BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6051

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006827209.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    171   1e-46   Amborella trichopoda
ref|XP_010257275.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    169   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010258381.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    166   1e-44   
gb|ABD96050.1|  ATP-utilizing phosphofructokinase                       165   2e-44   Spinacia oleracea
emb|CBI22198.3|  unnamed protein product                                165   2e-44   Vitis vinifera
ref|XP_002278018.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    165   2e-44   Vitis vinifera
ref|XP_010258379.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    165   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_009409133.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    164   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010693230.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    162   3e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009409142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    161   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN60905.1|  hypothetical protein VITISV_028449                     165   1e-42   Vitis vinifera
ref|XP_002464639.1|  hypothetical protein SORBIDRAFT_01g022370          160   2e-42   Sorghum bicolor [broomcorn]
ref|XP_006661761.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    159   4e-42   Oryza brachyantha
gb|ACR35078.1|  unknown                                                 158   7e-42   Zea mays [maize]
ref|NP_001147085.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    158   7e-42   
ref|XP_003573900.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    157   1e-41   Brachypodium distachyon [annual false brome]
gb|EEC66915.1|  hypothetical protein OsI_33512                          157   1e-41   Oryza sativa Indica Group [Indian rice]
gb|EMT10326.1|  6-phosphofructokinase 5, chloroplastic                  157   2e-41   
gb|KCW54605.1|  hypothetical protein EUGRSUZ_I005551                    154   3e-41   Eucalyptus grandis [rose gum]
gb|KCW54606.1|  hypothetical protein EUGRSUZ_I005551                    154   3e-41   Eucalyptus grandis [rose gum]
ref|NP_001064560.1|  Os10g0405600                                       156   4e-41   
ref|XP_004983148.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    156   5e-41   Setaria italica
gb|AAK98672.1|AC021893_6  Putative pyrophosphate--fructose-6-phos...    155   5e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973537.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    156   5e-41   Setaria italica
ref|XP_004956817.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    156   6e-41   Setaria italica
tpg|DAA48945.1|  TPA: hypothetical protein ZEAMMB73_793125              152   6e-41   
tpg|DAA48943.1|  TPA: hypothetical protein ZEAMMB73_793125              151   6e-41   
ref|XP_010917037.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    156   6e-41   Elaeis guineensis
ref|XP_002445557.1|  hypothetical protein SORBIDRAFT_07g021500          154   2e-40   Sorghum bicolor [broomcorn]
ref|XP_010027951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    154   3e-40   Eucalyptus grandis [rose gum]
dbj|BAJ96715.1|  predicted protein                                      149   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010939502.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    153   5e-40   Elaeis guineensis
ref|XP_009404386.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    153   5e-40   
ref|XP_008781839.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    153   6e-40   Phoenix dactylifera
ref|XP_008802617.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    153   7e-40   Phoenix dactylifera
ref|NP_001145725.1|  hypothetical protein                               152   1e-39   Zea mays [maize]
ref|NP_001063175.1|  Os09g0415800                                       152   1e-39   
dbj|BAD28914.1|  putative phosphofructokinase                           151   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660625.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    152   2e-39   Oryza brachyantha
ref|XP_010681044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    152   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS54985.1|  6-phosphofructokinase 5, chloroplastic                  151   3e-39   Triticum urartu
gb|AGN30569.1|  phosphofructokinase PFK07                               151   3e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001061896.2|  Os08g0439000                                       150   3e-39   
gb|EEC83634.1|  hypothetical protein OsI_29365                          151   3e-39   Oryza sativa Indica Group [Indian rice]
dbj|BAD09875.1|  putative diphosphate-fructose-6-phosphate 1-phos...    151   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462379.1|  hypothetical protein SORBIDRAFT_02g024680          150   4e-39   Sorghum bicolor [broomcorn]
gb|EEE68761.1|  hypothetical protein OsJ_27460                          151   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670192.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    150   4e-39   Zea mays [maize]
ref|XP_008781840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    150   5e-39   
ref|XP_008670187.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    150   5e-39   Zea mays [maize]
dbj|BAK04400.1|  predicted protein                                      150   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90129.1|  predicted protein                                      150   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008455602.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    150   7e-39   Cucumis melo [Oriental melon]
dbj|BAJ92720.1|  predicted protein                                      150   8e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006659441.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    150   9e-39   Oryza brachyantha
ref|XP_004137185.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    150   9e-39   Cucumis sativus [cucumbers]
ref|XP_010238165.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    149   1e-38   
ref|XP_006466285.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    149   1e-38   Citrus sinensis [apfelsine]
dbj|BAK00986.1|  predicted protein                                      147   9e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012081642.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    147   1e-37   Jatropha curcas
gb|KJB18250.1|  hypothetical protein B456_003G042800                    146   1e-37   Gossypium raimondii
ref|XP_011021841.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    146   1e-37   Populus euphratica
gb|EMS49605.1|  6-phosphofructokinase 5, chloroplastic                  146   2e-37   Triticum urartu
gb|KJB18251.1|  hypothetical protein B456_003G042800                    145   2e-37   Gossypium raimondii
gb|KJB18249.1|  hypothetical protein B456_003G042800                    145   3e-37   Gossypium raimondii
ref|XP_006426295.1|  hypothetical protein CICLE_v10025337mg             145   3e-37   Citrus clementina [clementine]
gb|KJB18252.1|  hypothetical protein B456_003G042800                    145   3e-37   Gossypium raimondii
ref|XP_007047818.1|  Phosphofructokinase 5 isoform 3                    144   4e-37   
ref|XP_007047817.1|  Phosphofructokinase 5 isoform 2                    144   6e-37   
gb|AIE16183.1|  chloroplast 6-phosphofructokinase 5                     144   8e-37   Nicotiana tabacum [American tobacco]
ref|XP_007047816.1|  Phosphofructokinase 5 isoform 1                    144   9e-37   
ref|XP_010526665.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    144   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_002310313.2|  hypothetical protein POPTR_0007s14380g             144   1e-36   
ref|XP_003574548.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    144   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_008235410.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    144   1e-36   Prunus mume [ume]
ref|XP_009785216.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    144   1e-36   Nicotiana sylvestris
gb|AIE16182.1|  chloroplast 6-phosphofructokinase 4                     144   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_003530616.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    144   1e-36   Glycine max [soybeans]
gb|KHN08327.1|  6-phosphofructokinase 5, chloroplastic                  143   1e-36   Glycine soja [wild soybean]
ref|XP_004288505.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    143   2e-36   Fragaria vesca subsp. vesca
ref|XP_009599322.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    143   2e-36   Nicotiana tomentosiformis
gb|EMT20555.1|  6-phosphofructokinase 5, chloroplastic                  142   5e-36   
gb|KHN20613.1|  6-phosphofructokinase 5, chloroplastic                  142   6e-36   Glycine soja [wild soybean]
ref|XP_007156482.1|  hypothetical protein PHAVU_003G289600g             142   6e-36   Phaseolus vulgaris [French bean]
ref|XP_006293955.1|  hypothetical protein CARUB_v10022950mg             141   8e-36   
ref|XP_008385679.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    141   9e-36   
ref|XP_004236699.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    141   1e-35   Solanum lycopersicum
ref|XP_008385677.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    141   1e-35   Malus domestica [apple tree]
ref|XP_004250136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    141   1e-35   Solanum lycopersicum
ref|XP_007208470.1|  hypothetical protein PRUPE_ppa004086mg             141   1e-35   Prunus persica
gb|AIE47273.1|  phosphofructokinase                                     141   1e-35   Hevea brasiliensis [jebe]
ref|XP_006293956.1|  hypothetical protein CARUB_v10022950mg             140   2e-35   Capsella rubella
ref|XP_010472236.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010417006.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    140   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_003552046.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    140   2e-35   Glycine max [soybeans]
ref|XP_006346747.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    140   2e-35   Solanum tuberosum [potatoes]
ref|XP_010429169.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    140   2e-35   Camelina sativa [gold-of-pleasure]
gb|KFK30402.1|  hypothetical protein AALP_AA7G256400                    140   2e-35   Arabis alpina [alpine rockcress]
ref|XP_009340975.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    140   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009348246.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    140   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_011097501.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    139   4e-35   Sesamum indicum [beniseed]
emb|CDX76918.1|  BnaC08g35040D                                          139   4e-35   
ref|XP_008345156.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    135   4e-35   
emb|CDP01541.1|  unnamed protein product                                139   4e-35   Coffea canephora [robusta coffee]
ref|XP_011100012.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    139   5e-35   Sesamum indicum [beniseed]
gb|EYU30954.1|  hypothetical protein MIMGU_mgv1a004409mg                139   5e-35   Erythranthe guttata [common monkey flower]
emb|CDY13756.1|  BnaA09g42580D                                          139   5e-35   Brassica napus [oilseed rape]
ref|XP_006404705.1|  hypothetical protein EUTSA_v10000117mg             139   5e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009112523.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    139   9e-35   Brassica rapa
emb|CBI18713.3|  unnamed protein product                                138   9e-35   Vitis vinifera
ref|XP_009112522.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    138   9e-35   Brassica rapa
ref|XP_010266371.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    138   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010646328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    138   1e-34   Vitis vinifera
ref|XP_010646329.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    138   1e-34   Vitis vinifera
ref|XP_003517707.2|  PREDICTED: 6-phosphofructokinase 5, chloropl...    138   1e-34   Glycine max [soybeans]
ref|XP_002878619.1|  phosphofructokinase family protein                 138   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010107299.1|  6-phosphofructokinase 5                            138   1e-34   Morus notabilis
gb|EYU39321.1|  hypothetical protein MIMGU_mgv1a004379mg                138   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_003628914.1|  6-phosphofructokinase                              137   2e-34   Medicago truncatula
gb|KFK32811.1|  hypothetical protein AALP_AA6G290900                    136   7e-34   Arabis alpina [alpine rockcress]
ref|XP_010916680.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    136   8e-34   Elaeis guineensis
ref|XP_006411816.1|  hypothetical protein EUTSA_v10024871mg             136   8e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006353187.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    135   1e-33   Solanum tuberosum [potatoes]
gb|AHE93343.1|  phosphofructokinase                                     135   1e-33   Camellia sinensis [black tea]
ref|XP_008795218.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    135   1e-33   Phoenix dactylifera
ref|XP_007158384.1|  hypothetical protein PHAVU_002G148700g             135   2e-33   Phaseolus vulgaris [French bean]
ref|XP_003613090.1|  6-phosphofructokinase                              135   2e-33   Medicago truncatula
ref|NP_850025.1|  6-phosphofructokinase 5                               135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489766.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    131   3e-32   Cicer arietinum [garbanzo]
emb|CDY52512.1|  BnaC03g61050D                                          130   1e-31   Brassica napus [oilseed rape]
ref|XP_009109420.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    129   1e-31   Brassica rapa
emb|CDX90382.1|  BnaA08g16020D                                          125   3e-30   
emb|CAN69658.1|  hypothetical protein VITISV_013008                     124   9e-30   Vitis vinifera
gb|EEC84573.1|  hypothetical protein OsI_31367                          114   8e-26   Oryza sativa Indica Group [Indian rice]
gb|KHN14523.1|  6-phosphofructokinase 5, chloroplastic                98.2    1e-20   Glycine soja [wild soybean]
gb|EMS54761.1|  6-phosphofructokinase 5, chloroplastic                97.8    2e-20   Triticum urartu
ref|XP_002530702.1|  phosphofructokinase, putative                    97.1    3e-20   
ref|XP_004509678.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...  95.5    1e-19   
emb|CBI18715.3|  unnamed protein product                              95.1    2e-19   Vitis vinifera
gb|AAD22353.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...  94.7    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973951.1|  hypothetical protein SELMODRAFT_100675           94.0    9e-19   
ref|XP_001767506.1|  predicted protein                                93.6    1e-18   
gb|ADE76905.1|  unknown                                               84.7    8e-16   Picea sitchensis
ref|XP_009409144.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  81.6    9e-15   
ref|XP_001769358.1|  predicted protein                                78.6    1e-13   
tpg|DAA54690.1|  TPA: hypothetical protein ZEAMMB73_253625            78.2    2e-13   
ref|XP_009144856.1|  PREDICTED: ATP-dependent 6-phosphofructokina...  71.2    3e-11   Brassica rapa
ref|XP_002969111.1|  hypothetical protein SELMODRAFT_146031           62.0    5e-08   
ref|XP_003083008.1|  putative pyrophosphate-fructose-6-phosphate ...  55.8    5e-06   Ostreococcus tauri
gb|KIZ06381.1|  hypothetical protein MNEG_1568                        54.3    2e-05   Monoraphidium neglectum
ref|XP_001778081.1|  predicted protein                                54.3    2e-05   
ref|XP_001422557.1|  predicted protein                                53.1    4e-05   Ostreococcus lucimarinus CCE9901
gb|KIZ02592.1|  hypothetical protein MNEG_5364                        52.4    6e-05   Monoraphidium neglectum
ref|XP_001696305.1|  phosphofructokinase family protein               51.6    1e-04   Chlamydomonas reinhardtii
ref|XP_002505771.1|  phosphofructokinase                              49.3    0.001   Micromonas commoda



>ref|XP_006827209.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Amborella trichopoda]
 gb|ERM94446.1| hypothetical protein AMTR_s00010p00259410 [Amborella trichopoda]
Length=528

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +1

Query  229  SCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDV  408
            +  K  +D  DP WKKKY++EFE RFSLPHL+D FD KP+PTTFS  N  +  +  GI V
Sbjct  54   AVTKPKLDLEDPNWKKKYEDEFEKRFSLPHLRDIFDIKPKPTTFSHKNGNI--SARGIHV  111

Query  409  FDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEV  588
            FDE    YV+D DRALLKVIKY+SPTSAGAE +DPNC+W+E WV RAGPR+ IYF+P EV
Sbjct  112  FDEYSDGYVNDDDRALLKVIKYSSPTSAGAECIDPNCTWVEQWVHRAGPRKQIYFDPTEV  171

Query  589  KAAIV  603
            KA IV
Sbjct  172  KAGIV  176



>ref|XP_010257275.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010257284.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Nelumbo nucifera]
Length=529

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKH  426
            +DF+DP+WKK +QE+FE RF+LPHL+D FD KPRPTTFSL N G     N ID  +++K 
Sbjct  60   IDFSDPDWKKHFQEDFENRFNLPHLRDVFDIKPRPTTFSLHNGGSQILSN-IDAPEDRKS  118

Query  427  SYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             YV+D DRALLKVIKY+SPTSAGAE +DP+CSW+E WV RAGPR+ IYF+P++VKA +V
Sbjct  119  GYVNDDDRALLKVIKYSSPTSAGAECIDPDCSWVEQWVHRAGPRKQIYFDPEKVKAGLV  177



>ref|XP_010258381.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=498

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGI  402
            R +  K  +DF+DP WK K++E+FE RF LPHL+D FD KP PTTFSL NRG     +G 
Sbjct  53   RAAIAKPEIDFSDPYWKNKFKEDFENRFDLPHLRDVFDIKPMPTTFSLHNRGSQIV-SGA  111

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
            D+ +++K+ YV+D DRALLKVIKY+SPTSAGAE +D +CSW+E WV RAGPR+ IYFEP+
Sbjct  112  DLPEDRKNGYVNDDDRALLKVIKYSSPTSAGAECIDADCSWVEQWVHRAGPRKQIYFEPE  171

Query  583  EVKAAIV  603
            +V A IV
Sbjct  172  KVNAGIV  178



>gb|ABD96050.1| ATP-utilizing phosphofructokinase [Spinacia oleracea]
Length=503

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 104/141 (74%), Gaps = 8/141 (6%)
 Frame = +1

Query  202  KPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNR-G  378
            K +F+ CR+  EK  +DF+DP+WK +YQ++ E  F+LPHLKD  D KPRP+TFSL +R G
Sbjct  8    KIRFSACRIVAEKLDIDFSDPDWKTEYQKDLENTFNLPHLKDVLDVKPRPSTFSLMHRDG  67

Query  379  VHPTRNGIDVFD------EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWV  540
                RN  +V D      ++K+ YVD  DR LLKVIKYASPTSAGAE +DPNC+W+E WV
Sbjct  68   SRWLRNE-NVTDRAEGPEDRKNDYVDIDDRTLLKVIKYASPTSAGAECIDPNCTWVEQWV  126

Query  541  PRAGPRRHIYFEPDEVKAAIV  603
             RAGPR+ IYFEP +VKAAIV
Sbjct  127  HRAGPRKEIYFEPTKVKAAIV  147



>emb|CBI22198.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            ++   + +DF DP WK K+QE+FE RF+LPHLKD    KPRPTTFSL NR      NG +
Sbjct  4    IAAGNQEMDFTDPCWKTKFQEDFELRFNLPHLKDVLPIKPRPTTFSLKNRNARLV-NGAN  62

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
            V +++K+ YV++ DRALLKVI+Y+SPTSAGAE +DP+CSW+E WV RAGPR  I+FEP E
Sbjct  63   VLEDRKNGYVNEDDRALLKVIRYSSPTSAGAECIDPDCSWVEQWVHRAGPREEIFFEPGE  122

Query  586  VKAAIV  603
            VKA IV
Sbjct  123  VKAGIV  128



>ref|XP_002278018.2| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Vitis vinifera]
Length=531

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            ++   + +DF DP WK K+QE+FE RF+LPHLKD    KPRPTTFSL NR      NG +
Sbjct  55   IAAGNQEMDFTDPCWKTKFQEDFELRFNLPHLKDVLPIKPRPTTFSLKNRNARLV-NGAN  113

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
            V +++K+ YV++ DRALLKVI+Y+SPTSAGAE +DP+CSW+E WV RAGPR  I+FEP E
Sbjct  114  VLEDRKNGYVNEDDRALLKVIRYSSPTSAGAECIDPDCSWVEQWVHRAGPREEIFFEPGE  173

Query  586  VKAAIV  603
            VKA IV
Sbjct  174  VKAGIV  179



>ref|XP_010258379.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010258380.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=530

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGI  402
            R +  K  +DF+DP WK K++E+FE RF LPHL+D FD KP PTTFSL NRG     +G 
Sbjct  53   RAAIAKPEIDFSDPYWKNKFKEDFENRFDLPHLRDVFDIKPMPTTFSLHNRGSQIV-SGA  111

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
            D+ +++K+ YV+D DRALLKVIKY+SPTSAGAE +D +CSW+E WV RAGPR+ IYFEP+
Sbjct  112  DLPEDRKNGYVNDDDRALLKVIKYSSPTSAGAECIDADCSWVEQWVHRAGPRKQIYFEPE  171

Query  583  EVKAAIV  603
            +V A IV
Sbjct  172  KVNAGIV  178



>ref|XP_009409133.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKH  426
            +DFNDP+WKKK+ E+F+ RF+LPHL+D  D +PRPTTFSL  RG     NG     E  +
Sbjct  61   IDFNDPDWKKKFLEDFDKRFNLPHLRDVLDIQPRPTTFSLKTRGTLEVGNG--AAREDWN  118

Query  427  SYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             +V D DRALLKVIK+ASPTSAGAE +DP+CSW+E WV RAGPR+ IY+EP EVKAAIV
Sbjct  119  GFVSDDDRALLKVIKFASPTSAGAESIDPDCSWVEQWVHRAGPRKQIYYEPREVKAAIV  177



>ref|XP_010693230.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=541

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 100/145 (69%), Gaps = 6/145 (4%)
 Frame = +1

Query  187  GRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSL  366
            GR   K +F  CR+  E   +D +DP+WK  YQ++FE++F+LPHLKD  D KPRP+TFSL
Sbjct  41   GRHSKKRRFAACRIISENLDMDTSDPDWKTNYQKDFESKFNLPHLKDILDVKPRPSTFSL  100

Query  367  SNRGVHPTRNGIDVFD------EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWL  528
              R          V D      ++K+ YVD+ DR LLKVIKYASPTSAGAE +DPNC+W+
Sbjct  101  MQRNRAGWAGNETVTDNAARPKDRKNGYVDNDDRTLLKVIKYASPTSAGAECIDPNCTWV  160

Query  529  ELWVPRAGPRRHIYFEPDEVKAAIV  603
            E WV RAGPR  IYF+P +VKAAIV
Sbjct  161  EQWVHRAGPREDIYFDPKKVKAAIV  185



>ref|XP_009409142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409143.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +1

Query  208  KFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHP  387
            + N   V   K  +DF DP+WKK +QE+F+ RF LPHL D  D KPRPTTFSL +RG  P
Sbjct  48   QVNDISVEVVKPEIDFKDPDWKKHFQEDFDNRFRLPHLTDILDVKPRPTTFSLKSRG--P  105

Query  388  TRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHI  567
              +G     +  + YV+D DRALLKVIK+ASP SAGAE +DP+CSW+E WV RAGPR+ I
Sbjct  106  LDDGNGAPMDTWYGYVNDDDRALLKVIKFASPNSAGAECIDPDCSWVEQWVHRAGPRKQI  165

Query  568  YFEPDEVKAAIV  603
            Y+EP EVKAAIV
Sbjct  166  YYEPKEVKAAIV  177



>emb|CAN60905.1| hypothetical protein VITISV_028449 [Vitis vinifera]
Length=1609

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            ++   + +DF DP WK K+QE+FE RF+LPHLKD    KPRPTTFSL NR      NG +
Sbjct  55   IAAGNQEMDFTDPCWKTKFQEDFELRFNLPHLKDVLPIKPRPTTFSLKNRNAQLV-NGAN  113

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
            V +++K+ YV++ DRALLKVI+Y+SPTSAGAE +DP+CSW+E WV RAGPR  I+FEP E
Sbjct  114  VLEDRKNGYVNEDDRALLKVIRYSSPTSAGAECIDPDCSWVEQWVHRAGPREEIFFEPGE  173

Query  586  VKAAIV  603
            VKA IV
Sbjct  174  VKAGIV  179



>ref|XP_002464639.1| hypothetical protein SORBIDRAFT_01g022370 [Sorghum bicolor]
 gb|EER91637.1| hypothetical protein SORBIDRAFT_01g022370 [Sorghum bicolor]
Length=524

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++P+WKK++QE+F  RFSLPHL+D  D +PRPTTFSL +R   P  N   
Sbjct  49   ISVDQPQLDFSNPDWKKQFQEDFNKRFSLPHLRDVIDVEPRPTTFSLKSR--TPLENVNG  106

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
               E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  107  TMQESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQY  166

Query  586  VKAAIV  603
            VKA IV
Sbjct  167  VKAGIV  172



>ref|XP_006661761.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=525

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++P+WKK++QE+F  RFSLPHLKD  D +PRPTTFSL +R   P  N   
Sbjct  50   ISVDRSQLDFSNPDWKKQFQEDFNRRFSLPHLKDVIDVEPRPTTFSLKSRA--PLENVNG  107

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
               E  + YV+D DRALLKVIK+ASPTSAGA  +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  108  SIQESWNGYVNDDDRALLKVIKFASPTSAGAYCIDPDCSWVEQWVHRAGPRKQIYFEPPY  167

Query  586  VKAAIV  603
            VKA IV
Sbjct  168  VKAGIV  173



>gb|ACR35078.1| unknown [Zea mays]
 tpg|DAA50030.1| TPA: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
[Zea mays]
Length=525

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            VS ++  +DF++P+WK ++QE+F+ RFSLPHL D  D +PRPTTFSL +R   P  N   
Sbjct  50   VSVDRTQLDFSNPDWKTQFQEDFDKRFSLPHLTDVIDVEPRPTTFSLKSRA--PLENANG  107

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
                  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  108  TMQGSWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQY  167

Query  586  VKAAIV  603
            VKA IV
Sbjct  168  VKAGIV  173



>ref|NP_001147085.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Zea 
mays]
 gb|ACG25393.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Zea 
mays]
Length=525

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            VS ++  +DF++P+WK ++QE+F+ RFSLPHL D  D +PRPTTFSL +R   P  N   
Sbjct  50   VSVDRTQLDFSNPDWKTQFQEDFDKRFSLPHLTDVIDVEPRPTTFSLKSRA--PLENANG  107

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
                  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  108  TMQGSWNGYVNDYDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQY  167

Query  586  VKAAIV  603
            VKA IV
Sbjct  168  VKAGIV  173



>ref|XP_003573900.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010234716.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=527

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +1

Query  142  CFLTHSPTR---NGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSL  312
            CF  HS      N Y +  R     +     +S ++  +DF+ P+WK  +QE+F+ RFSL
Sbjct  22   CFPVHSCNHLRCNAYEKKSR--TSDQLVIRAISVDRPQLDFSIPDWKNLFQEDFDRRFSL  79

Query  313  PHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSA  492
            PHL D    +PRPTTFSL +    P  NG   FDE  + YV+D DRALLKVIK+ASPTSA
Sbjct  80   PHLTDVIHLEPRPTTFSLKSSRT-PLENGSGPFDESWNGYVNDDDRALLKVIKFASPTSA  138

Query  493  GAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            GA+ +DP+CSW+E WV RAGPR+ IYFEP  VKA IV
Sbjct  139  GADCIDPDCSWVEQWVHRAGPRKQIYFEPQSVKAGIV  175



>gb|EEC66915.1| hypothetical protein OsI_33512 [Oryza sativa Indica Group]
Length=524

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 8/144 (6%)
 Frame = +1

Query  190  RCV-VKPKFNYCR-----VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRP  351
            RCV    K   CR     +S ++  +DF++ +WKK++QE+F++RFSLPHLKD  D +PRP
Sbjct  31   RCVRYNKKSRTCRLVTRAISVDRPQLDFSNSDWKKQFQEDFDSRFSLPHLKDVIDVEPRP  90

Query  352  TTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLE  531
            TTFSL +R   P  N         + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E
Sbjct  91   TTFSLKSR--TPLENVNGSMQGSWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVE  148

Query  532  LWVPRAGPRRHIYFEPDEVKAAIV  603
             WV RAGPR+ IYFEP  VKA IV
Sbjct  149  QWVHRAGPRKQIYFEPQYVKAGIV  172



>gb|EMT10326.1| 6-phosphofructokinase 5, chloroplastic [Aegilops tauschii]
Length=543

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 101/148 (68%), Gaps = 12/148 (8%)
 Frame = +1

Query  172  GYGR----GGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDA  339
            GYG     GG  VV+       +S ++  +DF++P WK ++QE+F+ RFSLPHL D  D 
Sbjct  35   GYGNKSRAGGHLVVRA------MSMDRLKLDFSNPNWKNQFQEDFDRRFSLPHLTDIIDV  88

Query  340  KPRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNC  519
            + RPTTFSL +R   P  N     +E  + YV+D DRALLKVIK+ASPTSAGAE +DP+C
Sbjct  89   ESRPTTFSLKSR--TPLENVDGSLEESWNGYVNDDDRALLKVIKFASPTSAGAECIDPDC  146

Query  520  SWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            SW+E WV RAGPR+ IYFEP  VKA IV
Sbjct  147  SWVEQWVHRAGPRKQIYFEPQCVKAGIV  174



>gb|KCW54605.1| hypothetical protein EUGRSUZ_I005551, partial [Eucalyptus grandis]
Length=344

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  172  GYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPR  348
            G G+GG  VVK +        ++  +DF+DP WK K+Q +FE+RF LPHLKD F DA P 
Sbjct  49   GIGQGG--VVKNEIKNAGGQRDRTAIDFSDPGWKPKFQRDFESRFDLPHLKDVFPDAVPI  106

Query  349  PTTFSLSNRGVHPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCS  522
            P+TF L  R   PT    D +  DE+ H Y++++DR LLKVI Y+SPTSAGA+ +DP+CS
Sbjct  107  PSTFCLRMR--SPTEEFADGYPSDEKWHGYINNSDRVLLKVIHYSSPTSAGAQCIDPDCS  164

Query  523  WLELWVPRAGPRRHIYFEPDEVKAAIV  603
            W+E WV RAGPR  IYF P+EVKAAIV
Sbjct  165  WVEQWVHRAGPREEIYFRPEEVKAAIV  191



>gb|KCW54606.1| hypothetical protein EUGRSUZ_I005551, partial [Eucalyptus grandis]
Length=345

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  172  GYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPR  348
            G G+GG  VVK +        ++  +DF+DP WK K+Q +FE+RF LPHLKD F DA P 
Sbjct  49   GIGQGG--VVKNEIKNAGGQRDRTAIDFSDPGWKPKFQRDFESRFDLPHLKDVFPDAVPI  106

Query  349  PTTFSLSNRGVHPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCS  522
            P+TF L  R   PT    D +  DE+ H Y++++DR LLKVI Y+SPTSAGA+ +DP+CS
Sbjct  107  PSTFCLRMR--SPTEEFADGYPSDEKWHGYINNSDRVLLKVIHYSSPTSAGAQCIDPDCS  164

Query  523  WLELWVPRAGPRRHIYFEPDEVKAAIV  603
            W+E WV RAGPR  IYF P+EVKAAIV
Sbjct  165  WVEQWVHRAGPREEIYFRPEEVKAAIV  191



>ref|NP_001064560.1| Os10g0405600 [Oryza sativa Japonica Group]
 gb|ABB47570.1| Phosphofructokinase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26474.1| Os10g0405600 [Oryza sativa Japonica Group]
 gb|EEE50929.1| hypothetical protein OsJ_31463 [Oryza sativa Japonica Group]
Length=524

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 8/144 (6%)
 Frame = +1

Query  190  RCV-VKPKFNYCR-----VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRP  351
            RCV    K   CR     +S ++  +DF++ +WKK++QE+F+ RFSLPHLKD  D +PRP
Sbjct  31   RCVRYNKKSRTCRLVTRAISVDRPQLDFSNSDWKKQFQEDFDRRFSLPHLKDVIDVEPRP  90

Query  352  TTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLE  531
            TTFSL +R   P  N         + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E
Sbjct  91   TTFSLKSR--TPLENVNGSMQGSWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVE  148

Query  532  LWVPRAGPRRHIYFEPDEVKAAIV  603
             WV RAGPR+ IYFEP  VKA IV
Sbjct  149  QWVHRAGPRKQIYFEPQYVKAGIV  172



>ref|XP_004983148.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Setaria 
italica]
Length=525

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++P WKK++QE+F+  FSLPHL+D  D +PRPTTFSL +R   P  N   
Sbjct  50   ISVDRPQLDFSNPNWKKQFQEDFDKCFSLPHLRDVIDVEPRPTTFSLKSR--IPLENVNG  107

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
               E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  108  SMQESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQY  167

Query  586  VKAAIV  603
            VKA IV
Sbjct  168  VKAGIV  173



>gb|AAK98672.1|AC021893_6 Putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
Length=490

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 100/144 (69%), Gaps = 8/144 (6%)
 Frame = +1

Query  190  RCV-VKPKFNYCR-----VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRP  351
            RCV    K   CR     +S ++  +DF++ +WKK++QE+F+ RFSLPHLKD  D +PRP
Sbjct  31   RCVRYNKKSRTCRLVTRAISVDRPQLDFSNSDWKKQFQEDFDRRFSLPHLKDVIDVEPRP  90

Query  352  TTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLE  531
            TTFSL +R   P  N         + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E
Sbjct  91   TTFSLKSRT--PLENVNGSMQGSWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVE  148

Query  532  LWVPRAGPRRHIYFEPDEVKAAIV  603
             WV RAGPR+ IYFEP  VKA IV
Sbjct  149  QWVHRAGPRKQIYFEPQYVKAGIV  172



>ref|XP_004973537.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004973538.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004973539.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like isoform 
X3 [Setaria italica]
Length=527

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGI  402
            + +  K  +DFNDP WK+K+QE++E RFSLP + D +D KPRPTTFSL           +
Sbjct  53   KATSSKVELDFNDPSWKQKFQEDWEQRFSLPSITDIYDLKPRPTTFSLKKNRTPTGDENV  112

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
            D+++     YV++ DRALLKVIKY+SPTSAGAE +DP CSW+E WV RAGPR+ IY+EP+
Sbjct  113  DMWN----GYVNNDDRALLKVIKYSSPTSAGAECIDPECSWVEQWVHRAGPRKEIYYEPE  168

Query  583  EVKAAIV  603
            EVKAAIV
Sbjct  169  EVKAAIV  175



>ref|XP_004956817.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Setaria 
italica]
Length=529

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 100/139 (72%), Gaps = 3/139 (2%)
 Frame = +1

Query  190  RCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS  369
            +C  +    + R    K  +DF+DP WK+KYQE+++ RFSLPH+ D +D +PR TTFSL 
Sbjct  41   KCRKRSVLLHVRAISGKLDLDFSDPSWKQKYQEDWDRRFSLPHITDIYDMEPRTTTFSLK  100

Query  370  -NRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPR  546
             NR   P  +G     + ++ YV+  DRALLKVIKYASPTSAGAE +DP+CSW+E WV R
Sbjct  101  KNRT--PLGDGDVSSTDMRNGYVNKDDRALLKVIKYASPTSAGAECIDPDCSWVEHWVHR  158

Query  547  AGPRRHIYFEPDEVKAAIV  603
            AGPR+ IY+EP+EVKAAIV
Sbjct  159  AGPRKEIYYEPEEVKAAIV  177



>tpg|DAA48945.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
Length=303

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = +1

Query  196  VVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNR  375
            ++KP     RV+  K  +D  DP WK+K+QE++E+RF LP + D +D KPRPTTFSL   
Sbjct  44   IIKPAPLCARVTSSKVELDVKDPYWKQKFQEDWESRFDLPSITDIYDLKPRPTTFSLKKN  103

Query  376  GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGP  555
                    +D+++     YV++ DRALLKVIKY+SPTSAGAE VD +CSW+E WV RAGP
Sbjct  104  RTLTGDENVDMWN----GYVNNDDRALLKVIKYSSPTSAGAECVDLDCSWVEQWVHRAGP  159

Query  556  RRHIYFEPDEVKAAIV  603
            R+ IY+EP+EVKAAIV
Sbjct  160  RKEIYYEPEEVKAAIV  175



>tpg|DAA48943.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
 tpg|DAA48944.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
Length=294

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = +1

Query  196  VVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNR  375
            ++KP     RV+  K  +D  DP WK+K+QE++E+RF LP + D +D KPRPTTFSL   
Sbjct  44   IIKPAPLCARVTSSKVELDVKDPYWKQKFQEDWESRFDLPSITDIYDLKPRPTTFSLKKN  103

Query  376  GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGP  555
                    +D+++     YV++ DRALLKVIKY+SPTSAGAE VD +CSW+E WV RAGP
Sbjct  104  RTLTGDENVDMWN----GYVNNDDRALLKVIKYSSPTSAGAECVDLDCSWVEQWVHRAGP  159

Query  556  RRHIYFEPDEVKAAIV  603
            R+ IY+EP+EVKAAIV
Sbjct  160  RKEIYYEPEEVKAAIV  175



>ref|XP_010917037.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=527

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGI  402
            R    K  VDF DP+WK  +QE+F+ RF+LPHL+D  D +PRPTTFSL +RG  P  +G 
Sbjct  51   RAVIFKPEVDFKDPDWKMHFQEDFDRRFNLPHLRDILDVQPRPTTFSLKSRG--PLHDGN  108

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
               +   + YV+D DRALLKVIK++SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP+
Sbjct  109  GAPEGVWNGYVNDDDRALLKVIKFSSPHSAGAECIDPDCSWVEQWVHRAGPRKQIYYEPE  168

Query  583  EVKAAIV  603
            EVKA IV
Sbjct  169  EVKAGIV  175



>ref|XP_002445557.1| hypothetical protein SORBIDRAFT_07g021500 [Sorghum bicolor]
 gb|EES15052.1| hypothetical protein SORBIDRAFT_07g021500 [Sorghum bicolor]
Length=527

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +1

Query  199  VKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRG  378
            +KP     R +  K  +DF+DP WK+K+QE++E RF+LP + D +D KPRPTTFSL    
Sbjct  45   IKPAPLCVRATSSKVELDFHDPSWKQKFQEDWERRFNLPSITDIYDLKPRPTTFSLKKNR  104

Query  379  VHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
                   +D+++     YV++ DRALLKVIKY+SPTSAGAE +DP+CSW+E WV RAGPR
Sbjct  105  TLTGDENVDMWN----GYVNNDDRALLKVIKYSSPTSAGAECIDPDCSWVEQWVHRAGPR  160

Query  559  RHIYFEPDEVKAAIV  603
            + IY+EP EVKAAIV
Sbjct  161  KEIYYEPAEVKAAIV  175



>ref|XP_010027951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Eucalyptus grandis]
Length=543

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  172  GYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPR  348
            G G+GG  VVK +        ++  +DF+DP WK K+Q +FE+RF LPHLKD F DA P 
Sbjct  49   GIGQGG--VVKNEIKNAGGQRDRTAIDFSDPGWKPKFQRDFESRFDLPHLKDVFPDAVPI  106

Query  349  PTTFSLSNRGVHPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCS  522
            P+TF L  R   PT    D +  DE+ H Y++++DR LLKVI Y+SPTSAGA+ +DP+CS
Sbjct  107  PSTFCLRMRS--PTEEFADGYPSDEKWHGYINNSDRVLLKVIHYSSPTSAGAQCIDPDCS  164

Query  523  WLELWVPRAGPRRHIYFEPDEVKAAIV  603
            W+E WV RAGPR  IYF P+EVKAAIV
Sbjct  165  WVEQWVHRAGPREEIYFRPEEVKAAIV  191



>dbj|BAJ96715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++  WK ++QE+F+ RFSLPHL D  D + RPTTFSL +R   P  N   
Sbjct  52   MSMDRPKLDFSNSNWKDQFQEDFDRRFSLPHLTDIIDVESRPTTFSLKSRA--PLENVTG  109

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
              +E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  110  SSEESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQC  169

Query  586  VKAAIV  603
            VKA IV
Sbjct  170  VKAGIV  175



>ref|XP_010939502.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010939505.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=529

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDE  417
            K  +DF DP WKK +QE+++ RF+LPHL D  D KPRPTTFSL  RG     NG    ++
Sbjct  58   KPDIDFKDPNWKKHFQEDWDRRFNLPHLTDILDLKPRPTTFSLKKRGSPENVNGAP--ND  115

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            +++ YV + DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IYFEPD  KA 
Sbjct  116  RRNDYVYNDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKQIYFEPDVAKAG  175

Query  598  IV  603
            IV
Sbjct  176  IV  177



>ref|XP_009404386.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404394.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKH  426
            +DF+DP+WK+ +QE+F+ RF+LPHL+D    KPRPTTFSL +R   P  +G        +
Sbjct  61   IDFSDPDWKRHFQEDFDKRFNLPHLRDILAIKPRPTTFSLKSR--IPLDDGDGAATGSWN  118

Query  427  SYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             YV+D DRALLKVIK+AS TSAGAE +DP+CSW+E WV RAGPR+ IYFEP EVKA IV
Sbjct  119  GYVNDDDRALLKVIKFASSTSAGAECIDPDCSWVEQWVHRAGPRKQIYFEPREVKAGIV  177



>ref|XP_008781839.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=529

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKH  426
            VDF DP+WK  +QE+F  RF+LPHL+D  D +PRPTTFSL +R   P  +G     +  +
Sbjct  61   VDFKDPDWKMHFQEDFNKRFNLPHLRDILDVQPRPTTFSLKSRS--PLDDGNGAPKDVWN  118

Query  427  SYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             YV+D DRALLKVIK++SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP+EVKA IV
Sbjct  119  GYVNDDDRALLKVIKFSSPHSAGAECIDPDCSWVEQWVHRAGPRKQIYYEPEEVKAGIV  177



>ref|XP_008802617.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Phoenix dactylifera]
Length=529

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 97/147 (66%), Gaps = 12/147 (8%)
 Frame = +1

Query  163  TRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAK  342
            TRNG+           F   +    K  +DF D  WKK +QE+++ RF+LPHL D  D  
Sbjct  43   TRNGF----------LFMDVKAVAVKPDIDFEDANWKKHFQEDWDRRFNLPHLTDILDVM  92

Query  343  PRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCS  522
            PRPTTFSL  RG     NG    +++++ YV + DRALLKVIKY+SP SAGAE +DP+CS
Sbjct  93   PRPTTFSLKKRGSPENINGAS--NDRRNDYVYNDDRALLKVIKYSSPNSAGAECIDPDCS  150

Query  523  WLELWVPRAGPRRHIYFEPDEVKAAIV  603
            W+E WV RAGPR+ IYFEP+EVKA IV
Sbjct  151  WVEQWVHRAGPRKQIYFEPNEVKAGIV  177



>ref|NP_001145725.1| hypothetical protein [Zea mays]
 ref|XP_008672494.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672500.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACL52464.1| unknown [Zea mays]
 tpg|DAA48942.1| TPA: hypothetical protein ZEAMMB73_793125 [Zea mays]
Length=527

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = +1

Query  196  VVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNR  375
            ++KP     RV+  K  +D  DP WK+K+QE++E+RF LP + D +D KPRPTTFSL   
Sbjct  44   IIKPAPLCARVTSSKVELDVKDPYWKQKFQEDWESRFDLPSITDIYDLKPRPTTFSLKKN  103

Query  376  GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGP  555
                    +D+++     YV++ DRALLKVIKY+SPTSAGAE VD +CSW+E WV RAGP
Sbjct  104  RTLTGDENVDMWN----GYVNNDDRALLKVIKYSSPTSAGAECVDLDCSWVEQWVHRAGP  159

Query  556  RRHIYFEPDEVKAAIV  603
            R+ IY+EP+EVKAAIV
Sbjct  160  RKEIYYEPEEVKAAIV  175



>ref|NP_001063175.1| Os09g0415800 [Oryza sativa Japonica Group]
 dbj|BAF25089.1| Os09g0415800 [Oryza sativa Japonica Group]
Length=527

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 6/134 (4%)
 Frame = +1

Query  205  PKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGV  381
            P     R    K  +DF+DP WK+KYQE++  RFSLPH+ D +D KPR TTFSL  NR  
Sbjct  47   PMVLSVRAVSGKSDLDFSDPSWKEKYQEDWNRRFSLPHITDIYDLKPRLTTFSLKKNR--  104

Query  382  HPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRR  561
                +G  +  ++ + YV+  DRALLKVIKYASPTSAGAE VDP+CSW+E W+ RAGPR+
Sbjct  105  ---TDGGSLSADKWNGYVNKDDRALLKVIKYASPTSAGAECVDPDCSWVEHWIHRAGPRK  161

Query  562  HIYFEPDEVKAAIV  603
             IY+EP EVKAAIV
Sbjct  162  EIYYEPAEVKAAIV  175



>dbj|BAD28914.1| putative phosphofructokinase [Oryza sativa Japonica Group]
 dbj|BAD29254.1| putative phosphofructokinase [Oryza sativa Japonica Group]
 gb|EEE69704.1| hypothetical protein OsJ_29365 [Oryza sativa Japonica Group]
Length=480

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 6/128 (5%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            R    K  +DF+DP WK+KYQE++  RFSLPH+ D +D KPR TTFSL  NR      +G
Sbjct  6    RAVSGKSDLDFSDPSWKEKYQEDWNRRFSLPHITDIYDLKPRLTTFSLKKNR-----TDG  60

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKYASPTSAGAE VDP+CSW+E W+ RAGPR+ IY+EP
Sbjct  61   GSLSADKWNGYVNKDDRALLKVIKYASPTSAGAECVDPDCSWVEHWIHRAGPRKEIYYEP  120

Query  580  DEVKAAIV  603
             EVKAAIV
Sbjct  121  AEVKAAIV  128



>ref|XP_006660625.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=522

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGI  402
            R    K  +DF+DP WK+KYQE++  RFSLPH+ D +D KPR TTFSL            
Sbjct  48   RAVSGKPDLDFSDPSWKQKYQEDWNRRFSLPHITDIYDLKPRLTTFSLKKNRSEAGNLSA  107

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
            D+++     YV+  DRALLKVIKYASPTSAGAE VDP+CSW+E W+ RAGPR+ IY+EP+
Sbjct  108  DMWN----GYVNKDDRALLKVIKYASPTSAGAECVDPDCSWVEHWIHRAGPRKEIYYEPE  163

Query  583  EVKAAIV  603
            EVKAAIV
Sbjct  164  EVKAAIV  170



>ref|XP_010681044.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=533

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 16/131 (12%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPT  390
            K+ +D +DPEWK KYQ+EFE RF LPHL DTF D KPRP+TF L  R        G +P+
Sbjct  58   KEEIDLSDPEWKTKYQQEFERRFDLPHLTDTFKDLKPRPSTFCLKMRSPVIEDFAGGYPS  117

Query  391  RNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
                   DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IY
Sbjct  118  -------DEKWHGYINNNDRVLLKVIHYSSPTSAGAECIDPDCTWVEQWVHRAGPREEIY  170

Query  571  FEPDEVKAAIV  603
            F P+EV AAIV
Sbjct  171  FRPEEVNAAIV  181



>gb|EMS54985.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=543

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++  WK ++QE+F+ RFSLPHL D  D + RPTTFSL +R   P  N   
Sbjct  51   MSMDRPKLDFSNLNWKNQFQEDFDRRFSLPHLTDIIDVESRPTTFSLKSR--TPLENVDG  108

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
              +E  + YV+D DRALLKVIK+ASPTSAGAE +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  109  SLEESWNGYVNDNDRALLKVIKFASPTSAGAECIDPDCSWVEQWVHRAGPRKQIYFEPQC  168

Query  586  VKAAIV  603
            VKA IV
Sbjct  169  VKAGIV  174



>gb|AGN30569.1| phosphofructokinase PFK07 [Oryza sativa Indica Group]
Length=529

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE+++ RF+LP + D +D KPRPTTFSL  NR      NG
Sbjct  52   KATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENG  111

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  112  TPM--DKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  169

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  170  EEVKAAIV  177



>ref|NP_001061896.2| Os08g0439000 [Oryza sativa Japonica Group]
 dbj|BAF23810.2| Os08g0439000 [Oryza sativa Japonica Group]
Length=489

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE+++ RF+LP + D +D KPRPTTFSL  NR      NG
Sbjct  52   KATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENG  111

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  112  TPM--DKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  169

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  170  EEVKAAIV  177



>gb|EEC83634.1| hypothetical protein OsI_29365 [Oryza sativa Indica Group]
Length=529

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE+++ RF+LP + D +D KPRPTTFSL  NR      NG
Sbjct  52   KATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENG  111

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  112  TPM--DKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  169

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  170  EEVKAAIV  177



>dbj|BAD09875.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
 dbj|BAD10161.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Oryza sativa Japonica Group]
Length=535

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE+++ RF+LP + D +D KPRPTTFSL  NR      NG
Sbjct  52   KATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENG  111

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  112  TPM--DKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  169

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  170  EEVKAAIV  177



>ref|XP_002462379.1| hypothetical protein SORBIDRAFT_02g024680 [Sorghum bicolor]
 gb|EER98900.1| hypothetical protein SORBIDRAFT_02g024680 [Sorghum bicolor]
Length=529

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 104/155 (67%), Gaps = 7/155 (5%)
 Frame = +1

Query  157  SPTRN----GYGRGGRCVVKPKFNYCRVSCE--KKGVDFNDPEWKKKYQEEFEARFSLPH  318
            SPT++    G+ +  R   + KF    V+    K  +DF DP W +KYQE++  RFSLPH
Sbjct  24   SPTKDRCQYGFTQLSRQKYRKKFAALHVTATSGKLDLDFTDPSWNQKYQEDWNRRFSLPH  83

Query  319  LKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGA  498
            + D +D +PR TTFSL    + P  +G     +  + YV+ +DRALLKVIKYASPTSAGA
Sbjct  84   ITDIYDLEPRRTTFSLKKNRI-PLGDGDGSSADMWNGYVNKSDRALLKVIKYASPTSAGA  142

Query  499  EGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
              +DP+CSW+E WV RAGPR+ IY+EP+EVKAAIV
Sbjct  143  LCIDPDCSWVEHWVHRAGPRKEIYYEPEEVKAAIV  177



>gb|EEE68761.1| hypothetical protein OsJ_27460 [Oryza sativa Japonica Group]
Length=566

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE+++ RF+LP + D +D KPRPTTFSL  NR      NG
Sbjct  90   KATSTKVELDFNDPSWKQKFQEDWDKRFNLPRITDIYDLKPRPTTFSLKKNRSPAGDENG  149

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV+  DRALLKVIKY+SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  150  TPM--DKWNGYVNSDDRALLKVIKYSSPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  207

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  208  EEVKAAIV  215



>ref|XP_008670192.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Zea mays]
 tpg|DAA40074.1| TPA: hypothetical protein ZEAMMB73_770546 [Zea mays]
 tpg|DAA40075.1| TPA: hypothetical protein ZEAMMB73_770546 [Zea mays]
Length=527

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDE  417
            K  +DF DP W +KYQE++  RFSLPH+ D +D +PR TTFSL    + P  +G     +
Sbjct  55   KLDLDFTDPSWNQKYQEDWNRRFSLPHINDIYDLEPRRTTFSLKKNRI-PLGDGDGSSTD  113

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
              + YV+  DRALLKVIKYASPTSAGAE +DP+CSW+E WV RAGPR+ IY+EP+EVKAA
Sbjct  114  MWNGYVNKNDRALLKVIKYASPTSAGAECIDPDCSWVEHWVHRAGPRKEIYYEPEEVKAA  173

Query  598  IV  603
            IV
Sbjct  174  IV  175



>ref|XP_008781840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=528

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKH  426
            VDF DP+WK  +QE+F  RF+LPHL+D  D +PRPTTFSL +    P  +G     +  +
Sbjct  61   VDFKDPDWKMHFQEDFNKRFNLPHLRDILDVQPRPTTFSLKSS---PLDDGNGAPKDVWN  117

Query  427  SYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             YV+D DRALLKVIK++SP SAGAE +DP+CSW+E WV RAGPR+ IY+EP+EVKA IV
Sbjct  118  GYVNDDDRALLKVIKFSSPHSAGAECIDPDCSWVEQWVHRAGPRKQIYYEPEEVKAGIV  176



>ref|XP_008670187.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670189.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670190.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008670191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
isoform X1 [Zea mays]
Length=536

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDE  417
            K  +DF DP W +KYQE++  RFSLPH+ D +D +PR TTFSL    + P  +G     +
Sbjct  55   KLDLDFTDPSWNQKYQEDWNRRFSLPHINDIYDLEPRRTTFSLKKNRI-PLGDGDGSSTD  113

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
              + YV+  DRALLKVIKYASPTSAGAE +DP+CSW+E WV RAGPR+ IY+EP+EVKAA
Sbjct  114  MWNGYVNKNDRALLKVIKYASPTSAGAECIDPDCSWVEHWVHRAGPRKEIYYEPEEVKAA  173

Query  598  IV  603
            IV
Sbjct  174  IV  175



>dbj|BAK04400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++  WK ++QE+F+ RFSLPHL D  D + RPTTFSL +R   P  N   
Sbjct  52   MSMDRPKLDFSNSNWKDQFQEDFDRRFSLPHLTDIIDVESRPTTFSLKSRA--PLENVTG  109

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
              +E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  110  SSEESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQC  169

Query  586  VKAAIV  603
            VKA IV
Sbjct  170  VKAGIV  175



>dbj|BAJ90129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++  WK ++QE+F+ RFSLPHL D  D + RPTTFSL +R   P  N   
Sbjct  52   MSMDRPKLDFSNSNWKDQFQEDFDRRFSLPHLTDIIDVESRPTTFSLKSRA--PLENVTG  109

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
              +E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  110  SSEESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQC  169

Query  586  VKAAIV  603
            VKA IV
Sbjct  170  VKAGIV  175



>ref|XP_008455602.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic [Cucumis melo]
Length=533

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 92/130 (71%), Gaps = 12/130 (9%)
 Frame = +1

Query  235  EKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF  411
            +   +DFNDP+WK KYQ +FE RF+LPH+ D F DA P P+TF L  R   P     DVF
Sbjct  57   KNTAIDFNDPDWKLKYQADFEKRFNLPHITDVFVDALPIPSTFCLKMR--TPVS---DVF  111

Query  412  ------DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
                  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IYF
Sbjct  112  AGGYPSDEEWHGYINNNDRVLLKVINYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIYF  171

Query  574  EPDEVKAAIV  603
            +P+EVKAAIV
Sbjct  172  KPEEVKAAIV  181



>dbj|BAJ92720.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S ++  +DF++  WK ++QE+F+ RFSLPHL D  D + RPTTFSL +R   P  N   
Sbjct  52   MSMDRPKLDFSNSNWKDQFQEDFDRRFSLPHLTDIIDVESRPTTFSLKSRA--PLENVTG  109

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDE  585
              +E  + YV+D DRALLKVIK+ASPTSAGA+ +DP+CSW+E WV RAGPR+ IYFEP  
Sbjct  110  SSEESWNGYVNDDDRALLKVIKFASPTSAGADCIDPDCSWVEQWVHRAGPRKQIYFEPQC  169

Query  586  VKAAIV  603
            VKA IV
Sbjct  170  VKAGIV  175



>ref|XP_006659441.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Oryza 
brachyantha]
Length=529

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNG  399
            + +  K  +DFNDP WK+K+QE ++ RF LP + D +D KPR TTFSL  NR      NG
Sbjct  52   KATSTKVELDFNDPSWKQKFQENWDKRFDLPRITDIYDLKPRATTFSLKKNRNSAGDENG  111

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
              +  ++ + YV++ DRALLKVIKYASP SAGAE +DP+CSW+E WV RAGPR+ IY+EP
Sbjct  112  TPM--DKWNGYVNNDDRALLKVIKYASPNSAGAECIDPDCSWVEQWVHRAGPRKEIYYEP  169

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  170  EEVKAAIV  177



>ref|XP_004137185.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Cucumis sativus]
 gb|KGN53656.1| hypothetical protein Csa_4G097630 [Cucumis sativus]
Length=532

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 92/130 (71%), Gaps = 12/130 (9%)
 Frame = +1

Query  235  EKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF  411
            +   +DFNDP+WK KYQ +FE RF+LPH+ D F DA P P+TF L  R   P     DVF
Sbjct  56   KNTAIDFNDPDWKLKYQADFEKRFNLPHITDVFVDAVPIPSTFCLKMRT--PVS---DVF  110

Query  412  ------DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
                  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IYF
Sbjct  111  AGGYPSDEEWHGYINNNDRVLLKVINYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIYF  170

Query  574  EPDEVKAAIV  603
            +P+EVKAAIV
Sbjct  171  KPEEVKAAIV  180



>ref|XP_010238165.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=531

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTRNGIDVFDEQK  423
            +DF+DP WK+KYQE+++ RFSLPH+ D FD KPR T+FSL  NR   P  +      +  
Sbjct  62   LDFSDPSWKQKYQEDWDMRFSLPHITDIFDLKPRLTSFSLKKNR--TPLGDNDGSSPDMW  119

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            + YV+  DRALLKVIKYASPTSAG+E +DP+CSW+E WV RAGPR+ IY+EP+EVKAAIV
Sbjct  120  NGYVNKDDRALLKVIKYASPTSAGSECIDPDCSWVEHWVHRAGPRKEIYYEPEEVKAAIV  179



>ref|XP_006466285.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Citrus 
sinensis]
Length=532

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +1

Query  229  SCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGID  405
            S    G+DFNDP+WK K+Q +FE RFSLPH+ D F DA P P+TF L  R    T +  D
Sbjct  54   SARASGLDFNDPDWKSKFQSDFEKRFSLPHITDIFRDATPIPSTFCLRMR-TPVTEDFAD  112

Query  406  VF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
             +  DE+ H Y+++ DR LLKVI ++SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P
Sbjct  113  GYPSDEKWHGYINNNDRVLLKVINFSSPTSAGAECIDPDCTWVEQWVHRAGPREEIYFKP  172

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  173  EEVKAAIV  180



>dbj|BAK00986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +1

Query  217  YCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTR  393
            + R    K  +DF DP WK+KYQE+++ RFSLPH+ D FD +PR TTFSL  NR      
Sbjct  51   HARAISGKLDLDFGDPSWKQKYQEDWDRRFSLPHITDIFDLEPRLTTFSLKKNRA---PL  107

Query  394  NGIDVFDEQK-HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
               DV    K + YV+  DRALLKVIKYAS TSAGAE +DP+CSW+E WV RAGPR+ IY
Sbjct  108  GASDVSSPDKWNGYVNKDDRALLKVIKYASNTSAGAECIDPDCSWVEHWVHRAGPRKEIY  167

Query  571  FEPDEVKAAIV  603
            +EP+EVKAAIV
Sbjct  168  YEPEEVKAAIV  178



>ref|XP_012081642.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Jatropha curcas]
 gb|KDP29747.1| hypothetical protein JCGZ_18682 [Jatropha curcas]
Length=536

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (70%), Gaps = 16/138 (12%)
 Frame = +1

Query  217  YCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR------  375
            +  +S +   +DF+D +WK KYQE+FE RF++PH+ D F DA+P P+TF L  R      
Sbjct  54   FAEISKQNSSIDFSDADWKIKYQEDFERRFNIPHITDVFPDAQPIPSTFCLKMRTPLLED  113

Query  376  --GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRA  549
              G +P+       DE+ H Y+++ DR LLKVIK++SP+SAGAE +DP CSW+E WV RA
Sbjct  114  FAGGYPS-------DEEWHGYINNNDRVLLKVIKFSSPSSAGAECIDPGCSWVEQWVHRA  166

Query  550  GPRRHIYFEPDEVKAAIV  603
            GPR  IYF+P+EVKAAIV
Sbjct  167  GPREKIYFKPEEVKAAIV  184



>gb|KJB18250.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=464

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +1

Query  220  CRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRN  396
            C     K  +DF DP+WK K+Q++FE RF++PH+ DTF DA   P+TF L  R    T +
Sbjct  57   CSQQSSKNCIDFTDPDWKSKFQQDFERRFNIPHITDTFPDAHSFPSTFCLRMR-TPVTED  115

Query  397  GIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
              + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  116  FAEGYPSDEEWHGYINNNDRVLLKVIHYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIY  175

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  176  FKPEEVKAAIV  186



>ref|XP_011021841.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Populus euphratica]
Length=532

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 16/131 (12%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPT  390
             K +DF+DP+WK  YQ +FE RF++PH+ D F DA P P+TF L  R        G +P+
Sbjct  57   NKEIDFSDPDWKTNYQRDFERRFNIPHITDIFPDADPIPSTFCLKMRTPIMEDFAGGYPS  116

Query  391  RNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
                   DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR  IY
Sbjct  117  -------DEEWHGYINNNDRVLLKVIHYSSPTSAGAECIDPNCSWVEQWVHRAGPREKIY  169

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  170  FQPEEVKAAIV  180



>gb|EMS49605.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=534

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +1

Query  217  YCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLS-NRGVHPTR  393
            + R    K  +DF DP WK+KYQE+++ RFSLPH+ D FD +PR TTFSL  NR   P  
Sbjct  46   HARAVSGKLDLDFGDPSWKQKYQEDWDRRFSLPHITDVFDLEPRLTTFSLKKNRS--PLG  103

Query  394  NGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
                   ++ + YV+  DRALLKVI YAS TSAGAE +DP+CSW+E WV RAGPR+ IY+
Sbjct  104  ASDASSPDKWNGYVNKDDRALLKVINYASNTSAGAECIDPDCSWVEHWVHRAGPRKEIYY  163

Query  574  EPDEVKAAIV  603
            EP+EVKAAIV
Sbjct  164  EPEEVKAAIV  173



>gb|KJB18251.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=464

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +1

Query  220  CRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRN  396
            C     K  +DF DP+WK K+Q++FE RF++PH+ DTF DA   P+TF L  R    T +
Sbjct  57   CSQQSSKNCIDFTDPDWKSKFQQDFERRFNIPHITDTFPDAHSFPSTFCLRMR-TPVTED  115

Query  397  GIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
              + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  116  FAEGYPSDEEWHGYINNNDRVLLKVIHYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIY  175

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  176  FKPEEVKAAIV  186



>gb|KJB18249.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=538

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +1

Query  220  CRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRN  396
            C     K  +DF DP+WK K+Q++FE RF++PH+ DTF DA   P+TF L  R    T +
Sbjct  57   CSQQSSKNCIDFTDPDWKSKFQQDFERRFNIPHITDTFPDAHSFPSTFCLRMR-TPVTED  115

Query  397  GIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
              + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  116  FAEGYPSDEEWHGYINNNDRVLLKVIHYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIY  175

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  176  FKPEEVKAAIV  186



>ref|XP_006426295.1| hypothetical protein CICLE_v10025337mg [Citrus clementina]
 gb|ESR39535.1| hypothetical protein CICLE_v10025337mg [Citrus clementina]
 gb|KDO60625.1| hypothetical protein CISIN_1g009559mg [Citrus sinensis]
Length=532

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 4/128 (3%)
 Frame = +1

Query  229  SCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGID  405
            S    G+DFNDP+WK K+Q +FE RFSLPH+ D F DA P P+TF L  R    T +  D
Sbjct  54   SARASGLDFNDPDWKSKFQSDFEKRFSLPHITDIFRDATPIPSTFCLRMR-TPVTEDFAD  112

Query  406  VF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
             +  DE+ H Y+++ DR LLKVI ++SPTSAGAE +D +C+W+E WV RAGPR  IYF+P
Sbjct  113  GYPSDEKWHGYINNNDRVLLKVINFSSPTSAGAECIDRDCTWVEQWVHRAGPREEIYFKP  172

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  173  EEVKAAIV  180



>gb|KJB18252.1| hypothetical protein B456_003G042800 [Gossypium raimondii]
Length=513

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = +1

Query  220  CRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRN  396
            C     K  +DF DP+WK K+Q++FE RF++PH+ DTF DA   P+TF L  R    T +
Sbjct  57   CSQQSSKNCIDFTDPDWKSKFQQDFERRFNIPHITDTFPDAHSFPSTFCLRMR-TPVTED  115

Query  397  GIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
              + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  116  FAEGYPSDEEWHGYINNNDRVLLKVIHYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIY  175

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  176  FKPEEVKAAIV  186



>ref|XP_007047818.1| Phosphofructokinase 5 isoform 3 [Theobroma cacao]
 gb|EOX91975.1| Phosphofructokinase 5 isoform 3 [Theobroma cacao]
Length=440

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +1

Query  217  YCRVSCEKKG---VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVH  384
            + +V C +     +DF+DP+WK K+Q++FE RF++PH+ D F DA   P+TF L  R   
Sbjct  52   FSKVECSQSSNNNIDFSDPDWKSKFQQDFEKRFNIPHITDIFPDAHSFPSTFCLRMR-TP  110

Query  385  PTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
             T +  + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR
Sbjct  111  VTEDFAEGYPSDEEWHGYINNKDRVLLKVIHYSSPTSAGAECIDPNCSWVEQWVHRAGPR  170

Query  559  RHIYFEPDEVKAAIV  603
              IYF+P+EVKAAIV
Sbjct  171  EKIYFKPEEVKAAIV  185



>ref|XP_007047817.1| Phosphofructokinase 5 isoform 2 [Theobroma cacao]
 gb|EOX91974.1| Phosphofructokinase 5 isoform 2 [Theobroma cacao]
Length=510

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +1

Query  217  YCRVSCEKKG---VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVH  384
            + +V C +     +DF+DP+WK K+Q++FE RF++PH+ D F DA   P+TF L  R   
Sbjct  52   FSKVECSQSSNNNIDFSDPDWKSKFQQDFEKRFNIPHITDIFPDAHSFPSTFCLRMR-TP  110

Query  385  PTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
             T +  + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR
Sbjct  111  VTEDFAEGYPSDEEWHGYINNKDRVLLKVIHYSSPTSAGAECIDPNCSWVEQWVHRAGPR  170

Query  559  RHIYFEPDEVKAAIV  603
              IYF+P+EVKAAIV
Sbjct  171  EKIYFKPEEVKAAIV  185



>gb|AIE16183.1| chloroplast 6-phosphofructokinase 5 [Nicotiana tabacum]
Length=504

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG--------VHPTRNG  399
            +DF+DP WK KYQ EFEARF++PH+ D F DA   P+TF L  R          +P+   
Sbjct  66   IDFSDPNWKLKYQREFEARFNIPHITDVFPDAVEYPSTFCLKMRTPVSEEFAEGYPS---  122

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR  IYF+P
Sbjct  123  ----DEKWHGYINNNDRVLLKVINYSSPTSAGAECIDPNCSWVEQWVHRAGPREKIYFKP  178

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  179  EEVKAAIV  186



>ref|XP_007047816.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao]
 gb|EOX91973.1| Phosphofructokinase 5 isoform 1 [Theobroma cacao]
Length=537

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +1

Query  217  YCRVSCEKKG---VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVH  384
            + +V C +     +DF+DP+WK K+Q++FE RF++PH+ D F DA   P+TF L  R   
Sbjct  52   FSKVECSQSSNNNIDFSDPDWKSKFQQDFEKRFNIPHITDIFPDAHSFPSTFCLRMR-TP  110

Query  385  PTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
             T +  + +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR
Sbjct  111  VTEDFAEGYPSDEEWHGYINNKDRVLLKVIHYSSPTSAGAECIDPNCSWVEQWVHRAGPR  170

Query  559  RHIYFEPDEVKAAIV  603
              IYF+P+EVKAAIV
Sbjct  171  EKIYFKPEEVKAAIV  185



>ref|XP_010526665.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Tarenaya hassleriana]
Length=534

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVFDEQK  423
            +DF+DPEWK KYQ +FE RFS+PHL D F DA+  P+TF L  R       G    DE+ 
Sbjct  63   IDFSDPEWKYKYQRDFEQRFSIPHLTDVFPDAEAIPSTFCLKMRSPTEDFAGGYPSDEKW  122

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            H Y+++ DR LLKVI Y+SPTSAGAE +D +CSW+E WV RAGPR  IYF P++VKAAIV
Sbjct  123  HGYINNNDRVLLKVINYSSPTSAGAECIDQDCSWVEQWVHRAGPREKIYFRPEQVKAAIV  182



>ref|XP_002310313.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa]
 gb|EEE90763.2| hypothetical protein POPTR_0007s14380g [Populus trichocarpa]
Length=532

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 90/131 (69%), Gaps = 16/131 (12%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPT  390
             K +DF+DP+WK  YQ +FE RF++PH+ D F DA P P+TF L  R        G +P+
Sbjct  57   NKEIDFSDPDWKTNYQRDFERRFNIPHITDIFPDADPIPSTFCLKMRTPVMEDFAGGYPS  116

Query  391  RNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
                   DE+ H Y++  DR LLKVI Y+SPTSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  117  -------DEEWHGYINKNDRVLLKVIHYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIY  169

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  170  FKPEEVKAAIV  180



>ref|XP_003574548.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010235169.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brachypodium distachyon]
Length=530

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 104/152 (68%), Gaps = 5/152 (3%)
 Frame = +1

Query  151  THSPTRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDT  330
            +HS T+    +  +   +P     + +  K  +DF+DP WK+K+QE+++ RF+LP + D 
Sbjct  31   SHSNTKECKSKNAK---RPAPLCVKATSTKVELDFSDPSWKQKFQEDWDERFNLPRITDI  87

Query  331  FD-AKPRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGV  507
            +D  KPRPTTFSL  +   P  +      +  + YV++ DRALLKVIKY+SPTSAGAE +
Sbjct  88   YDDLKPRPTTFSLKKKRT-PRSDEDSTPMDMWNGYVNNDDRALLKVIKYSSPTSAGAECI  146

Query  508  DPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            DP+CSW+E WV RAGPR+ IY+EP+EVKAAIV
Sbjct  147  DPDCSWVEQWVHRAGPRKEIYYEPEEVKAAIV  178



>ref|XP_008235410.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic [Prunus mume]
Length=531

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 22/157 (14%)
 Frame = +1

Query  160  PTRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-D  336
            P  NG  +  R V      + +     K +DF+DP+WK K+Q +FE RF++PH+ D F +
Sbjct  36   PASNGVAKKSRVV------FAQSKSHNKDIDFSDPDWKSKFQRDFERRFNIPHITDVFPE  89

Query  337  AKPRPTTFSLSNR--------GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSA  492
            + P P+TF L  R        G +P+       DE+ H Y+++ DR LLK I Y+SPTSA
Sbjct  90   SVPIPSTFCLRMRTPVIEDFAGGYPS-------DEEWHGYINNNDRVLLKTIYYSSPTSA  142

Query  493  GAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            GAE +DPNC+W+E WV RAGPR  IYF+P+EVKAAIV
Sbjct  143  GAECIDPNCTWVEQWVHRAGPREKIYFKPEEVKAAIV  179



>ref|XP_009785216.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Nicotiana sylvestris]
Length=538

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG--------VHPTRNG  399
            +DF+DP WK KYQ EFEARF++PH+ D F DA   P+TF L  R          +P+   
Sbjct  66   IDFSDPNWKLKYQREFEARFNIPHITDVFPDAVEYPSTFCLKMRTPVSEEFAEGYPS---  122

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR  IYF+P
Sbjct  123  ----DEKWHGYINNNDRVLLKVINYSSPTSAGAECIDPNCSWVEQWVHRAGPREKIYFKP  178

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  179  EEVKAAIV  186



>gb|AIE16182.1| chloroplast 6-phosphofructokinase 4 [Nicotiana tabacum]
Length=538

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG--------VHPTRNG  399
            +DF+DP WK KYQ EFEARF++PH+ D F DA   P+TF L  R          +P+   
Sbjct  66   IDFSDPNWKLKYQREFEARFNIPHITDVFPDAVEYPSTFCLKMRTPVSEEFAEGYPS---  122

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DPNCSW+E WV RAGPR  IYF+P
Sbjct  123  ----DEKWHGYINNNDRVLLKVINYSSPTSAGAECIDPNCSWVEQWVHRAGPREKIYFKP  178

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  179  EEVKAAIV  186



>ref|XP_003530616.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=532

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = +1

Query  145  FLTHSPTRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLK  324
             L+  PTR     G   V   + N  R S     VDF+DP+WK K+QE+ EARF LPHL 
Sbjct  30   LLSLPPTRVANKVG---VFAERSNKSR-STSTAAVDFSDPDWKIKFQEDREARFRLPHLT  85

Query  325  DTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGA  498
            D F DA P P+TF L  R  +     G    DE+ H Y+++ DR LLK I Y+SPTSAGA
Sbjct  86   DIFPDAPPIPSTFCLKMRTPIDRDFPGHYSLDEEWHGYINNNDRVLLKTIYYSSPTSAGA  145

Query  499  EGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            E +DP+C+W+E WV RAGPR  IYF+P+EVKAAIV
Sbjct  146  ECIDPDCTWVEQWVHRAGPREKIYFKPEEVKAAIV  180



>gb|KHN08327.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=525

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 99/155 (64%), Gaps = 6/155 (4%)
 Frame = +1

Query  145  FLTHSPTRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLK  324
             L+  PTR     G   V   + N  R S     VDF+DP+WK K+QE+ EARF LPHL 
Sbjct  23   LLSLPPTRVANKVG---VFAERSNKSR-STSTAAVDFSDPDWKIKFQEDREARFRLPHLT  78

Query  325  DTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGA  498
            D F DA P P+TF L  R  +     G    DE+ H Y+++ DR LLK I Y+SPTSAGA
Sbjct  79   DIFPDAPPIPSTFCLKMRTPIDRDFPGHYSLDEEWHGYINNNDRVLLKTIYYSSPTSAGA  138

Query  499  EGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            E +DP+C+W+E WV RAGPR  IYF+P+EVKAAIV
Sbjct  139  ECIDPDCTWVEQWVHRAGPREKIYFKPEEVKAAIV  173



>ref|XP_004288505.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=537

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 90/128 (70%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPTRNG  399
            +DF+DP+WK K+Q +FE RF++PH+ D F DA P P+TF L  R        G +P+   
Sbjct  65   IDFSDPDWKSKFQSDFEKRFAIPHITDVFPDAVPIPSTFCLKMRTPVIEDFAGGYPS---  121

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE+ H Y+++ DR LLK I Y+SPTSAGAE +DPNC+W+E WV RAGPR  IYF+P
Sbjct  122  ----DEEWHGYINNNDRVLLKTIYYSSPTSAGAECIDPNCTWVEQWVHRAGPREKIYFKP  177

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  178  EEVKAAIV  185



>ref|XP_009599322.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186} [Nicotiana tomentosiformis]
Length=536

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 89/129 (69%), Gaps = 16/129 (12%)
 Frame = +1

Query  244  GVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG--------VHPTRN  396
            G+DF+DP WK KYQ EFEARF++PH+ D F DA   P+TF L  R          +P+  
Sbjct  63   GIDFSDPNWKLKYQREFEARFNIPHITDVFPDAVEYPSTFCLKMRTPVSEEFAEGYPS--  120

Query  397  GIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFE  576
                 DE+ H Y+++ DR LLKVI Y+SPTSAGAE +D NCSW+E WV RAGPR  IYF+
Sbjct  121  -----DEKWHGYINNNDRVLLKVINYSSPTSAGAECIDSNCSWVEQWVHRAGPREKIYFK  175

Query  577  PDEVKAAIV  603
            P+EVKAAIV
Sbjct  176  PEEVKAAIV  184



>gb|EMT20555.1| 6-phosphofructokinase 5, chloroplastic [Aegilops tauschii]
Length=518

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTR-------NGID  405
            +DF DP WK+KYQE+++ RFSLPH+ D FD +PR TTFSL      P R          D
Sbjct  56   LDFGDPSWKQKYQEDWDRRFSLPHITDVFDLEPRLTTFSLKKNRFLPIRFIYNCPLGASD  115

Query  406  VFDEQK-HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
                 K + YV+  DRALLKVI YAS TSAGA  +DP+CSW+E WV RAGPR+ IY+EP+
Sbjct  116  ASSPDKWNGYVNKDDRALLKVINYASNTSAGAVCIDPDCSWVEHWVHRAGPRKEIYYEPE  175

Query  583  EVKAAIV  603
            EVKAAIV
Sbjct  176  EVKAAIV  182



>gb|KHN20613.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=534

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQ  420
            VDF+DP+WK K+QE++EARF LPHL D F +A P P+TF L  R  +     G    DE+
Sbjct  62   VDFSDPDWKIKFQEDWEARFRLPHLTDIFPNAPPIPSTFCLKMRTPIDRDFPGHYSLDEE  121

Query  421  KHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAI  600
             H Y+++ DR LLK I Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P+EVKAAI
Sbjct  122  WHGYINNNDRVLLKTIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKPEEVKAAI  181

Query  601  V  603
            V
Sbjct  182  V  182



>ref|XP_007156482.1| hypothetical protein PHAVU_003G289600g [Phaseolus vulgaris]
 gb|ESW28476.1| hypothetical protein PHAVU_003G289600g [Phaseolus vulgaris]
Length=534

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +1

Query  229  SCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR-GVHPTRNGI  402
            S     VDF+DP+WK K+Q+++EARF LPHL D F DA   P+TF L  R  +    NG 
Sbjct  56   SSRTSAVDFSDPDWKTKFQQDWEARFRLPHLTDVFPDAPAIPSTFCLKMRTSIDRDFNGH  115

Query  403  DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
               DE  H Y+++ DR LLK I Y+SPTSAGAE +DP+C+W+E WV RAGPR  IY++P+
Sbjct  116  YSSDEDWHGYINNNDRVLLKTIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYYKPE  175

Query  583  EVKAAIV  603
            EVKAAIV
Sbjct  176  EVKAAIV  182



>ref|XP_006293955.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
 gb|EOA26853.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
Length=496

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (73%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DPEWK KY+ +FE RFS+PH+ D   DA+   +TF L  R   PT + +  +  DE
Sbjct  68   IDLSDPEWKSKYERDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFVGGYPSDE  125

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF+P+EVKAA
Sbjct  126  EWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFKPEEVKAA  185

Query  598  IV  603
            I+
Sbjct  186  II  187



>ref|XP_008385679.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic isoform X2 
[Malus domestica]
Length=497

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 96/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  211  FNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR----  375
            FN  + S  ++ +DF+DP+WK K+Q++FE RF++PH+ D F DA P P+TF L  R    
Sbjct  45   FNQSK-SHSRQQIDFSDPDWKSKFQKDFEKRFNIPHITDVFPDAVPIPSTFCLQMRTPVI  103

Query  376  ----GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVP  543
                G +P+       DE+ H Y+++ DR LLK I Y+S TSAGAE +DPNC+W+E WV 
Sbjct  104  EDFAGGYPS-------DEEWHGYINNNDRVLLKTIYYSSHTSAGAECIDPNCTWVEQWVH  156

Query  544  RAGPRRHIYFEPDEVKAAIV  603
            RAGPR  IYF+P+EVKAAIV
Sbjct  157  RAGPREKIYFKPEEVKAAIV  176



>ref|XP_004236699.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Solanum lycopersicum]
Length=533

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  244  GVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--D  414
            G+DF+DP+WK KY  EFEARF++PH+ D F DA   P+TF L  R    T    + +  D
Sbjct  60   GIDFSDPDWKLKYSREFEARFNIPHMTDVFPDAVSYPSTFCLKMR-TPITEKFAEGYPSD  118

Query  415  EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKA  594
            E+ H Y+++ DR LLKVI Y+SPTSAGAE +D NCSW+E WV RAGPR  I+F+P+EVKA
Sbjct  119  EKWHGYINNNDRVLLKVINYSSPTSAGAECIDSNCSWVEQWVHRAGPREKIFFKPEEVKA  178

Query  595  AIV  603
            AIV
Sbjct  179  AIV  181



>ref|XP_008385677.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic isoform X1 
[Malus domestica]
Length=528

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 96/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  211  FNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR----  375
            FN  + S  ++ +DF+DP+WK K+Q++FE RF++PH+ D F DA P P+TF L  R    
Sbjct  45   FNQSK-SHSRQQIDFSDPDWKSKFQKDFEKRFNIPHITDVFPDAVPIPSTFCLQMRTPVI  103

Query  376  ----GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVP  543
                G +P+       DE+ H Y+++ DR LLK I Y+S TSAGAE +DPNC+W+E WV 
Sbjct  104  EDFAGGYPS-------DEEWHGYINNNDRVLLKTIYYSSHTSAGAECIDPNCTWVEQWVH  156

Query  544  RAGPRRHIYFEPDEVKAAIV  603
            RAGPR  IYF+P+EVKAAIV
Sbjct  157  RAGPREKIYFKPEEVKAAIV  176



>ref|XP_004250136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Solanum lycopersicum]
Length=532

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +DFNDP+WK KY+ EFEARF++PH+ D F DA   P+TF L  R    T +    +  DE
Sbjct  60   IDFNDPDWKVKYEREFEARFNIPHITDLFPDAVSYPSTFCLKMR-TPVTEDFAQGYPSDE  118

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLK I Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P+EVKAA
Sbjct  119  EWHGYINNNDRVLLKTINYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKPEEVKAA  178

Query  598  IV  603
            I+
Sbjct  179  II  180



>ref|XP_007208470.1| hypothetical protein PRUPE_ppa004086mg [Prunus persica]
 gb|EMJ09669.1| hypothetical protein PRUPE_ppa004086mg [Prunus persica]
Length=531

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 22/157 (14%)
 Frame = +1

Query  160  PTRNGYGRGGRCVVKPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-D  336
            P  NG  +      K +  + +     + +DF+DP+WK K+Q +FE RF++PH+ D F +
Sbjct  36   PASNGVAK------KSRVPFAQSKSHNQDIDFSDPDWKSKFQRDFERRFNIPHITDVFPE  89

Query  337  AKPRPTTFSLSNR--------GVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSA  492
            + P P+TF L  R        G +P+       DE+ H Y+++ DR LLK I Y+SPTSA
Sbjct  90   SVPIPSTFCLRMRTPVIEDFAGGYPS-------DEEWHGYINNNDRVLLKTIYYSSPTSA  142

Query  493  GAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            GAE +DPNC+W+E WV RAGPR  IYF+P+EVKAAIV
Sbjct  143  GAECIDPNCTWVEQWVHRAGPREKIYFKPEEVKAAIV  179



>gb|AIE47273.1| phosphofructokinase [Hevea brasiliensis]
Length=536

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +1

Query  235  EKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDV  408
            +   +DF+DP+WK KYQ +F+ RF++PH+ D F DA P P+TF L  R  V     G   
Sbjct  60   QSPAIDFSDPDWKIKYQTDFQRRFNIPHITDIFPDAAPIPSTFCLKMRTPVSEDFAGGYP  119

Query  409  FDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEV  588
             DE+ H Y+++ DR LLKVI ++SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P+EV
Sbjct  120  SDEEWHGYINNNDRVLLKVIHFSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKPEEV  179

Query  589  KAAIV  603
            KAAIV
Sbjct  180  KAAIV  184



>ref|XP_006293956.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
 gb|EOA26854.1| hypothetical protein CARUB_v10022950mg [Capsella rubella]
Length=539

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (73%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DPEWK KY+ +FE RFS+PH+ D   DA+   +TF L  R   PT + +  +  DE
Sbjct  68   IDLSDPEWKSKYERDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFVGGYPSDE  125

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF+P+EVKAA
Sbjct  126  EWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFKPEEVKAA  185

Query  598  IV  603
            I+
Sbjct  186  II  187



>ref|XP_010472236.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Camelina sativa]
Length=535

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGI  402
            V   K  +D +DP+WK KY+ +FE RFS+PH+ D   DA+   +TF L  R   PT + +
Sbjct  57   VQNTKTSIDLSDPDWKSKYERDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFV  114

Query  403  DVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFE  576
              +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF+
Sbjct  115  GGYPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFK  174

Query  577  PDEVKAAIV  603
            P+EVKAAI+
Sbjct  175  PEEVKAAII  183



>ref|XP_010417006.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Camelina sativa]
Length=537

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGI  402
            V   K  +D +DP+WK KY+ +FE RFS+PH+ D   DA+   +TF L  R   PT + +
Sbjct  59   VQNTKTSIDLSDPDWKSKYERDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFV  116

Query  403  DVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFE  576
              +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF+
Sbjct  117  GGYPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFK  176

Query  577  PDEVKAAIV  603
            P+EVKAAI+
Sbjct  177  PEEVKAAII  185



>ref|XP_003552046.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=534

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQ  420
            VDF+DP+WK K+QE++EARF LPHL D F +A P P+TF L  R  +     G    DE+
Sbjct  62   VDFSDPDWKIKFQEDWEARFRLPHLTDIFPNAPPIPSTFCLKMRTPIDRDFPGHYSLDEE  121

Query  421  KHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAI  600
             H Y+++ DR LLK I Y+SPTSAGAE +DP+C+W+E WV RAGPR  IY++P+EVKAAI
Sbjct  122  WHGYINNNDRVLLKTIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYYKPEEVKAAI  181

Query  601  V  603
            V
Sbjct  182  V  182



>ref|XP_006346747.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum 
tuberosum]
Length=537

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  244  GVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--D  414
            G+DF+DP+WK KY  EFEARF++PH+ D F DA   P+TF L  R    T    + +  D
Sbjct  64   GIDFSDPDWKLKYSREFEARFNIPHMTDVFPDAVSYPSTFCLKMR-TPITEKFAEGYPSD  122

Query  415  EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKA  594
            E+ H YV++ DR LLKVI Y+SP+SAGAE +D NCSW+E WV RAGPR  I+F+P+EVKA
Sbjct  123  EKWHGYVNNNDRVLLKVINYSSPSSAGAECIDSNCSWVEQWVHRAGPREKIFFKPEEVKA  182

Query  595  AIV  603
            AIV
Sbjct  183  AIV  185



>ref|XP_010429169.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Camelina sativa]
Length=536

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGI  402
            V   K  +D +DP+WK KY+ +FE RFS+PH+ D   DA+   +TF L  R   PT + +
Sbjct  58   VQNTKTSIDLSDPDWKSKYERDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFV  115

Query  403  DVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFE  576
              +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF+
Sbjct  116  GGYPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFK  175

Query  577  PDEVKAAIV  603
            P+EVKAAI+
Sbjct  176  PEEVKAAII  184



>gb|KFK30402.1| hypothetical protein AALP_AA7G256400 [Arabis alpina]
Length=525

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 89/135 (66%), Gaps = 1/135 (1%)
 Frame = +1

Query  202  KPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG  378
            KP+     V   +  +D NDP WK KYQ +FE RF++PH+ D F DA+   +TF L  R 
Sbjct  39   KPRSPAISVRFSRAAIDLNDPNWKSKYQTDFEERFNIPHITDVFPDAEAIRSTFCLKMRS  98

Query  379  VHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
                 +G    DE+ H Y+++ DR LLKVI Y+SPTSAGA  +DP+C+W+E WV RAGPR
Sbjct  99   PTADFSGGYPSDEEWHGYINNKDRVLLKVINYSSPTSAGAVCIDPDCTWIEQWVHRAGPR  158

Query  559  RHIYFEPDEVKAAIV  603
              IYF P++VKAAIV
Sbjct  159  EKIYFRPEKVKAAIV  173



>ref|XP_009340975.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=528

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 16/131 (12%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPT  390
            ++ +DF+DP+WK K+Q++FE RF++PH+ D F DA P P+TF L  R        G +P+
Sbjct  53   RQQIDFSDPDWKSKFQKDFEKRFNIPHITDVFPDAVPIPSTFCLQMRTPVIEDFAGGYPS  112

Query  391  RNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
                   DE+ H Y+++ DR LLK I Y+S TSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  113  -------DEEWHGYINNNDRVLLKTIYYSSHTSAGAECIDPNCTWVEQWVHRAGPREKIY  165

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  166  FKPEEVKAAIV  176



>ref|XP_009348246.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Pyrus x bretschneideri]
Length=593

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 16/131 (12%)
 Frame = +1

Query  238  KKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPT  390
            ++ +DF+DP+WK K+Q++FE RF++PH+ D F DA P P+TF L  R        G +P+
Sbjct  118  RQQIDFSDPDWKSKFQKDFEKRFNIPHITDVFPDAVPIPSTFCLQMRTPVIEDFAGGYPS  177

Query  391  RNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIY  570
                   DE+ H Y+++ DR LLK I Y+S TSAGAE +DPNC+W+E WV RAGPR  IY
Sbjct  178  -------DEEWHGYINNNDRVLLKTIYYSSHTSAGAECIDPNCTWVEQWVHRAGPREKIY  230

Query  571  FEPDEVKAAIV  603
            F+P+EVKAAIV
Sbjct  231  FKPEEVKAAIV  241



>ref|XP_011097501.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Sesamum indicum]
Length=533

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQ  420
            +D++DP WK+KYQ+EFEARFS+PH+ D   DA   P+TF L  R  + P        DE+
Sbjct  61   IDYSDPGWKEKYQKEFEARFSIPHITDVIHDAVSYPSTFCLKMRTPLSPDFTNGYPTDEE  120

Query  421  KHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAI  600
             H Y+++ DR LLKVI ++SPTSAGA+ +DP C+W+E WV RAGPR  IYF+P+EVKAAI
Sbjct  121  WHGYINNNDRVLLKVIHFSSPTSAGAQCIDPACTWVEQWVHRAGPREKIYFKPEEVKAAI  180

Query  601  V  603
            V
Sbjct  181  V  181



>emb|CDX76918.1| BnaC08g35040D [Brassica napus]
Length=539

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 97/144 (67%), Gaps = 10/144 (7%)
 Frame = +1

Query  196  VVKPKFNYCRVSCEKKG-----VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTT  357
            ++  + ++ R S  + G     +D +DP WK+KY+ EFE RFS+PH+ D F DA+   +T
Sbjct  46   LISSRSSFTRASAVEHGKTSVSIDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRST  105

Query  358  FSLSNRGVHPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLE  531
            F L  R   PT + +  +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +D +CSW+E
Sbjct  106  FCLKMRS--PTEDFVGGYPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDSDCSWVE  163

Query  532  LWVPRAGPRRHIYFEPDEVKAAIV  603
             W+ RAGPR  IYF P++VKAAI+
Sbjct  164  QWIHRAGPREKIYFRPEQVKAAII  187



>ref|XP_008345156.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 16/134 (12%)
 Frame = +1

Query  229  SCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GV  381
            S  ++ +DF+DP+WK K+Q +FE RF++PH+ D F D+ P P+TF L  R        G 
Sbjct  50   SQSRQQIDFSDPDWKSKFQXDFEKRFNIPHITDVFPDSVPIPSTFCLRMRTPVIEDFAGG  109

Query  382  HPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRR  561
            +P+       DE+ H Y+++ DR LLK I Y+S TSAGAE +DPNC+W+E WV RAGPR 
Sbjct  110  YPS-------DEEWHGYINNNDRVLLKTIYYSSHTSAGAECIDPNCTWVEQWVHRAGPRE  162

Query  562  HIYFEPDEVKAAIV  603
             IYF+P+ VKAAIV
Sbjct  163  KIYFKPEAVKAAIV  176



>emb|CDP01541.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 90/128 (70%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPTRNG  399
            +DF+DP+WK KYQ++FEARF++PHL D F +A   P+TF L  R        G +P+   
Sbjct  62   IDFSDPDWKSKYQKDFEARFNIPHLTDVFPNAVSYPSTFCLKMRTPVTEEFAGGYPS---  118

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE  H Y+++ DR LLKVI ++SPTSAGAE +DP C+W+E WV RAGPR  IYF+P
Sbjct  119  ----DEAWHGYINNNDRVLLKVIHFSSPTSAGAECIDPGCTWVEQWVHRAGPREKIYFKP  174

Query  580  DEVKAAIV  603
            ++VKAAIV
Sbjct  175  EDVKAAIV  182



>ref|XP_011100012.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Sesamum indicum]
Length=529

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +1

Query  235  EKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDV  408
            ++  +DF+DP+WK  YQ +FEARF +PH+ D   DA   P+TF L  R  V P       
Sbjct  53   KQGSIDFSDPDWKSNYQHDFEARFRIPHITDVLPDAVSYPSTFCLKMRTPVSPDFAEGYP  112

Query  409  FDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEV  588
             DE+ H Y+++ DR LLKVI+Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P++V
Sbjct  113  SDEEWHGYINNNDRVLLKVIRYSSPTSAGAECIDPDCTWIEQWVHRAGPREKIYFKPEDV  172

Query  589  KAAIV  603
            KAAIV
Sbjct  173  KAAIV  177



>gb|EYU30954.1| hypothetical protein MIMGU_mgv1a004409mg [Erythranthe guttata]
Length=528

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  241  KGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFD  414
            + VDF+DP+WK KYQ +FEARF +PH+ D   DA   P+TF L  R  V P        D
Sbjct  54   ESVDFSDPDWKSKYQTDFEARFRIPHITDVLNDAVSYPSTFCLRMRTPVSPDFAEGYPSD  113

Query  415  EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKA  594
            E  H Y+++ DR LLKVI+Y+SPTSAGAE +DP+C+W E WV RAGPR  IYF+P++VKA
Sbjct  114  EAWHGYINNNDRVLLKVIRYSSPTSAGAECIDPDCTWTEQWVHRAGPREKIYFKPEDVKA  173

Query  595  AIV  603
            AIV
Sbjct  174  AIV  176



>emb|CDY13756.1| BnaA09g42580D [Brassica napus]
Length=539

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 10/144 (7%)
 Frame = +1

Query  196  VVKPKFNYCRVSCEKKG-----VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTT  357
            ++  + ++ R S  + G     +D +DP WK+KY+ EFE RFS+PH+ D F DA+   +T
Sbjct  46   LISSRSSFTRASAVEHGKSSVSIDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRST  105

Query  358  FSLSNRGVHPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLE  531
            F L  R   PT   +  +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +D +CSW+E
Sbjct  106  FCLKMRS--PTEEFVGGYPSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDSDCSWVE  163

Query  532  LWVPRAGPRRHIYFEPDEVKAAIV  603
             W+ RAGPR  IYF P++VKAAI+
Sbjct  164  QWIHRAGPREKIYFRPEQVKAAII  187



>ref|XP_006404705.1| hypothetical protein EUTSA_v10000117mg [Eutrema salsugineum]
 gb|ESQ46158.1| hypothetical protein EUTSA_v10000117mg [Eutrema salsugineum]
Length=538

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DP WK KY+ +FE RFS+PH+ D F DA+   +TF L  R   PT + +  +  DE
Sbjct  67   IDLSDPNWKSKYERDFEQRFSIPHITDVFPDAEAIRSTFCLKMRS--PTEDFVGGYPSDE  124

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF P++VKAA
Sbjct  125  EWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFRPEQVKAA  184

Query  598  IV  603
            I+
Sbjct  185  II  186



>ref|XP_009112523.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
isoform X2 [Brassica rapa]
Length=541

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DP WK+KY+ EFE RFS+PH+ D F DA+   +TF L  R   PT   +  +  DE
Sbjct  68   IDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRSTFCLKMRS--PTEEFVGGYPSDE  125

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI+Y+SPTSAGAE +D +CSW+E W+ RAGPR  IYF P++VKAA
Sbjct  126  EWHGYINNNDRVLLKVIRYSSPTSAGAECIDSDCSWVEQWIHRAGPREKIYFRPEQVKAA  185

Query  598  IV  603
            I+
Sbjct  186  II  187



>emb|CBI18713.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFD-AKPRPTTFSLSNRGVHPTRNG  399
            R   +  G+DF DPEWK K+Q++FE RF +PH+ D FD A   P+TF L +R      + 
Sbjct  47   RALAKNPGIDFCDPEWKSKFQKDFEKRFYIPHITDIFDDAVAIPSTFCLKSR-TPVNEDF  105

Query  400  IDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
             D +  DE+ H Y++++DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF
Sbjct  106  ADGYPSDEKWHGYINNSDRVLLKVIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYF  165

Query  574  EPDEVKAAIV  603
            +P+ V AAIV
Sbjct  166  KPETVNAAIV  175



>ref|XP_009112522.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
isoform X1 [Brassica rapa]
Length=536

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DP WK+KY+ EFE RFS+PH+ D F DA+   +TF L  R   PT   +  +  DE
Sbjct  68   IDLSDPNWKRKYEREFEERFSIPHITDVFPDAEAIRSTFCLKMRS--PTEEFVGGYPSDE  125

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI+Y+SPTSAGAE +D +CSW+E W+ RAGPR  IYF P++VKAA
Sbjct  126  EWHGYINNNDRVLLKVIRYSSPTSAGAECIDSDCSWVEQWIHRAGPREKIYFRPEQVKAA  185

Query  598  IV  603
            I+
Sbjct  186  II  187



>ref|XP_010266371.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Nelumbo nucifera]
Length=526

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = +1

Query  211  FNYCRVSCEKK--GVDFNDPEWKKKYQEEFEARFSLPHLKDTFD-AKPRPTTFSLSNRGV  381
            F   RV  E +   +DF+DP WK K+Q +FE RF+LPHL D FD  +P P+TF L +R +
Sbjct  40   FQKSRVFTETRNPAIDFSDPHWKTKFQGDFERRFNLPHLTDLFDDIEPIPSTFCLKSR-L  98

Query  382  HPTRNGIDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGP  555
              +    D +  DE+ H Y+++ DR LLKVI Y+SPTSAGAE +DP C+W+E W+ RAGP
Sbjct  99   PVSEEFADGYPSDEKWHGYINNNDRVLLKVIHYSSPTSAGAECIDPACTWVEQWIHRAGP  158

Query  556  RRHIYFEPDEVKAAIV  603
            R  IYF+P++V AAIV
Sbjct  159  REKIYFKPEQVNAAIV  174



>ref|XP_010646328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Vitis vinifera]
Length=526

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFD-AKPRPTTFSLSNRGVHPTRNG  399
            R   +  G+DF DPEWK K+Q++FE RF +PH+ D FD A   P+TF L +R      + 
Sbjct  47   RALAKNPGIDFCDPEWKSKFQKDFEKRFYIPHITDIFDGAVAIPSTFCLKSR-TPVNEDF  105

Query  400  IDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
             D +  DE+ H Y++++DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF
Sbjct  106  ADGYPSDEKWHGYINNSDRVLLKVIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYF  165

Query  574  EPDEVKAAIV  603
            +P+ V AAIV
Sbjct  166  KPETVNAAIV  175



>ref|XP_010646329.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Vitis vinifera]
Length=526

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFD-AKPRPTTFSLSNRGVHPTRNG  399
            R   +  G+DF DPEWK K+Q++FE RF +PH+ D FD A   P+TF L +R      + 
Sbjct  47   RALAKNPGIDFCDPEWKSKFQKDFEKRFYIPHITDIFDDAVAIPSTFCLKSR-TPVNEDF  105

Query  400  IDVF--DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYF  573
             D +  DE+ H Y++++DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF
Sbjct  106  ADGYPSDEKWHGYINNSDRVLLKVIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYF  165

Query  574  EPDEVKAAIV  603
            +P+ V AAIV
Sbjct  166  KPETVNAAIV  175



>ref|XP_003517707.2| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Glycine 
max]
Length=554

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRN---GIDVFD  414
            +DF+DP+WK K++++FE RF LPH+ D F DA   P+TFS + R  +PT +   G    D
Sbjct  82   IDFSDPDWKTKFKDDFEDRFRLPHVTDIFPDAVSMPSTFSPNMR--NPTTSDFPGNYPLD  139

Query  415  EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKA  594
            E  H Y++D DR LLK I Y+SPTSAGAE +DP C+W+E WV RAGPR  IYF P+EVKA
Sbjct  140  EDWHGYINDNDRVLLKTIYYSSPTSAGAECIDPGCNWVEQWVHRAGPREKIYFHPEEVKA  199

Query  595  AIV  603
            AIV
Sbjct  200  AIV  202



>ref|XP_002878619.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54878.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (74%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DP+WK KY+++FE RF++PH+ D   DA+   +TF L  R   PT + +  +  DE
Sbjct  66   IDLSDPDWKLKYEKDFEQRFNIPHITDVLPDAEAIRSTFCLKMRS--PTEDFVGGYPSDE  123

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI+Y+SPTSAGAE +DP+CSW+E W+ RAGPR  IYF P+EVKAA
Sbjct  124  EWHGYINNNDRVLLKVIRYSSPTSAGAECIDPDCSWIEQWIHRAGPREKIYFRPEEVKAA  183

Query  598  IV  603
            I+
Sbjct  184  II  185



>ref|XP_010107299.1| 6-phosphofructokinase 5 [Morus notabilis]
 gb|EXC14632.1| 6-phosphofructokinase 5 [Morus notabilis]
Length=523

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 88/128 (69%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPTRNG  399
            +DF DP+WK K+Q +FE RF++PH+ D F DA   P+TF L  R        G +P+   
Sbjct  51   IDFGDPDWKSKFQSDFERRFNIPHITDVFPDAVSIPSTFCLKMRTPITEEFVGGYPS---  107

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE+ H Y+++ DR LLK I ++SPTSAGAE +DPNC+W+E WV RAGPR  IYF+P
Sbjct  108  ----DEEWHGYINNNDRVLLKTIHFSSPTSAGAECIDPNCTWVEQWVHRAGPREKIYFKP  163

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  164  EEVKAAIV  171



>gb|EYU39321.1| hypothetical protein MIMGU_mgv1a004379mg [Erythranthe guttata]
Length=530

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG-VHPTRNGIDVFDEQ  420
            VD+ DP+WK  YQ++FEARF +PHL D   DA P P+TF L  R  V P        D +
Sbjct  58   VDYTDPDWKSNYQKDFEARFRIPHLTDALHDAVPYPSTFCLRMRTPVSPDFAEGYPSDGE  117

Query  421  KHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAI  600
             H YV+  DR LLKVI+Y+SP SAGAE +DP C+W+E WV RAGPR  IYF+P+EVKAAI
Sbjct  118  WHGYVNTNDRVLLKVIRYSSPASAGAECIDPGCTWVEQWVHRAGPREKIYFKPEEVKAAI  177

Query  601  V  603
            V
Sbjct  178  V  178



>ref|XP_003628914.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET03390.1| 6-phosphofructokinase [Medicago truncatula]
Length=529

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 10/125 (8%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDV-----  408
            +DFNDP+WK K+Q++FE+RF LPH+ D F D+ P P+TF L  R    T  G D+     
Sbjct  57   IDFNDPDWKFKFQQDFESRFRLPHITDIFPDSPPIPSTFCLRMR----TPIGKDIPGHYT  112

Query  409  FDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEV  588
             DE+ + Y+++ DR LLK I Y+SP SAGAE +DP+C+W+E WV RAGPR  IY++P++V
Sbjct  113  LDEEWNGYINNNDRVLLKTINYSSPKSAGAECIDPDCTWVEQWVHRAGPREKIYYKPEDV  172

Query  589  KAAIV  603
            KAAIV
Sbjct  173  KAAIV  177



>gb|KFK32811.1| hypothetical protein AALP_AA6G290900 [Arabis alpina]
Length=525

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 85/122 (70%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D NDP WK  Y+ +FE RF++PH+ D   DA+P  +TF L  R   PT + +  +  DE
Sbjct  54   IDLNDPNWKSNYERDFEQRFNIPHINDVLPDAEPIRSTFCLKMRS--PTEDFVGGYPSDE  111

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI Y+SPTSAGAE + P CSW+E W+ RAGPR  IYF P++VKAA
Sbjct  112  EWHGYINNNDRVLLKVISYSSPTSAGAECIGPECSWVEQWIHRAGPREKIYFRPEQVKAA  171

Query  598  IV  603
            I+
Sbjct  172  II  173



>ref|XP_010916680.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Elaeis guineensis]
Length=530

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 6/138 (4%)
 Frame = +1

Query  202  KPKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRG  378
            +P F    +    + +DF +P+WK+KYQ +FE RF++ HL D F D  P P+TFSL +R 
Sbjct  44   RPVFAASTMEVGSQELDFGEPDWKQKYQGDFERRFNISHLTDLFPDLSPMPSTFSLKSR-  102

Query  379  VHPTRNGI---DVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRA  549
              P  + +      D Q + YV++ DR LLKVI Y++PTSAGAE +DP C+W+E WV RA
Sbjct  103  -RPVTDELLNGHPLDGQWNGYVNNNDRVLLKVINYSTPTSAGAECIDPACTWVEQWVHRA  161

Query  550  GPRRHIYFEPDEVKAAIV  603
            GPR  I+F+P+EV AAIV
Sbjct  162  GPREKIFFKPEEVNAAIV  179



>ref|XP_006411816.1| hypothetical protein EUTSA_v10024871mg [Eutrema salsugineum]
 gb|ESQ53269.1| hypothetical protein EUTSA_v10024871mg [Eutrema salsugineum]
Length=537

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +1

Query  235  EKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF  411
            E   +D +DP+W+ KYQ +FE RF++PH+ D F DA+   +TF L  R      +G    
Sbjct  62   ETAAIDLSDPDWRLKYQRDFEERFNIPHITDVFPDAEAIRSTFCLKMRSPTEDFSGGYPS  121

Query  412  DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVK  591
            DE+ H Y+++ DR LLKVI Y+SPTSAGA  +DP+C+W+E WV RAGPR  IYF P++VK
Sbjct  122  DEEWHGYINNKDRVLLKVINYSSPTSAGAVCIDPDCTWIEQWVHRAGPREKIYFRPEKVK  181

Query  592  AAIV  603
            AAIV
Sbjct  182  AAIV  185



>ref|XP_006353187.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Solanum 
tuberosum]
Length=532

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            ++F+DP+WK KY+ EFEARF++PH+ D F DA   P+TF L  R    T +    +  DE
Sbjct  60   INFSDPDWKVKYEREFEARFNIPHITDVFPDAVSYPSTFCLKMR-TPVTEDFAQGYPSDE  118

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLK I Y+SPTSAGAE +DP+C+W+E WV RAGPR   YF+P+EVKAA
Sbjct  119  EWHGYINNNDRVLLKTINYSSPTSAGAECIDPDCTWVEQWVHRAGPREKTYFKPEEVKAA  178

Query  598  IV  603
            I+
Sbjct  179  II  180



>gb|AHE93343.1| phosphofructokinase [Camellia sinensis]
Length=522

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 88/128 (69%), Gaps = 10/128 (8%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNG  399
            R +     +DF D +WK KY+++F+ARF++PHL D   DA P P+TF L  R   PT++ 
Sbjct  52   RAASSAAAIDFRDRDWKSKYEDDFQARFNIPHLTDVIEDALPIPSTFCLRMR--TPTQDF  109

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
             D        Y+++ DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P
Sbjct  110  AD-------GYINNNDRVLLKVINYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKP  162

Query  580  DEVKAAIV  603
            + VKAAIV
Sbjct  163  ENVKAAIV  170



>ref|XP_008795218.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
[Phoenix dactylifera]
Length=529

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = +1

Query  205  PKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSL-SNRG  378
            P F         + +DF D +WKKKYQ+ FE RF++PHL D F D  P P+TFSL S R 
Sbjct  45   PVFAASTTEVGTQELDFGDTDWKKKYQD-FERRFNIPHLTDLFPDLSPMPSTFSLKSRRS  103

Query  379  VHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPR  558
            V          D Q + YV++ DR LLKVI Y++PTSAGAE +DP+C+W+E WV RAGPR
Sbjct  104  VSDDLLNGYPLDGQWNGYVNNNDRVLLKVINYSTPTSAGAECIDPDCTWVEQWVHRAGPR  163

Query  559  RHIYFEPDEVKAAIV  603
              IYF+P+EV AAI+
Sbjct  164  EKIYFKPEEVNAAII  178



>ref|XP_007158384.1| hypothetical protein PHAVU_002G148700g [Phaseolus vulgaris]
 gb|ESW30378.1| hypothetical protein PHAVU_002G148700g [Phaseolus vulgaris]
Length=532

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 84/128 (66%), Gaps = 16/128 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNR--------GVHPTRNG  399
            +DFNDP+WK K+ +EFE RF LPH+ D F DA   P+TF  + R        G +P    
Sbjct  60   IDFNDPDWKTKFNDEFEERFRLPHVTDIFPDAASMPSTFCHNVRTPRTSDFPGNYP----  115

Query  400  IDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEP  579
                DE  H Y+ + DR LLK I Y+SPTSAGAE +DP C+W+E WV RAGPR  IYF+P
Sbjct  116  ---LDEDWHGYISENDRVLLKTIYYSSPTSAGAECIDPGCNWVEQWVHRAGPRGKIYFKP  172

Query  580  DEVKAAIV  603
            +EVKAAIV
Sbjct  173  EEVKAAIV  180



>ref|XP_003613090.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES96048.1| 6-phosphofructokinase [Medicago truncatula]
Length=533

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 7/136 (5%)
 Frame = +1

Query  214  NYCRVSCEKKG---VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGV  381
            N  RV  E K    +D+NDP+WK K++E+FEARF LPH+ D F DA    +TF L  R  
Sbjct  47   NNVRVFSELKSQNKIDYNDPDWKDKFKEDFEARFRLPHITDIFPDASSMRSTFCLKMRAP  106

Query  382  HPTRNGIDVFD--EQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGP  555
              TR+    +D  E+ + Y+ D DR LLK I ++SPTSAGA+ +DP C+W+E WV RAGP
Sbjct  107  -ITRDFHGNYDSGEEWNGYISDNDRVLLKTIYHSSPTSAGAQCIDPGCNWVEQWVHRAGP  165

Query  556  RRHIYFEPDEVKAAIV  603
            R++IYF+P+EVKAAIV
Sbjct  166  RKNIYFKPEEVKAAIV  181



>ref|NP_850025.1| 6-phosphofructokinase 5 [Arabidopsis thaliana]
 sp|Q8VYN6.1|PFKA5_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 5, chloroplastic; 
Short=ATP-PFK 5; Short=Phosphofructokinase 5; AltName: 
Full=Phosphohexokinase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49898.1| putative pyrophosphate-fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAM20228.1| putative pyrophosphate-fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEC07312.1| 6-phosphofructokinase 5 [Arabidopsis thaliana]
Length=537

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVF--DE  417
            +D +DP+WK KY+++FE RFS+PH+ D   DA+   +TF L  R   PT + +  +  DE
Sbjct  66   IDLSDPDWKLKYEKDFEQRFSIPHITDVLPDAEAIRSTFCLKMRS--PTEDFVGGYPSDE  123

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAA  597
            + H Y+++ DR LLKVI Y+SPTSAGAE +D +CSW+E W+ RAGPR  IYF P+EVKAA
Sbjct  124  EWHGYINNNDRVLLKVISYSSPTSAGAECLDHDCSWVEQWIHRAGPREKIYFRPEEVKAA  183

Query  598  IV  603
            I+
Sbjct  184  II  185



>ref|XP_004489766.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer 
arietinum]
Length=524

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  211  FNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHP  387
            F+  + S     +DF D +WK K++E+FE RF LPH+ DTF D+   P+TF L  R    
Sbjct  41   FSDLKKSPSNNAIDFTDTDWKIKFKEDFEERFRLPHVTDTFPDSASIPSTFCLKMRTPMT  100

Query  388  TRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHI  567
                 +   ++ + Y++D DR LLK I ++SPTSAGAE +DP C+W+E WV RAGPR+ I
Sbjct  101  KDFPGNYNSDEWNGYINDNDRVLLKTINHSSPTSAGAECIDPGCNWVEQWVHRAGPRKEI  160

Query  568  YFEPDEVKAAIV  603
            YF+P+EVKAAIV
Sbjct  161  YFKPEEVKAAIV  172



>emb|CDY52512.1| BnaC03g61050D [Brassica napus]
Length=503

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 16/120 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVFDEQK  423
            +D +DPEWK KYQ +FE RF++PH+ D F DA+  P+TF L  R   PT           
Sbjct  47   IDLSDPEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCLKMRS--PT-----------  93

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
              Y+++ DR LLKVI Y+SP SAGA  +DP+C+W+E WV RAGPR +IYF P++VKAAIV
Sbjct  94   --YINNKDRVLLKVINYSSPASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIV  151



>ref|XP_009109420.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brassica rapa]
Length=512

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 16/120 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVFDEQK  423
            +D +DPEWK KYQ +FE RFS+PH+ D F DA+  P+TF +  R   PT           
Sbjct  56   IDLSDPEWKLKYQRDFEERFSIPHITDAFPDAEAIPSTFCVKMRS--PT-----------  102

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
              Y++  DR LLKVI Y+SP SAGA  +DP+C+W+E WV RAGPR +IYF P++VKAAIV
Sbjct  103  --YINTKDRVLLKVINYSSPASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIV  160



>emb|CDX90382.1| BnaA08g16020D [Brassica napus]
Length=512

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 81/120 (68%), Gaps = 16/120 (13%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVFDEQK  423
            +D +DPEWK KYQ +FE RF++PH+ D F DA+  P+TF +  R   PT           
Sbjct  56   IDPSDPEWKLKYQRDFEERFNIPHITDAFPDAEAIPSTFCVKMRS--PT-----------  102

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
              Y++  DR LLKVI Y+SP SAGA  +DP+C+W+E WV RAGPR +IYF P++VKAAIV
Sbjct  103  --YINTKDRVLLKVINYSSPASAGAVCIDPDCTWIEQWVQRAGPRENIYFRPEDVKAAIV  160



>emb|CAN69658.1| hypothetical protein VITISV_013008 [Vitis vinifera]
Length=516

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 28/154 (18%)
 Frame = +1

Query  223  RVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFD-AKPRPTTFSLSNRGVHPTRNG  399
            R   +  G+DF DPEWK K+Q++FE RF +PH+ D FD A   P+TF L +R      + 
Sbjct  47   RALAKNPGIDFCDPEWKSKFQKDFEKRFYIPHITDIFDXAVAIPSTFCLKSR-TPVNEDF  105

Query  400  IDVF--DEQKHSYVDDADRALLK------------------------VIKYASPTSAGAE  501
             D +  DE+ H Y++++DR LLK                        VI Y+SPTSAGAE
Sbjct  106  ADGYPSDEKWHGYINNSDRVLLKALXSVSTKRLVYRLYERLHLEHKKVIYYSSPTSAGAE  165

Query  502  GVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
             +DP+C+W+E WV RAGPR  IYF+P+ V AAIV
Sbjct  166  CIDPDCTWVEQWVHRAGPREKIYFKPETVNAAIV  199



>gb|EEC84573.1| hypothetical protein OsI_31367 [Oryza sativa Indica Group]
Length=547

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  205  PKFNYCRVSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSL-SNRGV  381
            P     R    K  +DF+DP WK+KYQE++  RFSLPH+ D +D KPR TTFSL  NR  
Sbjct  96   PMVLSVRAVSGKSDLDFSDPSWKEKYQEDWNRRFSLPHITDIYDLKPRLTTFSLKKNR--  153

Query  382  HPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSW  525
                +G  +  ++ + YV+  DRALLKVIKYASPTSAGAE VDP+CSW
Sbjct  154  ---TDGGSLSADKWNGYVNKDDRALLKVIKYASPTSAGAECVDPDCSW  198



>gb|KHN14523.1| 6-phosphofructokinase 5, chloroplastic [Glycine soja]
Length=439

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +1

Query  349  PTTFSLSNRGVHPTRN---GIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNC  519
            P+TFS + R  +PT +   G    DE  H Y++D DR LLK I Y+SPTSAGAE +DP C
Sbjct  2    PSTFSPNMR--NPTTSDFPGNYPLDEDWHGYINDNDRVLLKTIYYSSPTSAGAECIDPGC  59

Query  520  SWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            +W+E WV RAGPR  IYF P+EVKAAIV
Sbjct  60   NWVEQWVHRAGPREKIYFHPEEVKAAIV  87



>gb|EMS54761.1| 6-phosphofructokinase 5, chloroplastic [Triticum urartu]
Length=452

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            + YV++ DRAL+KVIKY+SPTSAGAE +DP+CSW+E WV RAGPR+ IY+EP+EVKAAIV
Sbjct  30   NGYVNNDDRALMKVIKYSSPTSAGAECIDPDCSWVEQWVHRAGPRKDIYYEPNEVKAAIV  89



>ref|XP_002530702.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF31697.1| phosphofructokinase, putative [Ricinus communis]
Length=431

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVK  591
            DE+ H Y+++ DR LLKVI ++SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P+EVK
Sbjct  16   DEEWHGYINNNDRVLLKVIHFSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKPEEVK  75

Query  592  AAIV  603
            AAIV
Sbjct  76   AAIV  79



>ref|XP_004509678.1| PREDICTED: 6-phosphofructokinase 5, chloroplastic-like [Cicer 
arietinum]
Length=429

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVK  591
            DE+ H Y+++ DR LLK I Y+SP SAGAE +DPNC+W+E WV RAGPR  IY++P+EVK
Sbjct  16   DEEWHGYINNNDRVLLKTINYSSPKSAGAECIDPNCTWVEQWVHRAGPREKIYYKPEEVK  75

Query  592  AAIV  603
            AAIV
Sbjct  76   AAIV  79



>emb|CBI18715.3| unnamed protein product [Vitis vinifera]
Length=471

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVK  591
            DE+ H Y++++DR LLKVI Y+SPTSAGAE +DP+C+W+E WV RAGPR  IYF+P+ V 
Sbjct  26   DEKWHGYINNSDRVLLKVIYYSSPTSAGAECIDPDCTWVEQWVHRAGPREKIYFKPETVN  85

Query  592  AAIV  603
            AAIV
Sbjct  86   AAIV  89



>gb|AAD22353.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
Length=463

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +1

Query  412  DEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVK  591
            DE+ H Y+++ DR LLKVI Y+SPTSAGAE +D +CSW+E W+ RAGPR  IYF P+EVK
Sbjct  23   DEEWHGYINNNDRVLLKVISYSSPTSAGAECLDHDCSWVEQWIHRAGPREKIYFRPEEVK  82

Query  592  AAIV  603
            AAI+
Sbjct  83   AAII  86



>ref|XP_002973951.1| hypothetical protein SELMODRAFT_100675 [Selaginella moellendorffii]
 gb|EFJ24906.1| hypothetical protein SELMODRAFT_100675 [Selaginella moellendorffii]
Length=520

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 4/120 (3%)
 Frame = +1

Query  247  VDFNDPEWKKKYQEEFEARFSLPHLKDTF-DAKPRPTTFSLSNRGVHPTRNGIDVFDEQK  423
            VD  D +   + + +F  +F LPH+ D F D +P PTTFS+ +    P  +  D   + K
Sbjct  49   VDLRDED---EIEADFGRKFRLPHISDVFPDLEPLPTTFSVKSSYPLPDYHFDDESKDLK  105

Query  424  HSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
              YV + DR LLKVI+Y SPTSAGA+    +C +  L V RAGPR+ IY  P+EVKAAIV
Sbjct  106  KMYVHNDDRVLLKVIEYVSPTSAGADCEGEDCKFRHLRVWRAGPRKKIYIRPEEVKAAIV  165



>ref|XP_001767506.1| predicted protein [Physcomitrella patens]
 gb|EDQ67641.1| predicted protein [Physcomitrella patens]
Length=543

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 69/127 (54%), Gaps = 7/127 (6%)
 Frame = +1

Query  226  VSCEKKGVDFNDPEWKKKYQEEFEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGID  405
            +S +K+GV        K   E++   F  PH+ D FD   RP+TF        P    ++
Sbjct  70   ISVDKRGVS------SKISDEDYAENFRPPHITDVFDIPARPSTFCAKTSLPLPEGRQVN  123

Query  406  VFDEQ-KHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPD  582
             +       +V + DR LLK IKYASPTSAGAE +D  C +   WV RAGPR  I+F+P 
Sbjct  124  RWSTNLGKMFVHEDDRVLLKTIKYASPTSAGAECMDGECRFQHQWVARAGPRSKIFFDPA  183

Query  583  EVKAAIV  603
            EV AAIV
Sbjct  184  EVNAAIV  190



>gb|ADE76905.1| unknown [Picea sitchensis]
Length=411

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  YVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            +V + DR LLKVIKYA+P+SAGAE VDP+C+++  WV RAGPR  IYF P+EVKAAIV
Sbjct  2    FVHNDDRVLLKVIKYATPSSAGAECVDPDCNFVHQWVHRAGPRPEIYFNPNEVKAAIV  59



>ref|XP_009409144.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic 
{ECO:0000255|HAMAP-Rule:MF_03186}-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=411

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +1

Query  457  LKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            L VIK+ASP SAGAE +DP+CSW+E WV RAGPR+ IY+EP EVKAAIV
Sbjct  11   LMVIKFASPNSAGAECIDPDCSWVEQWVHRAGPRKQIYYEPKEVKAAIV  59



>ref|XP_001769358.1| predicted protein [Physcomitrella patens]
 gb|EDQ65727.1| predicted protein [Physcomitrella patens]
Length=413

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  YVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            ++ + DR LLK IKYASP SAGAE VD +C++   WV RAGPR+ IYF+P+EV AAIV
Sbjct  2    FIHEDDRVLLKTIKYASPASAGAECVDRDCNFHHQWVARAGPRQKIYFDPEEVNAAIV  59



>tpg|DAA54690.1| TPA: hypothetical protein ZEAMMB73_253625 [Zea mays]
Length=515

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  385  PTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRH  564
            P  N  D        YV+DADRALL VIK+ASPTS   + + P+  W+E WV RAGP + 
Sbjct  401  PLENVNDTMQGSWDGYVNDADRALLMVIKFASPTSVRVDRIAPDYRWVEHWVHRAGPHKQ  460

Query  565  IYFEPDEVKAAIV  603
            IYFEP  VKA IV
Sbjct  461  IYFEPQYVKAGIV  473



>ref|XP_009144856.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic-like 
[Brassica rapa]
Length=393

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +1

Query  451  ALLK-VIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            AL++ VI Y+SPTSAGAE +D +CSW+E  + RAGPR  IYF P++VKAAI+
Sbjct  86   ALIREVISYSSPTSAGAECIDSDCSWVEQRIHRAGPREKIYFRPEQVKAAII  137



>ref|XP_002969111.1| hypothetical protein SELMODRAFT_146031 [Selaginella moellendorffii]
 gb|EFJ30227.1| hypothetical protein SELMODRAFT_146031 [Selaginella moellendorffii]
Length=404

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 10/58 (17%)
 Frame = +1

Query  430  YVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            YV + DR LLKVI+Y SPTSAGA+         E+W  RAGPR+ IY  P+EVKAAIV
Sbjct  2    YVHNDDRVLLKVIEYVSPTSAGAD--------CEVW--RAGPRKKIYIRPEEVKAAIV  49



>ref|XP_003083008.1| putative pyrophosphate-fructose-6-phosphate 1-p (ISS) [Ostreococcus 
tauri]
 emb|CAL56963.1| Pyrophosphate-dependent phosphofructokinase TP0108 [Ostreococcus 
tauri]
Length=505

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 7/70 (10%)
 Frame = +1

Query  415  EQKHSYVDDADRALLKVIKYAS---PT---SAGAEGVDPN-CSWLELWVPRAGPRRHIYF  573
            E   ++V ++DR LL  + + S   PT   S  AE  DPN C ++  WV RAGPR  +YF
Sbjct  90   EFNSNFVSNSDRVLLNSVAFGSSADPTQTCSLWAETFDPNGCDYVPQWVVRAGPRSEVYF  149

Query  574  EPDEVKAAIV  603
            + DEV AAIV
Sbjct  150  DSDEVHAAIV  159



>gb|KIZ06381.1| hypothetical protein MNEG_1568 [Monoraphidium neglectum]
Length=454

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 42/94 (45%), Gaps = 21/94 (22%)
 Frame = +1

Query  343  PRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIKYASPTSAGA-------E  501
            PRP+ F+  N                   +V D DR  L  ++Y S  S+GA        
Sbjct  23   PRPSPFTKDN--------------NAGAGFVGDKDRIRLHTVEYESELSSGAACGNGVVS  68

Query  502  GVDPNCSWLELWVPRAGPRRHIYFEPDEVKAAIV  603
            G D  C  L  W  R+GPR  IYFEP +V AAIV
Sbjct  69   GEDDTCLMLPEWAIRSGPRDTIYFEPSQVTAAIV  102



>ref|XP_001778081.1| predicted protein [Physcomitrella patens]
 gb|EDQ57087.1| predicted protein [Physcomitrella patens]
Length=549

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  418  QKHSYVDDADRALLKVIKYASPTSAGAEGVDPNCSWLELW-VPRAGPRRHIYFEPDEVKA  594
             K  Y+ D DR L+KV+ +  P+S G E ++ +  W E   V RAGPR  IYFEP  V+A
Sbjct  1    MKQIYIHDDDRVLIKVVHFGHPSSVGIE-LEDDGEWHESSRVRRAGPRAWIYFEPPSVRA  59

Query  595  AIV  603
            AIV
Sbjct  60   AIV  62



>ref|XP_001422557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00874.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=416

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 7/69 (10%)
 Frame = +1

Query  418  QKHSYVDDADRALLKVIKYAS---PT---SAGAEGVDPN-CSWLELWVPRAGPRRHIYFE  576
            +K ++V ++DR LL  + Y S   PT   S  ++  DP+ C ++  WV RAGPR  +YF+
Sbjct  2    RKTNFVSNSDRILLNSVAYGSAADPTQTCSLSSDVYDPSGCDYVPEWVVRAGPRAEVYFD  61

Query  577  PDEVKAAIV  603
            P+EV AA+V
Sbjct  62   PEEVHAAVV  70



>gb|KIZ02592.1| hypothetical protein MNEG_5364 [Monoraphidium neglectum]
Length=387

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 37/125 (30%)
 Frame = +1

Query  292  FEARFSLPHLKDTFDAKPRPTTFSLSNRGVHPTRNGIDVFDEQKHSYVDDADRALLKVIK  471
            ++   ++P ++D     PRP+ F+     VH    G          +VDD DR  L  I+
Sbjct  44   YDDYLAIPDIRDVL--TPRPSPFA-----VHNYFGG---------GFVDDGDRVALSSIQ  87

Query  472  YASPTSAGA----------EGVDPNCSWLEL-----------WVPRAGPRRHIYFEPDEV  588
            +AS TSAGA          EG   + +W+E            W  RAG R  I+ +P + 
Sbjct  88   FASGTSAGACGTSTAVLNDEGTQQSVNWMEASLEQLVTPLPPWAIRAGARATIFHDPKQT  147

Query  589  KAAIV  603
             AAIV
Sbjct  148  TAAIV  152



>ref|XP_001696305.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
 gb|EDP08282.1| phosphofructokinase family protein [Chlamydomonas reinhardtii]
Length=529

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 8/74 (11%)
 Frame = +1

Query  406  VFDEQKHSYVDDADRALLKVIKYASPTSAG---AEGVDPN-----CSWLELWVPRAGPRR  561
            V + Q   +V D DR  L  +++ S  SAG   A+GV  N     C  L  W  R GPR+
Sbjct  106  VDNNQGGGFVGDRDRIRLHTVEFESTESAGSFCADGVLTNGDEDSCILLPEWAIRCGPRK  165

Query  562  HIYFEPDEVKAAIV  603
             IYF+P +V AA+V
Sbjct  166  TIYFDPQQVSAAVV  179



>ref|XP_002505771.1| phosphofructokinase [Micromonas sp. RCC299]
 gb|ACO67029.1| phosphofructokinase [Micromonas sp. RCC299]
Length=575

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 12/70 (17%)
 Frame = +1

Query  430  YVDDADRALLKVIKYASPTSAGAE-----GVDPN-------CSWLELWVPRAGPRRHIYF  573
            +V + DR LLK I + SP S  A+      VD +       CS+   +  RAGPR  IYF
Sbjct  156  FVSEDDRVLLKAIAFGSPDSLAAQCSFDCSVDGSFDEPCDVCSFTPEFCYRAGPRAKIYF  215

Query  574  EPDEVKAAIV  603
            EP EV AAIV
Sbjct  216  EPAEVHAAIV  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 833277205081