTVGNGVKVELSE  61

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  62    TARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  121

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT  LN+NITP LPLRGTITASG
Sbjct  122   KETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITSFLNNNITPSLPLRGTITASG  181

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKA GPNG+AL AE+AFK+AG++ GFF+LQPKEGLALVNGTAV
Sbjct  182   DLVPLSYIAGLLTGRPNSKATGPNGEALNAEZAFKMAGISSGFFDLQPKEGLALVNGTAV  241

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  242   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  301

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK A+KLHEMDPLQKP+
Sbjct  302   LDGSSYMKLAKKLHEMDPLQKPK  324



>ref|XP_002881488.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57747.1| hypothetical protein ARALYDRAFT_482690 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 292/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  34    DPLNWGAAAEQMKGSHLDEVKRMVVEFRKPVVNLGGETLTIGQVAAISTIGNGVKVELSE  93

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94    TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN+NITP LPLRGTITASG
Sbjct  154   KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNNNITPSLPLRGTITASG  213

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAG+LTGRPNSKA GPNG+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGTAV
Sbjct  214   DLVPLSYIAGILTGRPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAV  273

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  274   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  333

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK AQKLHEMDPLQKP+
Sbjct  334   LDGSSYMKLAQKLHEMDPLQKPK  356



>gb|ABN79671.2| phenylalanine ammonia-lyase [Rudbeckia hirta]
Length=720

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/338 (83%), Positives = 300/338 (89%), Gaps = 7/338 (2%)
 Frame = +2

Query  212   NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  391
             NG + +FCIK DPLNW  AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  15    NGAAAEFCIK-DPLNWGAAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  73

Query  392   RDN----AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
                     V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ
Sbjct  74    AGGGGGGTVTVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQ  133

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAGIFG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITK LN+N
Sbjct  134   KELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNN  193

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             ITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKA+GP G+ L AE AF  AGV  GFFE
Sbjct  194   ITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAMGPTGEILNAETAFAQAGVKGGFFE  253

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSGMASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLK
Sbjct  254   LQPKEGLALVNGTAVGSGMASMVLFEANVLALLSEVLSAIFAEVMQGKPEFTDHLTHKLK  313

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIME+ILDGS ++KAAQK+HEMDPLQKP+
Sbjct  314   HHPGQIEAAAIMEYILDGSDYVKAAQKVHEMDPLQKPK  351



>gb|AAW51923.2| phenylalanine ammonia-lyase 2 [Rhizophora mangle]
Length=723

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 304/340 (89%), Gaps = 7/340 (2%)
 Frame = +2

Query  209   ENGHSNDFCI----KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  376
             +NG  +  C     + DPLNW +AA+SLKGSHLDEVKRMVAE+R   VK+GG+TLT+AQV
Sbjct  10    QNGSLDSLCTTKPPRHDPLNWGVAAESLKGSHLDEVKRMVAEYRKHVVKLGGETLTIAQV  69

Query  377   AAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  553
             AAI+   D+ + VEL+E ARAGVKASSDWVM+ M  GTDSYGVTTGFGATSHRRTK G A
Sbjct  70    AAISRGVDSGITVELAESARAGVKASSDWVMDGMTKGTDSYGVTTGFGATSHRRTKQGSA  129

Query  554   LQQELIRFLNAGIFGTGTG--HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  727
             LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKLLN
Sbjct  130   LQRELIRFLNAGIFGHGTDSCHTLPHAATRAAMLVRINTLLQGYSGIRFEILEAITKLLN  189

Query  728   HNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGF  907
             HNITPCLPLRGTITASGD++PLSYIAGLLTGRPNSKA+GP+GQ+L A EAF+LAG+  GF
Sbjct  190   HNITPCLPLRGTITASGDLIPLSYIAGLLTGRPNSKAIGPDGQSLNAGEAFRLAGIESGF  249

Query  908   FELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHK  1087
             FELQPKEGLALVNGTAVGSG+ASMVLFEANILAVL+E+LSAIFAEVM+GKPEFTDHL HK
Sbjct  250   FELQPKEGLALVNGTAVGSGLASMVLFEANILAVLAEMLSAIFAEVMNGKPEFTDHLTHK  309

Query  1088  LKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             LKHHPGQIEAAAIMEHILDGS +MK A+++HEMDPLQKP+
Sbjct  310   LKHHPGQIEAAAIMEHILDGSSYMKEAKRIHEMDPLQKPK  349



>ref|XP_010505261.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Camelina sativa]
Length=727

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 291/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  36    DPLNWGAAAEQMKGSHLDEVKRMVEEFRKPVVNLGGETLTIGQVAAISTIGNGVKVELSE  95

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  96    TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  155

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN NITP LPLRGTITASG
Sbjct  156   KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNSNITPSLPLRGTITASG  215

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAG+LTGRPNSKA GPNG+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGTAV
Sbjct  216   DLVPLSYIAGILTGRPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAV  275

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  276   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  335

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK AQKLHEMDPLQKP+
Sbjct  336   LDGSSYMKLAQKLHEMDPLQKPK  358



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/338 (80%), Positives = 304/338 (90%), Gaps = 4/338 (1%)
 Frame = +2

Query  203   AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  379
              + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18    CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  380   AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  559
             AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78    AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  560   QELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHN  733
             +ELIRFLNAGIFG GT   HTLPH+ATRAAMLVRINTLLQGYSGIRFEILEAITKL+N+N
Sbjct  138   KELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLINNN  197

Query  734   ITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFE  913
             +TPCL LRGTITASGD+VPLSYIAGLLTGRPNSKA G +G+ L A+EAF+ A +NDGFFE
Sbjct  198   VTPCL-LRGTITASGDLVPLSYIAGLLTGRPNSKAHGTSGEILNAKEAFQSAEINDGFFE  256

Query  914   LQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLK  1093
             LQPKEGLALVNGTAVGSG+AS+VLFEANILAVLSEVLSAIFAEVM GKPEFTDHL HKLK
Sbjct  257   LQPKEGLALVNGTAVGSGLASIVLFEANILAVLSEVLSAIFAEVMQGKPEFTDHLTHKLK  316

Query  1094  HHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HHPGQIEAAAIMEHILDGS ++KAA+KLHEMDPLQKP+
Sbjct  317   HHPGQIEAAAIMEHILDGSAYVKAAKKLHEMDPLQKPK  354



>ref|XP_011041025.1| PREDICTED: phenylalanine ammonia-lyase G2B [Populus euphratica]
Length=711

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 293/323 (91%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVVVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  605   T--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T   HTLP SATRAAMLVRINTLLQGYSGIRFE+LEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRINTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGP+G+ L+  EAF  A ++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPHGEPLSPAEAFTQARIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFEAN+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFEANVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSAYVKEAQKLHEIDPLQKPK  342



>gb|AAQ74878.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=711

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 292/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20    DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFG--  598
              ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG  
Sbjct  80    EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGND  139

Query  599   TGTGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
             T + HTLP SATRAAMLVR NTLLQGYSGIRFE+LEAITKLLNHNITPCLPLRGTITASG
Sbjct  140   TESSHTLPRSATRAAMLVRFNTLLQGYSGIRFEMLEAITKLLNHNITPCLPLRGTITASG  199

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAGLLTGRPNSKAVGPNG+ L+  EAF  AG++ GFFELQPKEGLALVNGTAV
Sbjct  200   DLVPLSYIAGLLTGRPNSKAVGPNGEPLSPAEAFTQAGIDGGFFELQPKEGLALVNGTAV  259

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSG+ASMVLFE N+LA+LSEVLSAIFAEVM GKPEFTDHL HKLKHHPGQIEAAAIMEHI
Sbjct  260   GSGLASMVLFETNVLAILSEVLSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHI  319

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS ++K AQKLHE+DPLQKP+
Sbjct  320   LDGSAYVKEAQKLHEIDPLQKPK  342



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/349 (77%), Positives = 299/349 (86%), Gaps = 8/349 (2%)
 Frame = +2

Query  185   NTTMEGAIENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             N   +  I+NG  +  C+K        DPLNW  AA+S+ GSHLDEVKRMVAE+R P VK
Sbjct  7     NGYHQNGIQNGSLDILCVKTESLKAVSDPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVK  66

Query  344   IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  523
             +GG+TLT+AQVAAIA  D+ VKVEL E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  67    LGGKTLTIAQVAAIANHDSGVKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  126

Query  524   SHRRTKNGHALQQELIRFLNAGIFGTGT-GHTLPHSATRAAMLVRINTLLQGYSGIRFEI  700
             SHRRTK G ALQ+ELIRFLNAG+FG GT  HTLPH  TRAAMLVRINTLLQGYSGIRFEI
Sbjct  127   SHRRTKQGAALQKELIRFLNAGVFGKGTESHTLPHPTTRAAMLVRINTLLQGYSGIRFEI  186

Query  701   LEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAF  880
             LEAITK LNHNITPCLPLRGTI++SGD+VPLSYIAGLLTGRPNSK+VGP G+ L A +AF
Sbjct  187   LEAITKFLNHNITPCLPLRGTISSSGDLVPLSYIAGLLTGRPNSKSVGPKGETLNAAQAF  246

Query  881   KLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKP  1060
             +  G++ GFFELQPKEGLALVNGTAVGSG+AS VLFE NIL +LSE+LSAIFAEVM GKP
Sbjct  247   EQVGISSGFFELQPKEGLALVNGTAVGSGLASTVLFETNILTLLSEILSAIFAEVMQGKP  306

Query  1061  EFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             EFTDHL HKLKHHPGQIEAAAIME+ILDGS ++KAA+KLHE DPLQKP+
Sbjct  307   EFTDHLTHKLKHHPGQIEAAAIMEYILDGSDYVKAAKKLHEQDPLQKPK  355



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/350 (78%), Positives = 308/350 (88%), Gaps = 15/350 (4%)
 Frame = +2

Query  191   TMEGAIENGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  343
             T EG   NG++N FC+ V         DPLNW  AA+++ GSHLDEVKRMV E+R P VK
Sbjct  2     TQEG---NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVK  57

Query  344   IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  523
             +GG+TLT++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGAT
Sbjct  58    LGGETLTISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGAT  117

Query  524   SHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFE  697
             SHRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAMLVRINTLLQGYSGIRFE
Sbjct  118   SHRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAMLVRINTLLQGYSGIRFE  177

Query  698   ILEAITKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEA  877
             ILEAITKLLN+NITPCLPLRGTITASGD+VPLSYIAGLLTGRPNSKAVGP+G+ L A+EA
Sbjct  178   ILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEILNAKEA  237

Query  878   FKLAGVNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGK  1057
             F+LA ++  FFELQPKEGLALVNGTAVGSG+AS+VLFEANI+AVLSEV+SAIFAEVM GK
Sbjct  238   FELANISAEFFELQPKEGLALVNGTAVGSGLASIVLFEANIIAVLSEVISAIFAEVMQGK  297

Query  1058  PEFTDHLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             PEFTDHL HKLKHHPGQIEAAAIMEHIL+GS ++KAA+KLHE+DPLQKP+
Sbjct  298   PEFTDHLTHKLKHHPGQIEAAAIMEHILEGSSYIKAAKKLHEIDPLQKPK  347



>gb|ADI40166.1| phenylalanine ammonia-lyase [Morus alba]
Length=726

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/341 (78%), Positives = 303/341 (89%), Gaps = 2/341 (1%)
 Frame = +2

Query  191   TMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  370
             ++EG   +  +N   +  D LNW  AA+++KGSHL+EVKRMV E+R PAV +GG+TLT++
Sbjct  17    SLEGICTSSGNNGGIVSGDALNWGAAAEAMKGSHLEEVKRMVEEYRKPAVNLGGETLTIS  76

Query  371   QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  550
             QVAAIA++D  VKVELSE AR GVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  77    QVAAIASQDGGVKVELSEAAREGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGV  136

Query  551   ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLL  724
             A Q+ELIRFLNAGIFG GT   HTLPH+ T AA+LVRINTLLQGYSGIRFEILEA+TKLL
Sbjct  137   AFQKELIRFLNAGIFGNGTESCHTLPHTTTGAALLVRINTLLQGYSGIRFEILEAMTKLL  196

Query  725   NHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDG  904
             N N+TPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGPNG++LTA +AFK+AG+N G
Sbjct  197   NGNVTPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPNGESLTATQAFKVAGINSG  256

Query  905   FFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIH  1084
             FFELQPKEGLALVNGTAVGSG+ASMVLF+ANILAVLSE+LSAIFAEVM GKPEFTDHL H
Sbjct  257   FFELQPKEGLALVNGTAVGSGLASMVLFDANILAVLSEILSAIFAEVMQGKPEFTDHLTH  316

Query  1085  KLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             KLKHHPGQIEAAAIMEHILD S +MKAA+KLHE+DPLQKP+
Sbjct  317   KLKHHPGQIEAAAIMEHILDDSSYMKAAKKLHEIDPLQKPK  357



>ref|XP_010509401.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Camelina sativa]
Length=726

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/323 (83%), Positives = 291/323 (90%), Gaps = 2/323 (1%)
 Frame = +2

Query  245   DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  424
             DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  35    DPLNWGAAAEQMKGSHLDEVKRMVEEFRKPVVNLGGETLTIGQVAAISTIGNGVKVELSE  94

Query  425   GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  604
              ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  95    TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  154

Query  605   --TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASG  778
               T HTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN NITP LPLRGTITASG
Sbjct  155   KETSHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNCNITPSLPLRGTITASG  214

Query  779   DIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGTAV  958
             D+VPLSYIAG+LTGRPNSKA GPNG+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGTAV
Sbjct  215   DLVPLSYIAGILTGRPNSKATGPNGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGTAV  274

Query  959   GSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIMEHI  1138
             GSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIMEHI
Sbjct  275   GSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIMEHI  334

Query  1139  LDGSHFMKAAQKLHEMDPLQKPQ  1207
             LDGS +MK AQKLHEMDPLQKP+
Sbjct  335   LDGSSYMKLAQKLHEMDPLQKPK  357



>ref|XP_006293761.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
 gb|EOA26659.1| hypothetical protein CARUB_v10022721mg [Capsella rubella]
Length=726

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/325 (82%), Positives = 294/325 (90%), Gaps = 2/325 (1%)
 Frame = +2

Query  239   KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVEL  418
             + DPLNW  AAD +KGSHL+EVK+MV +FR P V +GG+TLT+ QVAAI+   N VKVEL
Sbjct  33    EADPLNWGAAADQMKGSHLEEVKKMVEDFRKPVVNLGGETLTIGQVAAISTIGNGVKVEL  92

Query  419   SEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFG  598
             SE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG
Sbjct  93    SETARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFG  152

Query  599   TG--TGHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITA  772
             +   TGHTLPHSATRAAMLVRINTLLQG+SGIRFEILEAIT  LN+NITP LPLRGTITA
Sbjct  153   STKETGHTLPHSATRAAMLVRINTLLQGFSGIRFEILEAITSFLNNNITPSLPLRGTITA  212

Query  773   SGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAGVNDGFFELQPKEGLALVNGT  952
             SGD+VPLSYIAG+LTGRPNSKA GP+G+ALTAEEAFKLAG++ GFF+LQPKEGLALVNGT
Sbjct  213   SGDLVPLSYIAGILTGRPNSKATGPDGEALTAEEAFKLAGISSGFFDLQPKEGLALVNGT  272

Query  953   AVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTDHLIHKLKHHPGQIEAAAIME  1132
             AVGSGMASMVLFE N+L+VL+E+LSA+FAEVM GKPEFTDHL H+LKHHPGQIEAAAIME
Sbjct  273   AVGSGMASMVLFETNVLSVLAEILSAVFAEVMSGKPEFTDHLTHRLKHHPGQIEAAAIME  332

Query  1133  HILDGSHFMKAAQKLHEMDPLQKPQ  1207
             HILDGS +MK AQKLHEMDPLQKP+
Sbjct  333   HILDGSSYMKLAQKLHEMDPLQKPK  357



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/345 (79%), Positives = 304/345 (88%), Gaps = 12/345 (3%)
 Frame = +2

Query  209   ENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  367
             +NGH N    +V       DPLNWEMA DSL+GSHLDEVK+MV EFR P VK+ G+TLTV
Sbjct  7     QNGHVNGEVEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGETLTV  66

Query  368   AQVAAIAARDNAV---KVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  538
             AQVA+IA  DN     KVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF ATSHRRT
Sbjct  67    AQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSHRRT  126

Query  539   KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  712
             KNG ALQ+ELI+FLNAG+FG GT   HTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI
Sbjct  127   KNGGALQKELIKFLNAGVFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAI  186

Query  713   TKLLNHNITPCLPLRGTITASGDIVPLSYIAGLLTGRPNSKAVGPNGQALTAEEAFKLAG  892
             TKL+N NITPCLPLRGT+TASGD+VPLSYIAGLLTGRPNSKAVGP+G  L A+EAF++A 
Sbjct  187   TKLINSNITPCLPLRGTVTASGDLVPLSYIAGLLTGRPNSKAVGPSGSKLDADEAFRVAA  246

Query  893   VNDGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLSEVLSAIFAEVMHGKPEFTD  1072
             V+ GFFELQPKEGLALVNGTAVGSGMAS+VL+++NILAV+ EVLSAIFAEVM+GKPEFTD
Sbjct  247   VSGGFFELQPKEGLALVNGTAVGSGMASIVLYDSNILAVMFEVLSAIFAEVMNGKPEFTD  306

Query  1073  HLIHKLKHHPGQIEAAAIMEHILDGSHFMKAAQKLHEMDPLQKPQ  1207
             +L HKLKHHPGQIEAAAIMEHILDGS ++KAAQKLHEMDPLQKP+
Sbjct  307   YLTHKLKHHPGQIEAAAIMEHILDGSSYVKAAQKLHEMDPLQKPK  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3461876544493