BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig6008

Length=912
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...    192   3e-52   Nicotiana tomentosiformis
ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...    191   2e-51   Solanum tuberosum [potatoes]
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...    189   5e-51   Nicotiana sylvestris
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...    188   2e-50   Solanum lycopersicum
emb|CDP01069.1|  unnamed protein product                                169   7e-44   Coffea canephora [robusta coffee]
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein    168   2e-43   Gossypium arboreum [tree cotton]
gb|KJB64260.1|  hypothetical protein B456_010G039800                    167   2e-43   Gossypium raimondii
gb|KJB64258.1|  hypothetical protein B456_010G039800                    167   2e-43   Gossypium raimondii
gb|KJB64259.1|  hypothetical protein B456_010G039800                    167   3e-43   Gossypium raimondii
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...    164   3e-42   Sesamum indicum [beniseed]
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...    163   8e-42   
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...    163   8e-42   
ref|XP_012067887.1|  PREDICTED: probable pectin methyltransferase...    163   9e-42   Jatropha curcas
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...    152   4e-38   Malus domestica [apple tree]
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g             152   5e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...    152   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...    151   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...    150   1e-37   
gb|EYU36493.1|  hypothetical protein MIMGU_mgv1a018181mg                149   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...    150   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...    147   3e-36   Populus euphratica
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...    146   9e-36   
gb|KJB59032.1|  hypothetical protein B456_009G236100                    145   1e-35   Gossypium raimondii
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein    146   1e-35   Gossypium arboreum [tree cotton]
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg             145   1e-35   Prunus persica
gb|KJB59033.1|  hypothetical protein B456_009G236100                    145   2e-35   Gossypium raimondii
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...    145   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...    145   2e-35   Citrus sinensis [apfelsine]
gb|KJB59030.1|  hypothetical protein B456_009G236100                    145   2e-35   Gossypium raimondii
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...    145   2e-35   Prunus mume [ume]
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g             143   1e-34   
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                   143   1e-34   Citrus sinensis [apfelsine]
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg             143   1e-34   Citrus clementina [clementine]
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...    143   1e-34   Fragaria vesca subsp. vesca
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...    142   3e-34   Populus euphratica
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...    140   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...    136   4e-32   Glycine max [soybeans]
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                  136   4e-32   Glycine soja [wild soybean]
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...    135   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...    135   8e-32   Vitis vinifera
gb|KJB59916.1|  hypothetical protein B456_009G280800                    132   1e-31   Gossypium raimondii
gb|KJB59917.1|  hypothetical protein B456_009G280800                    131   7e-31   Gossypium raimondii
gb|KJB59918.1|  hypothetical protein B456_009G280800                    131   1e-30   Gossypium raimondii
ref|XP_011100984.1|  PREDICTED: probable pectin methyltransferase...    131   1e-30   Sesamum indicum [beniseed]
ref|XP_007136263.1|  hypothetical protein PHAVU_009G0319000g            127   2e-30   Phaseolus vulgaris [French bean]
gb|KHN19772.1|  Putative pectin methyltransferase QUA2                  130   3e-30   Glycine soja [wild soybean]
ref|XP_003522790.1|  PREDICTED: probable pectin methyltransferase...    129   7e-30   Glycine max [soybeans]
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...    129   1e-29   Cucumis melo [Oriental melon]
ref|XP_010098612.1|  putative pectin methyltransferase QUA2             127   5e-29   Morus notabilis
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...    126   7e-29   Cucumis sativus [cucumbers]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...    125   3e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH34953.1|  pectin methyltransferase QUA2, putative                 122   2e-27   Medicago truncatula
ref|XP_006390005.1|  hypothetical protein EUTSA_v10018220mg             121   6e-27   Eutrema salsugineum [saltwater cress]
ref|XP_004500638.1|  PREDICTED: probable pectin methyltransferase...    120   9e-27   
gb|KJB64256.1|  hypothetical protein B456_010G039800                    120   9e-27   Gossypium raimondii
ref|XP_004500637.1|  PREDICTED: probable pectin methyltransferase...    120   1e-26   Cicer arietinum [garbanzo]
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g             119   3e-26   Phaseolus vulgaris [French bean]
gb|KHN44795.1|  Putative pectin methyltransferase QUA2                  119   3e-26   Glycine soja [wild soybean]
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...    118   5e-26   Glycine max [soybeans]
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...    117   8e-26   
ref|XP_004490695.1|  PREDICTED: probable pectin methyltransferase...    116   3e-25   Cicer arietinum [garbanzo]
ref|XP_006300626.1|  hypothetical protein CARUB_v10019895mg             116   3e-25   Capsella rubella
ref|XP_010269315.1|  PREDICTED: probable pectin methyltransferase...    116   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_003615127.1|  hypothetical protein MTR_5g064080                  115   4e-25   Medicago truncatula
ref|XP_010269316.1|  PREDICTED: probable pectin methyltransferase...    116   4e-25   Nelumbo nucifera [Indian lotus]
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                  114   2e-24   Glycine soja [wild soybean]
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...    113   3e-24   Glycine max [soybeans]
emb|CDX79252.1|  BnaC06g20510D                                          112   7e-24   
emb|CDX68025.1|  BnaA07g20650D                                          110   3e-23   
ref|XP_002889181.1|  hypothetical protein ARALYDRAFT_895718             109   5e-23   Arabidopsis lyrata subsp. lyrata
gb|AAF71804.1|AC013430_13  F3F9.21                                      109   9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177948.3|  putative pectin methyltransferase TSD2                108   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KDO81002.1|  hypothetical protein CISIN_1g005417mg                   104   4e-22   Citrus sinensis [apfelsine]
ref|XP_006472587.1|  PREDICTED: probable pectin methyltransferase...    106   6e-22   Citrus sinensis [apfelsine]
gb|KDO81000.1|  hypothetical protein CISIN_1g005417mg                   104   1e-21   Citrus sinensis [apfelsine]
gb|KDO80995.1|  hypothetical protein CISIN_1g005417mg                   104   3e-21   Citrus sinensis [apfelsine]
gb|KDO80999.1|  hypothetical protein CISIN_1g005417mg                   103   4e-21   Citrus sinensis [apfelsine]
ref|XP_009104583.1|  PREDICTED: probable pectin methyltransferase...    103   8e-21   Brassica rapa
ref|XP_008779373.1|  PREDICTED: probable pectin methyltransferase...  99.0    3e-20   
ref|XP_008811174.1|  PREDICTED: probable pectin methyltransferase...  99.4    1e-19   Phoenix dactylifera
ref|XP_010416801.1|  PREDICTED: probable pectin methyltransferase...  98.6    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...  98.6    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010472034.1|  PREDICTED: probable pectin methyltransferase...  98.6    3e-19   Camelina sativa [gold-of-pleasure]
gb|KJB59914.1|  hypothetical protein B456_009G280800                  98.2    3e-19   Gossypium raimondii
gb|KJB59919.1|  hypothetical protein B456_009G280800                  98.2    3e-19   Gossypium raimondii
gb|KJB59915.1|  hypothetical protein B456_009G280800                  98.2    3e-19   Gossypium raimondii
gb|KJB59031.1|  hypothetical protein B456_009G236100                  94.7    4e-18   Gossypium raimondii
ref|XP_009128288.1|  PREDICTED: probable pectin methyltransferase...  94.7    4e-18   Brassica rapa
ref|NP_001288873.1|  probable pectin methyltransferase QUA2           94.7    5e-18   Brassica rapa
gb|EPS65073.1|  hypothetical protein M569_09706                       94.4    6e-18   Genlisea aurea
gb|ERN14661.1|  hypothetical protein AMTR_s00038p00207680             94.0    1e-17   Amborella trichopoda
ref|XP_006853194.2|  PREDICTED: probable pectin methyltransferase...  94.0    1e-17   Amborella trichopoda
emb|CDY14622.1|  BnaC02g24910D                                        93.6    1e-17   Brassica napus [oilseed rape]
ref|XP_010428946.1|  PREDICTED: probable pectin methyltransferase...  93.6    1e-17   Camelina sativa [gold-of-pleasure]
emb|CDY26858.1|  BnaA02g18830D                                        93.6    1e-17   Brassica napus [oilseed rape]
ref|XP_008790887.1|  PREDICTED: probable pectin methyltransferase...  90.9    9e-17   Phoenix dactylifera
ref|XP_010937423.1|  PREDICTED: probable pectin methyltransferase...  90.5    1e-16   Elaeis guineensis
ref|XP_009380861.1|  PREDICTED: probable pectin methyltransferase...  90.1    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939668.1|  PREDICTED: probable pectin methyltransferase...  89.4    3e-16   Elaeis guineensis
ref|XP_009387117.1|  PREDICTED: probable pectin methyltransferase...  88.2    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409275.1|  PREDICTED: probable pectin methyltransferase...  85.1    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87461.1|  BnaA07g34120D                                        76.6    4e-12   
ref|XP_009106531.1|  PREDICTED: probable pectin methyltransferase...  76.6    4e-12   Brassica rapa
emb|CDX88430.1|  BnaC06g38740D                                        76.6    4e-12   
ref|XP_010916838.1|  PREDICTED: probable pectin methyltransferase...  74.3    2e-11   Elaeis guineensis
ref|XP_008781887.1|  PREDICTED: probable pectin methyltransferase...  73.6    4e-11   Phoenix dactylifera
ref|XP_010926317.1|  PREDICTED: probable pectin methyltransferase...  72.8    6e-11   Elaeis guineensis
ref|XP_010926316.1|  PREDICTED: probable pectin methyltransferase...  72.8    7e-11   Elaeis guineensis
ref|XP_002452533.1|  hypothetical protein SORBIDRAFT_04g027500        66.2    1e-08   
ref|XP_010680526.1|  PREDICTED: probable pectin methyltransferase...  65.5    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007045901.1|  Quasimodo2 like 2 isoform 6                      65.1    2e-08   
ref|XP_007045897.1|  Quasimodo2 like 2 isoform 2                      65.1    2e-08   
ref|XP_007045896.1|  Quasimodo2 like 2 isoform 1                      65.1    2e-08   
gb|EAY87574.1|  hypothetical protein OsI_08986                        65.1    3e-08   Oryza sativa Indica Group [Indian rice]
dbj|BAD17245.1|  putative early-responsive to dehydration stress ...  65.1    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24662.1|  hypothetical protein OsJ_08431                        65.1    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KDO81798.1|  hypothetical protein CISIN_1g012595mg                 63.2    7e-08   Citrus sinensis [apfelsine]
ref|XP_003570613.2|  PREDICTED: probable pectin methyltransferase...  63.5    8e-08   
ref|XP_011012134.1|  PREDICTED: probable methyltransferase PMT5       63.2    1e-07   Populus euphratica
emb|CAN64161.1|  hypothetical protein VITISV_040644                   62.4    1e-07   Vitis vinifera
ref|XP_006484179.1|  PREDICTED: probable methyltransferase PMT5-l...  62.8    1e-07   Citrus sinensis [apfelsine]
gb|KDO81792.1|  hypothetical protein CISIN_1g012595mg                 62.4    2e-07   Citrus sinensis [apfelsine]
ref|XP_006437954.1|  hypothetical protein CICLE_v10031472mg           62.4    2e-07   
ref|XP_008221508.1|  PREDICTED: probable methyltransferase PMT5       62.4    2e-07   Prunus mume [ume]
emb|CBI27261.3|  unnamed protein product                              62.0    2e-07   Vitis vinifera
ref|XP_007226959.1|  hypothetical protein PRUPE_ppa002650mg           62.4    2e-07   
ref|XP_010649494.1|  PREDICTED: probable methyltransferase PMT5       62.0    3e-07   Vitis vinifera
ref|XP_009802931.1|  PREDICTED: probable methyltransferase PMT5       61.6    3e-07   Nicotiana sylvestris
ref|XP_011075591.1|  PREDICTED: probable methyltransferase PMT5       61.6    3e-07   Sesamum indicum [beniseed]
ref|XP_008361773.1|  PREDICTED: probable methyltransferase PMT5       61.6    4e-07   
ref|XP_008339821.1|  PREDICTED: probable methyltransferase PMT5       59.3    5e-07   
ref|XP_002512094.1|  ATP binding protein, putative                    60.8    6e-07   
ref|XP_008390042.1|  PREDICTED: probable methyltransferase PMT5       60.5    6e-07   
ref|XP_002316092.1|  dehydration-responsive family protein            60.8    7e-07   
ref|XP_008360171.1|  PREDICTED: probable methyltransferase PMT5       60.1    1e-06   
ref|XP_009356400.1|  PREDICTED: probable methyltransferase PMT5       59.7    1e-06   Pyrus x bretschneideri [bai li]
gb|KDP41290.1|  hypothetical protein JCGZ_15697                       59.7    1e-06   Jatropha curcas
gb|KJB30457.1|  hypothetical protein B456_005G145000                  59.3    1e-06   Gossypium raimondii
ref|XP_010258081.1|  PREDICTED: probable methyltransferase PMT5       59.3    2e-06   
ref|XP_012067761.1|  PREDICTED: probable methyltransferase PMT5       59.3    2e-06   Jatropha curcas
gb|KJB30458.1|  hypothetical protein B456_005G145000                  58.9    3e-06   Gossypium raimondii
ref|XP_010906131.1|  PREDICTED: probable methyltransferase PMT5       58.5    3e-06   Elaeis guineensis
ref|XP_010527954.1|  PREDICTED: probable methyltransferase PMT5       58.5    3e-06   
gb|ERN00004.1|  hypothetical protein AMTR_s00110p00151520             58.5    3e-06   Amborella trichopoda
ref|XP_011621117.1|  PREDICTED: probable methyltransferase PMT5       58.5    3e-06   
ref|XP_008807815.1|  PREDICTED: probable methyltransferase PMT5       58.2    4e-06   
ref|XP_008679296.1|  PREDICTED: probable pectin methyltransferase...  58.2    4e-06   Zea mays [maize]
gb|AFW64432.1|  hypothetical protein ZEAMMB73_102169                  58.2    5e-06   
gb|KHG00547.1|  hypothetical protein F383_17617                       58.2    5e-06   Gossypium arboreum [tree cotton]
ref|XP_004953963.1|  PREDICTED: probable pectin methyltransferase...  58.2    5e-06   
ref|XP_008446426.1|  PREDICTED: probable methyltransferase PMT5       57.8    6e-06   Cucumis melo [Oriental melon]
gb|KGN51971.1|  hypothetical protein Csa_5G606620                     57.8    6e-06   Cucumis sativus [cucumbers]
ref|XP_008797048.1|  PREDICTED: probable methyltransferase PMT5 i...  57.8    6e-06   
ref|XP_011655706.1|  PREDICTED: probable methyltransferase PMT5       57.8    7e-06   Cucumis sativus [cucumbers]
dbj|BAJ94920.1|  predicted protein                                    57.8    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008797047.1|  PREDICTED: probable methyltransferase PMT5 i...  57.4    7e-06   Phoenix dactylifera
ref|XP_008797046.1|  PREDICTED: probable methyltransferase PMT5 i...  57.4    8e-06   Phoenix dactylifera
dbj|BAJ86389.1|  predicted protein                                    57.4    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW73497.1|  hypothetical protein ZEAMMB73_264626                  57.4    8e-06   
ref|XP_010109369.1|  putative methyltransferase PMT5                  57.4    9e-06   
ref|XP_010066852.1|  PREDICTED: probable methyltransferase PMT5       57.4    9e-06   Eucalyptus grandis [rose gum]
ref|XP_008646287.1|  PREDICTED: probable pectin methyltransferase...  57.4    9e-06   Zea mays [maize]
ref|XP_009777410.1|  PREDICTED: probable methyltransferase PMT5 i...  57.0    1e-05   Nicotiana sylvestris
ref|XP_009777411.1|  PREDICTED: probable methyltransferase PMT5 i...  57.0    1e-05   Nicotiana sylvestris
ref|XP_010458849.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  57.0    1e-05   
ref|XP_006307032.1|  hypothetical protein CARUB_v10008622mg           56.6    1e-05   Capsella rubella
ref|XP_006573141.1|  PREDICTED: probable methyltransferase PMT5-l...  56.6    2e-05   Glycine max [soybeans]
gb|KHN03641.1|  Putative methyltransferase PMT4                       56.6    2e-05   Glycine soja [wild soybean]
ref|XP_009798763.1|  PREDICTED: probable methyltransferase PMT5       56.2    2e-05   Nicotiana sylvestris
ref|NP_027543.2|  QUASIMODO2 like 2                                   56.2    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50580.1|  hypothetical protein B456_008G177800                  55.8    2e-05   Gossypium raimondii
ref|XP_010476413.1|  PREDICTED: probable methyltransferase PMT4       55.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|NP_973410.1|  QUASIMODO2 like 2                                   55.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495624.1|  PREDICTED: probable methyltransferase PMT4       55.8    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009631772.1|  PREDICTED: probable methyltransferase PMT5 i...  55.8    3e-05   Nicotiana tomentosiformis
ref|XP_009631773.1|  PREDICTED: probable methyltransferase PMT5 i...  55.8    3e-05   Nicotiana tomentosiformis
ref|XP_006574934.1|  PREDICTED: probable methyltransferase PMT4-l...  55.5    3e-05   Glycine max [soybeans]
ref|XP_009129088.1|  PREDICTED: probable methyltransferase PMT5       55.5    3e-05   Brassica rapa
gb|KJB50579.1|  hypothetical protein B456_008G177800                  55.5    3e-05   Gossypium raimondii
gb|KHN29999.1|  Putative methyltransferase PMT4                       55.5    3e-05   Glycine soja [wild soybean]
ref|XP_006574937.1|  PREDICTED: probable methyltransferase PMT4-l...  55.5    3e-05   Glycine max [soybeans]
emb|CDY53946.1|  BnaA02g36960D                                        55.5    3e-05   Brassica napus [oilseed rape]
ref|XP_009152172.1|  PREDICTED: probable methyltransferase PMT5       55.5    3e-05   Brassica rapa
dbj|BAH56871.1|  AT1G13860                                            55.5    3e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42014.1|  unknown protein                                      55.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006379687.1|  hypothetical protein POPTR_0008s09440g           55.1    4e-05   
gb|AAF79416.1|AC068197_26  F16A14.7                                   55.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172839.1|  QUASIMODO2 LIKE 1                                   55.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237055.1|  PREDICTED: probable methyltransferase PMT5       55.1    4e-05   
ref|XP_007157839.1|  hypothetical protein PHAVU_002G102600g           55.1    5e-05   Phaseolus vulgaris [French bean]
ref|XP_006348706.1|  PREDICTED: probable methyltransferase PMT5-l...  55.1    5e-05   Solanum tuberosum [potatoes]
ref|XP_006348707.1|  PREDICTED: probable methyltransferase PMT5-l...  54.7    5e-05   Solanum tuberosum [potatoes]
ref|XP_010425141.1|  PREDICTED: probable methyltransferase PMT5 i...  54.7    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010514117.1|  PREDICTED: probable methyltransferase PMT5       54.7    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010425139.1|  PREDICTED: probable methyltransferase PMT5 i...  54.7    5e-05   
ref|XP_010502360.1|  PREDICTED: probable methyltransferase PMT5       54.7    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002892777.1|  hypothetical protein ARALYDRAFT_471543           54.7    6e-05   
gb|KHG21066.1|  hypothetical protein F383_04870                       54.7    6e-05   Gossypium arboreum [tree cotton]
ref|XP_002875206.1|  predicted protein                                54.7    6e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_011463023.1|  PREDICTED: probable methyltransferase PMT5       54.7    7e-05   Fragaria vesca subsp. vesca
ref|XP_006365134.1|  PREDICTED: probable methyltransferase PMT5-l...  54.3    7e-05   Solanum tuberosum [potatoes]
ref|XP_010323873.1|  PREDICTED: probable methyltransferase PMT5       54.3    7e-05   Solanum lycopersicum
gb|KJB80352.1|  hypothetical protein B456_013G093300                  54.3    8e-05   Gossypium raimondii
ref|XP_010320876.1|  PREDICTED: probable methyltransferase PMT5       54.3    9e-05   
gb|KHG30605.1|  hypothetical protein F383_04558                       53.9    1e-04   Gossypium arboreum [tree cotton]
ref|XP_007153532.1|  hypothetical protein PHAVU_003G043400g           53.9    1e-04   Phaseolus vulgaris [French bean]
ref|XP_010554289.1|  PREDICTED: probable methyltransferase PMT5       53.9    1e-04   Tarenaya hassleriana [spider flower]
gb|KJB80353.1|  hypothetical protein B456_013G093300                  53.9    1e-04   Gossypium raimondii
ref|XP_011018345.1|  PREDICTED: probable methyltransferase PMT5 i...  53.9    1e-04   Populus euphratica
ref|XP_006395700.1|  hypothetical protein EUTSA_v10003873mg           53.9    1e-04   
ref|XP_011018362.1|  PREDICTED: probable methyltransferase PMT5 i...  53.5    1e-04   Populus euphratica
ref|XP_009114154.1|  PREDICTED: probable methyltransferase PMT5       53.1    2e-04   Brassica rapa
ref|XP_006292704.1|  hypothetical protein CARUB_v10018950mg           53.1    2e-04   
gb|AES89995.2|  methyltransferase PMT16, putative                     52.8    3e-04   Medicago truncatula
ref|XP_003607798.1|  hypothetical protein MTR_4g083030                52.8    3e-04   
ref|XP_009590890.1|  PREDICTED: probable methyltransferase PMT5       52.4    3e-04   Nicotiana tomentosiformis
ref|XP_004505366.1|  PREDICTED: probable methyltransferase PMT5-like  52.0    4e-04   Cicer arietinum [garbanzo]
ref|XP_006344244.1|  PREDICTED: probable methyltransferase PMT5-l...  52.0    5e-04   Solanum tuberosum [potatoes]
ref|XP_010680718.1|  PREDICTED: probable methyltransferase PMT5       51.6    6e-04   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY02989.1|  BnaC07g22380D                                        51.2    7e-04   
emb|CDY51215.1|  BnaA06g39940D                                        51.2    7e-04   Brassica napus [oilseed rape]
emb|CDY37197.1|  BnaC02g35050D                                        50.8    0.001   Brassica napus [oilseed rape]



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            N     DDSQMKDK EKED + ++SAGDQ+ LS+KFL RIL  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRSAGDQTPLSIKFLSRILFPDNSPSKQSLGENGLLSD  77

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFSPG GR+++K+TLLL++LSLV I++LALTGSFWWTISITSSSRG+IYHGYR+LQEQVV
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSFWWTISITSSSRGQIYHGYRQLQEQVV  137

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL+DIG LSLG++ +KD+EYCPPE+EN+VPCFNVSE+L+LG 
Sbjct  138  SDLRDIGKLSLGAANVKDMEYCPPESENFVPCFNVSENLDLGL  180



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            N   F DDSQMKDKIEKED + ++S GDQ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDQTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFSPG GR+++K+ L L++LSLV IV+LALTGSFWWTISITSSSRG IYHGYR+LQEQVV
Sbjct  78   PFSPGTGRNRLKYALGLIRLSLVGIVLLALTGSFWWTISITSSSRGHIYHGYRQLQEQVV  137

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DLKDIG LSLG++ +KD+EYCPPE+EN++PCFNVSE+L+LG 
Sbjct  138  SDLKDIGQLSLGAANVKDIEYCPPESENFIPCFNVSENLDLGL  180



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            N     DDSQMKDK EKED + +++AGDQ+ LS+KFL R+L  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRAAGDQTHLSIKFLSRMLFPDNSPSKQSLGENGLLSD  77

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFSPG GR+++K+TLLL++LSLV I++LALTGSFWWTISITSSSRG+IYHGYR+LQEQVV
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSFWWTISITSSSRGQIYHGYRQLQEQVV  137

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL+DIG LSLG++ +KD+EYCPPE+EN+VPCFNVSE+L+ G 
Sbjct  138  SDLRDIGKLSLGAANVKDMEYCPPESENFVPCFNVSENLDFGL  180



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            N   F DDSQMKDKIEKED + ++S GD ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDLTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFSPG GR+++K+ L+L++LSLV I++LALTGSFWWTISITSSSRG IYHGYR+LQEQVV
Sbjct  78   PFSPGTGRNRLKYALVLIRLSLVVIILLALTGSFWWTISITSSSRGHIYHGYRQLQEQVV  137

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL+DIG LSLG++ +KD+EYCPPE+EN++PCFNVSE+L+LG 
Sbjct  138  SDLRDIGQLSLGATNVKDIEYCPPESENFIPCFNVSENLDLGL  180



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  442  DDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGA  621
            DDSQMKDK+EKED D      DQ++LS++   R L TD S +K+G+ ENG++S+PFSPG 
Sbjct  22   DDSQMKDKLEKEDVDRKSPNADQTYLSIRQPFRFLLTDNSSSKHGLMENGFVSDPFSPGV  81

Query  622  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDI  801
             R++ K TLLLL+LSLV IV+LALTGSFWWTISIT+SSRG++Y GYRRLQ+Q+V DL D+
Sbjct  82   LRNRHKRTLLLLRLSLVVIVILALTGSFWWTISITTSSRGQVYRGYRRLQQQLVSDLVDV  141

Query  802  GHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            G LSLGS++LKDLEYC PE+ENYVPCFNVSE+L LG 
Sbjct  142  GKLSLGSTRLKDLEYCSPESENYVPCFNVSENLALGI  178



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K GV+ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGVTENGFASD  76

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRLQEQ+V
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQLV  136

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            LDL DIG LSLG+S++K++++CP E+EN++PCFN+SE+L LG+
Sbjct  137  LDLWDIGELSLGASRMKEIDFCPEESENHIPCFNISENLALGY  179



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRLQEQ+V
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQLV  136

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            LDL DIG LSLG+S++K++++CP E+EN++PCFN+SE+L LG+
Sbjct  137  LDLWDIGELSLGASRMKEIDFCPEESENHIPCFNISENLALGY  179



>gb|KJB64258.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64261.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=630

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRLQEQ+V
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQLV  136

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            LDL DIG LSLG+S++K++++CP E+EN++PCFN+SE+L LG+
Sbjct  137  LDLWDIGELSLGASRMKEIDFCPEESENHIPCFNISENLALGY  179



>gb|KJB64259.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=691

 Score =   167 bits (423),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 135/163 (83%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRLQEQ+V
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQLV  136

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            LDL DIG LSLG+S++K++++CP E+EN++PCFN+SE+L LG+
Sbjct  137  LDLWDIGELSLGASRMKEIDFCPEESENHIPCFNISENLALGY  179



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  600
            NSQ F +DSQMK++ EKED D S++ G D +FLS+KF  R L TD   +K+  SENG++S
Sbjct  19   NSQDFWEDSQMKERTEKEDLDRSRANGADNTFLSLKFPFRYLFTDNLSSKH-FSENGFMS  77

Query  601  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQV  780
            +PFSPG  RS+ K TL LLK SLV IV+LALTGSFWWT+SITS++RG+I+ GYRRLQEQ+
Sbjct  78   DPFSPGPLRSRHKVTLTLLKFSLVVIVILALTGSFWWTLSITSTTRGQIFRGYRRLQEQL  137

Query  781  VLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            V DL +IG LSLG+S+ K+LEYC  E+ENYVPCFNVSE+L LGF
Sbjct  138  VSDLYEIGELSLGTSRFKELEYCSQESENYVPCFNVSENLALGF  181



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSFWWTISI++SSRG I+HGYRRLQEQ+V
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSFWWTISISTSSRGHIFHGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+CP E+EN++PCFNVSE+L LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCPEESENFIPCFNVSENLALGY  177



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSFWWTISI++SSRG I+HGYRRLQEQ+V
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSFWWTISISTSSRGHIFHGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+CP E+EN++PCFNVSE+L LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCPEESENFIPCFNVSENLALGY  177



>ref|XP_012067887.1| PREDICTED: probable pectin methyltransferase QUA2 [Jatropha curcas]
 gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 3/164 (2%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKS-PTKNGVSENGYLS  600
            NSQ  L DSQMKDK EKED D ++S+ DQS+L++KF LR+L  D S P+K G  ENG+ S
Sbjct  16   NSQE-LWDSQMKDKTEKEDLDRNRSS-DQSYLALKFPLRVLFPDNSSPSKYGTGENGFAS  73

Query  601  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQV  780
            +PFS G  RS+ KFTLLLLKLSL  I+VLALTGSFWWTISI++SSR +I H YRRLQEQ+
Sbjct  74   DPFSIGTPRSRHKFTLLLLKLSLAVILVLALTGSFWWTISISTSSRVQILHNYRRLQEQL  133

Query  781  VLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            V DL DIG LSLGSS+LK++E+CP E+EN+VPCFNVSE+L LG+
Sbjct  134  VSDLWDIGELSLGSSRLKEVEFCPQESENHVPCFNVSENLALGY  177



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KED D   S+ + SF + KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K TLLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRLQ+Q+V DL  IG
Sbjct  82   RSRHKLTLLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQLVSDLWHIG  141

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLGSS+L+DLE+CP E EN VPCFNVSE+L LG 
Sbjct  142  ELSLGSSRLRDLEFCPQEYENNVPCFNVSENLALGL  177



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  615
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L   + SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPENNSPSKYGSGENGFASDPFIV  79

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G+ RS+ K+ LLLLKLSL  IV+LALTGSFWWTISIT+ SRG+I H YRRLQEQ+V DL 
Sbjct  80   GSPRSRHKWALLLLKLSLAVIVILALTGSFWWTISITTMSRGQILHNYRRLQEQLVSDLW  139

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LSLGSS+L++LE+C  E+ENY PCFNVSE+L LG+
Sbjct  140  DIGELSLGSSRLQELEFCSEESENYAPCFNVSENLALGY  178



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   152 bits (383),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRLQ+Q+V DL  IG
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQLVSDLWHIG  141

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLGSS+L+DLE+CP E EN VPCFNVSE+L LG 
Sbjct  142  ELSLGSSRLRDLEFCPQENENNVPCFNVSENLALGL  177



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 127/163 (78%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            +S  FLD SQMKDK +KED D   S+ + SF + +  +R+L  D SP+K+G +ENG+ S+
Sbjct  17   SSNDFLD-SQMKDKTDKEDLDRRASSDNNSF-AFRLPVRVLFPDNSPSKHGNTENGFASD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PF  G  RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG+I+HGYRRLQEQ+V
Sbjct  75   PFMAGTPRSRHKLMLLLLKLSLVLIVILALTGSFWWTLSISTTSRGRIHHGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL  IG LSLGSS+LKDLE+CP E EN VPCFNVSE+L LG 
Sbjct  135  SDLWHIGELSLGSSRLKDLEFCPQEYENNVPCFNVSENLALGL  177



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 130/156 (83%), Gaps = 2/156 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  615
            L DSQMKDK EKE+ + ++S+ DQS+L+++F  R+L  D  SP+K G +ENG  S+PFS 
Sbjct  21   LWDSQMKDKPEKEELEKNRSS-DQSYLALRFPFRVLFPDNVSPSKYGSTENGIASDPFSI  79

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G  RS+ KFTLLLLKLSLV I+VLALTGSFWWTISIT+SSRG+I+H YRRLQEQ+V DL 
Sbjct  80   GTPRSRHKFTLLLLKLSLVVILVLALTGSFWWTISITTSSRGQIFHNYRRLQEQLVSDLW  139

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            DIG LSLGSS+LK++E+CP + ENYVPC+NVSE+++
Sbjct  140  DIGELSLGSSRLKEVEFCPQQYENYVPCYNVSENID  175



>gb|EYU36493.1| hypothetical protein MIMGU_mgv1a018181mg, partial [Erythranthe 
guttata]
Length=497

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  600
            NS    +DSQMK++ +KED D  ++ G D +  S+KFL R L  D   +K+G++EN ++S
Sbjct  21   NSHDLWEDSQMKERPDKEDVDPKRTNGADHTHSSIKFLFRYLFPDNLSSKHGLNENSFMS  80

Query  601  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQV  780
            +PFSPG  RS+ K TL  LKLSLV IV+LALTGSF+WT+SITS+SRG+I+ GYRRLQEQV
Sbjct  81   DPFSPGPTRSRHKVTLSFLKLSLVVIVILALTGSFYWTLSITSTSRGQIFRGYRRLQEQV  140

Query  781  VLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            V DL +IG LSLG S++++LEYC  E+ NYVPCFNVSE+L LG 
Sbjct  141  VTDLYEIGELSLGFSRMRELEYCSMESLNYVPCFNVSENLALGL  184



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            +SQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   NSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRLQ+Q+V DL  IG
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQLVSDLWHIG  141

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLGSS+L+DLE+CP E EN VPCFNVSE+L LG 
Sbjct  142  ELSLGSSRLRDLEFCPQENENNVPCFNVSENLALGL  177



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  615
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L  D  SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPDNNSPSKYGSGENGFASDPFIV  79

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G+ RS+ K  LLLLKLSL  IV+LAL GSFWWTISIT+ SRG+I H YRRLQEQ+V DL 
Sbjct  80   GSPRSRHKLALLLLKLSLAVIVILALAGSFWWTISITTMSRGQILHNYRRLQEQLVSDLW  139

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LSLGSS+L++LE+C  E+ENY PCFNVSE+L LG+
Sbjct  140  DIGELSLGSSRLQELEFCSEESENYAPCFNVSENLALGY  178



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score =   146 bits (368),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KED D   S+ + SF + +  +R+L  D SP+K G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFRMPIRVLFPDNSPSKXGNTENGFASDPFMAGTP  81

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG I+HGYRRLQ+Q+V DL  IG
Sbjct  82   RSRHKLMLLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIHHGYRRLQQQLVSDLWHIG  141

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLGSS+LKDLE+CP E EN  PCFNVSE+L LG 
Sbjct  142  ELSLGSSRLKDLEFCPQEYENNAPCFNVSENLALGL  177



>gb|KJB59032.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=597

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRLQEQ+V
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+C  E ENY+PCFNVSE++ LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCSEEFENYIPCFNVSENVALGY  177



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D +++KDK EKE+ D + S+  QSFLS++   R+   D SP K GV+ENG+ S+
Sbjct  17   NSNDFWD-AEVKDKTEKEESDRNHSSS-QSFLSLRSPFRLFFQDNSPPKYGVTENGFTSD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRLQEQ+V
Sbjct  75   PFRGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+C  E+ENY+PCFNVSE++ LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCSEESENYIPCFNVSENVALGY  177



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +1

Query  367  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  546
            M+RPLHRG S   G R SGNS  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGNSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  547  STDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisit  726
              D SP+K+G + NG+ S+P      RS+ K  LLLLKLSLV IV+LALTGSFWWTISI+
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHKLALLLLKLSLVLIVILALTGSFWWTISIS  118

Query  727  sssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLEL  906
            ++SRG++YHGYRRLQ+Q+V DL  IG LSLGSS+L+DLE+CP E EN+VPCFNVSE+L L
Sbjct  119  TTSRGRVYHGYRRLQQQLVSDLWHIGELSLGSSRLRDLEFCPQEFENHVPCFNVSENLAL  178

Query  907  GF  912
            G 
Sbjct  179  GL  180



>gb|KJB59033.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
 gb|KJB59034.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=644

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRLQEQ+V
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+C  E ENY+PCFNVSE++ LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCSEEFENYIPCFNVSENVALGY  177



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQMKDK EK D D S+S  D +FL+++F    L ++ S  KNG++ENG+ S+P+  G
Sbjct  21   LWDSQMKDKTEKGDLDRSRSM-DNTFLALRFPFGFLFSNHSSPKNGINENGFASDPYISG  79

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ +  +LLLK+SLV IV++ALTGSFWWTISI++SSRG IYH YRRLQEQ+V DL D
Sbjct  80   TARSRHRLMMLLLKISLVVIVIVALTGSFWWTISISTSSRGHIYHNYRRLQEQLVSDLLD  139

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +SLG ++ K++E+C  ++ENYVPCFNVSE+L LG+
Sbjct  140  IGEISLGPNRWKEMEFCSADSENYVPCFNVSENLALGY  177



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 123/158 (78%), Gaps = 3/158 (2%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  618
            DS+MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DSEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL D
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWD  141

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +SLGS++ KDLE+C  + ENYVPCFN S++L LG+
Sbjct  142  IGEISLGSTRSKDLEFCSEDFENYVPCFNESQNLALGY  179



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 124/163 (76%), Gaps = 2/163 (1%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRLQEQ+V
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQLV  134

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DL DIG LSLG S+LK++E+C  E ENY+PCFNVSE++ LG+
Sbjct  135  SDLWDIGELSLGPSRLKEIEFCSEEFENYIPCFNVSENVALGY  177



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = +1

Query  367  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  546
            M+RPLHRG S   G R SG+S  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGSSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  547  STDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisit  726
              D SP+K+G + NG+ S+P      RS+ K  LLLLKLSLV IV+LALTGSFWWTISI+
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHKLALLLLKLSLVLIVILALTGSFWWTISIS  118

Query  727  sssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLEL  906
            ++SRG++YHGYRRLQ+Q+V DL  IG LSLGSS+L+DLE+CP E+EN+VPCFNVSE+L L
Sbjct  119  TTSRGRVYHGYRRLQQQLVSDLWHIGELSLGSSRLRDLEFCPQESENHVPCFNVSENLAL  178

Query  907  GF  912
            G 
Sbjct  179  GL  180



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  615
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L  D  SP+K    E+G+ S+PFS 
Sbjct  45   LWDSQMKDKTEKEDMDRNRSS-DQSYLALKFPFRVLFPDNNSPSKYVNGESGFASDPFSV  103

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G+ RS+ K TLLLLKLSL  IVVLALTGSFWWTISI++ SRG+I H YRRLQEQ+V D+ 
Sbjct  104  GSPRSRHKLTLLLLKLSLAVIVVLALTGSFWWTISISTLSRGQILHTYRRLQEQLVSDMW  163

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LSLGSS+L++LE+C  E+E YVPCFNVSE+L LG+
Sbjct  164  DIGELSLGSSRLQELEFCSQESEIYVPCFNVSENLALGY  202



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  618
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL D
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWD  141

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  142  IGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  179



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  618
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL D
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWD  141

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  142  IGEISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  179



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KED D   S+ DQ+  S +  +R+L  + SP+K GV ENG+ S P    + 
Sbjct  20   DSQMKDKTDKEDLDRRASS-DQNSFSFRIPVRLLLGENSPSKQGVGENGFASEPLLAVSP  78

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LLLLKLSLV IV+ ALTGSFWWTISI+++SRG IYHGYRRLQ+Q+V DL  IG
Sbjct  79   RSRHKLALLLLKLSLVLIVIFALTGSFWWTISISTTSRGHIYHGYRRLQQQLVSDLWHIG  138

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLGSS+L+DL++CP E EN+VPCFNVSE+L LG 
Sbjct  139  ELSLGSSRLRDLDFCPQEFENHVPCFNVSENLALGL  174



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 127/159 (80%), Gaps = 2/159 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  615
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L   + SP+K    E+G+ S+PFS 
Sbjct  21   LWDSQMKDKTEKEDMDSNRSS-DQSYLALKFPFRVLFPYNNSPSKYVNGESGFASDPFSV  79

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G+ RS+ K TLLLLKLSL  IVVLALTGSFWWTISI++ SRG+I H YRRLQEQ+V D+ 
Sbjct  80   GSPRSRHKLTLLLLKLSLAVIVVLALTGSFWWTISISTLSRGQILHTYRRLQEQLVSDMW  139

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LSLGSS+L++LE+C  E+E YVPCFNVSE+L LG+
Sbjct  140  DIGELSLGSSRLQELEFCSQESEIYVPCFNVSENLALGY  178



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score =   140 bits (354),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQMKDKIEKED + S+S  D + L+++     L  + S +KNG+SENG  S+P+S  
Sbjct  21   LWDSQMKDKIEKEDLNRSRSM-DNTSLALRSPFGFLFNNHSSSKNGISENGVTSDPYSGS  79

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ +F LL LK+SLV IVV+ALTGSF WTI+I+SSSRG IYH YRRLQEQ+V DL D
Sbjct  80   NSRSRQRFMLLFLKISLVGIVVVALTGSFLWTIAISSSSRGHIYHNYRRLQEQLVSDLLD  139

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +SLG ++ K++E+C  ++ENYVPCFNVSE+L LG+
Sbjct  140  IGEISLGPNRWKEMEFCSEDSENYVPCFNVSENLALGY  177



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS++K  LL L+ SLV IV+LAL GSFWWTISI+++SRG IYHGYRRLQE++V DL D
Sbjct  79   TPRSRLKLVLLFLRFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQEKLVSDLLD  138

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +S   S+LK+LE+C  E ENYVPCFNVS++L LGF
Sbjct  139  IGEISYAPSRLKELEFCSEEFENYVPCFNVSDNLALGF  176



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS++K  LL L+ SLV IV+LAL GSFWWTISI+++SRG IYHGYRRLQE++V DL D
Sbjct  79   TPRSRLKLVLLFLRFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQEKLVSDLLD  138

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +S   S+LK+LE+C  E ENYVPCFNVS++L LGF
Sbjct  139  IGEISYAPSRLKELEFCSEEFENYVPCFNVSDNLALGF  176



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  445  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  615
            DSQMK +    EKED D ++S+ D + LS++FL+ +   D S  K+G+++NG+ S+PF+ 
Sbjct  25   DSQMKSRSPRTEKEDVDRNRSSPDHTSLSLRFLVNLFFPDNSSFKSGLTDNGFGSDPFNM  84

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G+ RS+   TLL L++SLV IV+LAL+GS WWTISI++SSRG I+ GYRRLQEQ++ DL 
Sbjct  85   GSSRSRQNLTLLFLRISLVLIVILALSGSLWWTISISTSSRGYIFRGYRRLQEQLISDLS  144

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LSLG+++L +L+YC  E+EN+VPCFN+S++LELG+
Sbjct  145  DIGELSLGAARLTELDYCSEESENHVPCFNISQNLELGY  183



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   135 bits (340),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMK K EKED + ++S+ D + LS KF   +   D S +K+G+SENG+ S+ FS G+ 
Sbjct  23   DSQMKVKTEKEDSEKNRSS-DHTCLSFKFP-SVPFPDNSSSKHGISENGFASDTFSAGSP  80

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYH--GYRRLQEQVVLDLKD  798
            RS+ K T+L+LKLSLV IVVLALTGSF WTISIT+SSRG+I+H  GYRRL EQ+V DL D
Sbjct  81   RSRHKLTMLVLKLSLVLIVVLALTGSFLWTISITTSSRGQIFHSHGYRRLYEQLVSDLWD  140

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG LSLG ++LK++E+CP E EN+VPCFNVSESL LG+
Sbjct  141  IGELSLGPARLKEVEFCPLEYENHVPCFNVSESLALGY  178



>gb|KJB59916.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=432

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  615
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL 
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLW  133

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  134  DIGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  172



>gb|KJB59917.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=592

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  615
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL 
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLW  133

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  134  DIGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  172



>gb|KJB59918.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=690

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  615
            L DSQ+K++ EKE+FD +QS+    F S       L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQSSHRFPFWS-------LFSDNSPLTKYDATDNGFASDPFTV  73

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL 
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLW  133

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            DIG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  134  DIGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  172



>ref|XP_011100984.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100985.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100986.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=693

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 118/159 (74%), Gaps = 4/159 (3%)
 Frame = +1

Query  436  FLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  615
            F +D QMK++IEK+  + + S    ++LS K+  R L T+   + + + ++G++S+PF P
Sbjct  23   FSEDCQMKERIEKDRTNGAVS----TYLSSKYPFRFLFTNNLSSNHSLGDHGFISDPFGP  78

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLK  795
             A RS  K TL LLK SL  IV+LAL GSFWWT+S+TS SRG+I HGYRRLQEQ+V DL 
Sbjct  79   RAPRSLHKVTLCLLKFSLAVIVILALIGSFWWTLSVTSMSRGQIVHGYRRLQEQLVSDLY  138

Query  796  DIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IG LS+GSS+L++LEYC  E+ENYVPCFNVS +L LGF
Sbjct  139  EIGELSIGSSRLRELEYCSEESENYVPCFNVSGNLALGF  177



>ref|XP_007136263.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 ref|XP_007136264.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 gb|ESW08257.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 gb|ESW08258.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
Length=285

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQ KDK EKE FD   S+   S L       +L +D S +K G++ENG LS+P+  G  
Sbjct  22   DSQSKDKTEKEGFDKRFSSPHPSPLR-----SLLLSDNSNSKLGITENGLLSDPYIIGTP  76

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            R++ K  L  LK SLV +V+LAL GSFWWTISI+++SRG IYHGYRRL EQ+VLDL DIG
Sbjct  77   RNRHKLILFFLKFSLVFVVILALAGSFWWTISISTASRGHIYHGYRRLHEQLVLDLLDIG  136

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +S   S+LK+LE+C  E ENYVPCFNVS++L LGF
Sbjct  137  EISYAPSRLKELEFCYKEFENYVPCFNVSDNLALGF  172



>gb|KHN19772.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ KDK EKE  D   S G  S L   F  R+L +D S  K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--RLLFSDNSNPKYGIGENGFSSDPFIIG  78

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ K  LL LK SLV IV+LAL GSFWWTISI+++SRG IYHGYRRLQE +V DL D
Sbjct  79   TPRSRHKLVLLFLKFSLVLIVILALAGSFWWTISISTASRGHIYHGYRRLQENLVSDLLD  138

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +S   S+LK+LE+C  E ENYVPCFNVS++L LGF
Sbjct  139  IGEISYAPSRLKELEFCSEEFENYVPCFNVSDNLALGF  176



>ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
1 [Glycine max]
Length=690

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ KDK EKE  D   S G  S L   F  ++L +D S +K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--KLLFSDNSNSKYGIGENGFSSDPFIIG  78

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ K  LL LK SLV IV+LAL GSFWWTISI+++SRG IYHGYRRLQE +V DL D
Sbjct  79   TPRSRHKLVLLFLKFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQENLVSDLLD  138

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG +S   S+LK+LE+C  E ENYVPCFNVS++L LGF
Sbjct  139  IGEISYAPSRLKELEFCSEEFENYVPCFNVSDNLALGF  176



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K+G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKHGGTENGFASDSFLVGNS  82

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ +F L +L+LSLV I++LALTGSFWWT+SI+ SS+ +I+HGYRRLQEQ+V DL DIG
Sbjct  83   RSRQQFILQMLRLSLVLIIILALTGSFWWTLSISGSSQVQIFHGYRRLQEQLVSDLWDIG  142

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
             +SLG S+LK+LE+C PE ENYVPCFN S S E
Sbjct  143  EISLGPSRLKELEFCSPEFENYVPCFNSSLSQE  175



>ref|XP_010098612.1| putative pectin methyltransferase QUA2 [Morus notabilis]
 gb|EXB75351.1| putative pectin methyltransferase QUA2 [Morus notabilis]
Length=696

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSPGA  621
            DSQM D+ EKED D   S+ DQ   SM+  LR++  D  SP+K G SENG+ S+      
Sbjct  23   DSQMIDRTEKEDLDRRGSS-DQGSFSMRMPLRVVFPDNNSPSKYGNSENGFSSDSLISNT  81

Query  622  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDI  801
             R++ K TLLLLKLSL  ++V+AL GSFWWTISI++SSRG I  GYRRLQEQ+V DL DI
Sbjct  82   PRNRHKLTLLLLKLSLALVIVIALFGSFWWTISISTSSRGHISLGYRRLQEQLVSDLWDI  141

Query  802  GHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            G LSLGSS+ KD+E+CP E ENYVPCFNVSE+LE G 
Sbjct  142  GELSLGSSRSKDMEFCPQEFENYVPCFNVSENLESGL  178



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score =   126 bits (317),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKYGGTENGFASDSFLVGNS  82

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ +F L +L+ SLV I++LALTGSFWWT+SI+ SS+ +I+HGYRRLQEQ+V DL DIG
Sbjct  83   RSRQQFILQMLRFSLVLIIILALTGSFWWTLSISGSSQVQIFHGYRRLQEQLVSDLWDIG  142

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
             +SLG S+LK+LE+C PE ENYVPCFN S S E
Sbjct  143  EISLGPSRLKELEFCLPEFENYVPCFNSSLSQE  175



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            R++ KF LL+L++SLV IV+LALTGSFWWTISI++SSRG I+H YRRLQEQ+V DL  I 
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSFWWTISISTSSRGHIFHSYRRLQEQLVSDLTAIS  147

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             LSLG +KL++L++C  E EN+VPC+N+SES  LG+
Sbjct  148  ELSLGPAKLRELDFCSKEYENFVPCYNISESSALGY  183



>gb|KEH34953.1| pectin methyltransferase QUA2, putative [Medicago truncatula]
Length=693

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSPGA  621
            DSQ KDK EK+  D   S+ DQS L +    R+L  D S  +K GV+ENG+  +PF  G 
Sbjct  23   DSQSKDKTEKDGLDRRGSS-DQSPLHLSSPFRLLFADNSSHSKFGVTENGFSPDPFILGT  81

Query  622  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDI  801
             RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG+IYHGYRRLQE++V DL DI
Sbjct  82   PRSRHKLILLFMKFSIVLIVILALAGSFWWTVSISTTSRGQIYHGYRRLQEKLVSDLLDI  141

Query  802  GHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            G +S   S+LK+LE+C  E ENYVPCFNVS++L  G+
Sbjct  142  GEISYAPSRLKELEFCSQEFENYVPCFNVSDNLAQGY  178



>ref|XP_006390005.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
 gb|ESQ27291.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
Length=684

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK EKED    +S      L+++F    L +++S +K+G  ENG+ ++P+S    RS
Sbjct  25   QMKDKTEKEDLARGRSTDS---LTLRFPFAFLFSNQSSSKHG--ENGFPADPYS---ARS  76

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  LL LK+SLV IVV+AL GSFWWT+SI++SSRG +YH YRRLQEQ+V DL DIG +
Sbjct  77   RHRLMLLFLKISLVLIVVIALAGSFWWTVSISTSSRGHVYHNYRRLQEQLVSDLLDIGEI  136

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            S+G S+ K+LEYC  E+ENYVPCFNVSE+L LG+
Sbjct  137  SIGPSRWKELEYCTLESENYVPCFNVSENLALGY  170



>ref|XP_004500638.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Cicer arietinum]
Length=659

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG I+HGYRRLQE++V DL DIG
Sbjct  80   RSRHKLILLFMKFSIVFIVILALAGSFWWTVSISTTSRGHIFHGYRRLQEKLVSDLLDIG  139

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +S   SKLK+L++C  E ENYVPCFNVS++L  G+
Sbjct  140  EISDAPSKLKELDFCSQEFENYVPCFNVSDNLAQGY  175



>gb|KJB64256.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64257.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64262.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64263.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=669

 Score =   120 bits (301),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 114/163 (70%), Gaps = 30/163 (18%)
 Frame = +1

Query  424  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  603
            NS  F D S++KDK EKED D ++ A DQS+LS+                          
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSL--------------------------  50

Query  604  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVV  783
              S G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRLQEQ+V
Sbjct  51   --SVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQLV  108

Query  784  LDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            LDL DIG LSLG+S++K++++CP E+EN++PCFN+SE+L LG+
Sbjct  109  LDLWDIGELSLGASRMKEIDFCPEESENHIPCFNISENLALGY  151



>ref|XP_004500637.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Cicer arietinum]
Length=689

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG I+HGYRRLQE++V DL DIG
Sbjct  80   RSRHKLILLFMKFSIVFIVILALAGSFWWTVSISTTSRGHIFHGYRRLQEKLVSDLLDIG  139

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +S   SKLK+L++C  E ENYVPCFNVS++L  G+
Sbjct  140  EISDAPSKLKELDFCSQEFENYVPCFNVSDNLAQGY  175



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  612
            L DSQ KDK EKED D   S+ D S L+++F L +L  + S +K  NG+ ENG+ S+ F 
Sbjct  22   LWDSQSKDKTEKEDLDKRGSS-DHSPLALRFPLGLLLGNNSDSKYGNGIGENGFASDSFI  80

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDL  792
              + RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRLQE++V DL
Sbjct  81   VSSPRSRLKLMLLSLKFSLVVIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKLVSDL  140

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLEL  906
             DIG  S G  +LK+ E+C  + EN+VPC+NVS ++EL
Sbjct  141  LDIGEFSRGPLRLKESEFCSQDLENFVPCYNVSGNVEL  178



>gb|KHN44795.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=670

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  612
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDL  792
             G  RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG+IYHGYRRLQE++V D+
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGQIYHGYRRLQEKLVSDI  141

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             DI   S G  +LK+ E+C  E EN+VPC+N+SE +ELG
Sbjct  142  LDISEFSRGPLRLKESEFCSEEFENFVPCYNISEDVELG  180



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  612
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDL  792
             G  RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG+IYHGYRRLQE++V D+
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGQIYHGYRRLQEKLVSDI  141

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             DI   S G  +LK+ E+C  E EN+VPC+N+SE +ELG
Sbjct  142  LDISEFSHGPLRLKESEFCSEEFENFVPCYNISEDVELG  180



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 109/158 (69%), Gaps = 1/158 (1%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQMKDK EKED     S+ DQS+  +KF  ++L    SP+K    ENG+ S+P S G
Sbjct  21   LWDSQMKDKSEKEDLSRRDSS-DQSYPPLKFASQLLHPSNSPSKFTNLENGFASDPCSAG  79

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
            + R +    +L L+ SL  IV+LA+TGS WWTISI++SSRG I   Y+ L  +V+ DL D
Sbjct  80   SPRKRHHLIMLALRSSLFLIVILAVTGSLWWTISISTSSRGHINQHYKDLHARVLSDLWD  139

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG LSLG +KL++LE CP E ENYVPC+NVSE++ LG+
Sbjct  140  IGELSLGPTKLRELEACPDEFENYVPCYNVSENVALGY  177



>ref|XP_004490695.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
 ref|XP_004505832.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
Length=683

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 9/154 (6%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQ KDK EK+DFD  +   D + L+++  LR   +DK        E+ ++S+PF  G  
Sbjct  24   DSQSKDKTEKDDFD-KRGVSDHTPLALRSPLRFFFSDK--------ESNFVSDPFIVGTP  74

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  LL LK SLV IVVLAL GSF+WT+++++SSR ++YHGYRRLQE++V DL DIG
Sbjct  75   RSRFKLMLLSLKFSLVFIVVLALVGSFYWTLTLSTSSRVRVYHGYRRLQEKLVSDLLDIG  134

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLEL  906
              SLG+ K K+LE C PE EN+VPCFNVS++L+L
Sbjct  135  EFSLGAPKGKELESCSPELENFVPCFNVSDNLDL  168



>ref|XP_006300626.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
 gb|EOA33524.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
Length=687

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 114/154 (74%), Gaps = 6/154 (4%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK +KED    +S   +S L+++F    L ++ S +K+G  ENG+ ++P+S    RS
Sbjct  25   QMKDKTDKEDLARGRST--ESHLTLRFPFAFLFSNHSSSKHG-GENGFPADPYS---ARS  78

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  L+ LK+SLV IVV+AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DI  +
Sbjct  79   RHRLMLMFLKISLVLIVVVALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLLDIEEI  138

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            SLG ++ K+LEYC  E+EN+VPCFNVSE+L LG+
Sbjct  139  SLGPNRWKELEYCNIESENFVPCFNVSENLALGY  172



>ref|XP_010269315.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Nelumbo nucifera]
Length=704

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +1

Query  367  MARPlhrglsvggggrhsgNSQSFLDDSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLL  537
            M+RPLHR    GGG     N  S+  DSQMK K    EK+D D ++S  D + LS++FL+
Sbjct  5    MSRPLHRNSISGGGRFAESNRDSW--DSQMKSKSPRTEKDDVDRNRSTSDHNSLSLRFLV  62

Query  538  RILSTDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwti  717
             ++  + S +K+ +S++G+ S+PF+  + RS+    LL L+ SLV IV+LAL GS WWTI
Sbjct  63   NLIFPENSSSKSVLSDSGFGSDPFNMSSSRSRHNLILLFLRFSLVLIVILALFGSLWWTI  122

Query  718  sitsssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            SI++SSRG I+ GYR+LQEQ++ DL DIG LSLG+++LK+++YC  E+EN+VPCFN+S++
Sbjct  123  SISTSSRGYIFKGYRKLQEQLISDLSDIGDLSLGAARLKEMDYCSEESENHVPCFNISQN  182

Query  898  LELGF  912
            LELG+
Sbjct  183  LELGY  187



>ref|XP_003615127.1| hypothetical protein MTR_5g064080 [Medicago truncatula]
 gb|AES98085.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=675

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 110/154 (71%), Gaps = 10/154 (6%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQ KDK EK+DFD   S+ D + L+++  L++ S DK        ENG+ S+P S G+ 
Sbjct  25   DSQSKDKSEKDDFDRRGSS-DHTPLALRSPLKLFS-DK--------ENGFASDPISVGSP  74

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+ K  + L+K SLV IVV AL GSF WT++++SSSRG++YHGYRRLQE++V DL DIG
Sbjct  75   RSRFKLMMFLVKFSLVFIVVFALVGSFLWTLNLSSSSRGRVYHGYRRLQEKLVSDLLDIG  134

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLEL  906
             +S G+S+ K+LE C PE EN+VPCFNVS+  E 
Sbjct  135  EISRGASRWKELESCSPELENFVPCFNVSDGNEF  168



>ref|XP_010269316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269318.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
Length=700

 Score =   116 bits (290),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 135/185 (73%), Gaps = 5/185 (3%)
 Frame = +1

Query  367  MARPlhrglsvggggrhsgNSQSFLDDSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLL  537
            M+RPLHR    GGG     N  S+  DSQMK K    EK+D D ++S  D + LS++FL+
Sbjct  1    MSRPLHRNSISGGGRFAESNRDSW--DSQMKSKSPRTEKDDVDRNRSTSDHNSLSLRFLV  58

Query  538  RILSTDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwti  717
             ++  + S +K+ +S++G+ S+PF+  + RS+    LL L+ SLV IV+LAL GS WWTI
Sbjct  59   NLIFPENSSSKSVLSDSGFGSDPFNMSSSRSRHNLILLFLRFSLVLIVILALFGSLWWTI  118

Query  718  sitsssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            SI++SSRG I+ GYR+LQEQ++ DL DIG LSLG+++LK+++YC  E+EN+VPCFN+S++
Sbjct  119  SISTSSRGYIFKGYRKLQEQLISDLSDIGDLSLGAARLKEMDYCSEESENHVPCFNISQN  178

Query  898  LELGF  912
            LELG+
Sbjct  179  LELGY  183



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  612
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDRRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDL  792
             G  RS +K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRLQE++V DL
Sbjct  81   VGTPRSLLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKLVSDL  140

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             DIG  S G  +LK+ E+C  E EN+VPC+NVSE++ELG
Sbjct  141  LDIGEFSRGPLRLKESEFCSEEFENFVPCYNVSENVELG  179



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  612
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDKRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDL  792
             G  RS +K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRLQE++V DL
Sbjct  81   VGTPRSLLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKLVSDL  140

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             DIG  S G  +LK+ E+C  E EN+VPC+NVSE++ELG
Sbjct  141  LDIGEFSRGPLRLKESEFCSEEFENFVPCYNVSENVELG  179



>emb|CDX79252.1| BnaC06g20510D [Brassica napus]
Length=684

 Score =   112 bits (280),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 16/161 (10%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTD--KSPTKNGVSENGYLSNPFS  612
            L DSQMKDK    D    +S  D S L+++F    L T+  +SP+K G  +NG  S+P  
Sbjct  23   LRDSQMKDK---TDLIRGRSTTDSSSLTLRFPFAFLFTNNTQSPSKTG--DNG--SDP--  73

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRG-KIYHGYRRLQEQVVLD  789
                RS+ +  LL LK+SLV IVVLAL GSFWWT+SI++S RG  +YH YRRLQEQ+V D
Sbjct  74   ----RSRHRLVLLFLKISLVLIVVLALAGSFWWTLSISASPRGGHVYHNYRRLQEQLVSD  129

Query  790  LKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            L DIG +S+G S+ K+LEYC  EAENYVPCFNVSESLE+G+
Sbjct  130  LLDIGEISIGPSRWKELEYCDVEAENYVPCFNVSESLEMGY  170



>emb|CDX68025.1| BnaA07g20650D [Brassica napus]
Length=683

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 15/160 (9%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  615
            L DSQMKDK    D    +S  D S L+++F    L + ++ P+K G  +NG  S+P   
Sbjct  23   LRDSQMKDK---TDLIRGRSTTDSSSLTLRFPFAFLFNNNQPPSKTG--DNG--SDP---  72

Query  616  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRG-KIYHGYRRLQEQVVLDL  792
               RS+ +  LL LK+SLV IVVLAL GSFWWT+SI++S RG  +YH YRRLQEQ+V DL
Sbjct  73   ---RSRHRLVLLFLKISLVLIVVLALAGSFWWTLSISASPRGGHVYHNYRRLQEQLVSDL  129

Query  793  KDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             DIG +S+G S+ K+LEYC  EAENYVPCFNVSESLE+G+
Sbjct  130  LDIGEISIGPSRWKELEYCDTEAENYVPCFNVSESLEMGY  169



>ref|XP_002889181.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65440.1| hypothetical protein ARALYDRAFT_895718 [Arabidopsis lyrata subsp. 
lyrata]
Length=683

 Score =   109 bits (273),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 11/155 (7%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVS-ENGYLSNPFSPGAGR  627
            QMKDK E+            + L+++F    L T++S +K+G   ENG+ ++P+S    R
Sbjct  25   QMKDKTER-------PRSSDNHLTLRFPFGFLFTNQSSSKHGGGGENGFSADPYS---AR  74

Query  628  SQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGH  807
            S+ +  L+ LK+SLV IVV+AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DIG 
Sbjct  75   SRHRLMLMFLKISLVLIVVIALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLWDIGE  134

Query  808  LSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +SLG ++ K+LEYC  E+EN+VPCFNVSE+L LG+
Sbjct  135  ISLGPNRWKELEYCNIESENFVPCFNVSENLALGY  169



>gb|AAF71804.1|AC013430_13 F3F9.21 [Arabidopsis thaliana]
Length=767

 Score =   109 bits (272),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 113/155 (73%), Gaps = 10/155 (6%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVS-ENGYLSNPFSPGAGR  627
            QMKDK E+        + + + L+++F    L +++S +K+G   ENG+ ++P+S    R
Sbjct  25   QMKDKTERA------RSTENNNLTLRFPFGFLFSNQSSSKHGGGGENGFSADPYS---AR  75

Query  628  SQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGH  807
            S+ +  LL LK+SLV IVV+AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DIG 
Sbjct  76   SRHRLMLLFLKISLVLIVVIALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLWDIGE  135

Query  808  LSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +SLG ++ K+LEYC  E+EN+VPCFNVSE+L LG+
Sbjct  136  ISLGPNRWKELEYCNIESENFVPCFNVSENLALGY  170



>ref|NP_177948.3| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 ref|NP_001154475.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 sp|Q9C9Q8.2|PMTT_ARATH RecName: Full=Probable pectin methyltransferase QUA2; AltName: 
Full=Protein OVERSENSITIVE TO SUGAR 1; AltName: Full=Protein 
QUASIMODO 2; AltName: Full=Protein TUMOROUS SHOOT DEVELOPMENT 
2 [Arabidopsis thaliana]
 gb|AEE36085.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
 gb|AEE36086.1| putative pectin methyltransferase TSD2 [Arabidopsis thaliana]
Length=684

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 113/155 (73%), Gaps = 10/155 (6%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVS-ENGYLSNPFSPGAGR  627
            QMKDK E+        + + + L+++F    L +++S +K+G   ENG+ ++P+S    R
Sbjct  25   QMKDKTERA------RSTENNNLTLRFPFGFLFSNQSSSKHGGGGENGFSADPYS---AR  75

Query  628  SQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGH  807
            S+ +  LL LK+SLV IVV+AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DIG 
Sbjct  76   SRHRLMLLFLKISLVLIVVIALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLWDIGE  135

Query  808  LSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +SLG ++ K+LEYC  E+EN+VPCFNVSE+L LG+
Sbjct  136  ISLGPNRWKELEYCNIESENFVPCFNVSENLALGY  170



>gb|KDO81002.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=344

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 29/156 (19%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            D +MK++ EKED +   S  DQS+L++                            S G  
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLAL----------------------------SSGTP  53

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL DIG
Sbjct  54   RSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIG  113

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  114  EISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  149



>ref|XP_006472587.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Citrus sinensis]
Length=667

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 29/156 (19%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DS+MK++ EKED +   S  DQS+L++                            S G  
Sbjct  23   DSEMKERNEKEDLEKDHST-DQSYLAL----------------------------SSGTP  53

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL DIG
Sbjct  54   RSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIG  113

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +SLGS++ KDLE+C  + ENYVPCFN S++L LG+
Sbjct  114  EISLGSTRSKDLEFCSEDFENYVPCFNESQNLALGY  149



>gb|KDO81000.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO81001.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=474

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 29/156 (19%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            D +MK++ EKED +   S  DQS+L++                            S G  
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLAL----------------------------SSGTP  53

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL DIG
Sbjct  54   RSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIG  113

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  114  EISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  149



>gb|KDO80995.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=667

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 29/156 (19%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            D +MK++ EKED +   S  DQS+L++                            S G  
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLAL----------------------------SSGTP  53

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL DIG
Sbjct  54   RSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIG  113

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  114  EISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  149



>gb|KDO80999.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=642

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 29/156 (19%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            D +MK++ EKED +   S  DQS+L++                            S G  
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLAL----------------------------SSGTP  53

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRLQEQ+V DL DIG
Sbjct  54   RSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQLVSDLWDIG  113

Query  805  HLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             +SLGSS+ KDLE+C  + ENYVPCFN S +L LG+
Sbjct  114  EISLGSSRSKDLEFCSEDFENYVPCFNESRNLALGY  149



>ref|XP_009104583.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
 ref|XP_009104584.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=684

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 16/161 (10%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMK--FLLRILSTDKSPTKNGVSENGYLSNPFS  612
            L DSQMKDK    D    +S  D + L+++  F     +  +SP+K G  +NG  S+P  
Sbjct  23   LRDSQMKDK---TDLIRGRSTTDSNSLTLRAPFAFLFSNNTQSPSKTG--DNG--SDP--  73

Query  613  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRG-KIYHGYRRLQEQVVLD  789
                RS+ +  LL LK+SLV IVVLAL GSFWWT+SI++S RG  +Y  YRRLQEQ+V D
Sbjct  74   ----RSRHRLVLLFLKISLVLIVVLALAGSFWWTLSISASPRGGHVYLNYRRLQEQLVSD  129

Query  790  LKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            L DIG +S+G S+ K+LEYC  EAENYVPCFNVSESLE+G+
Sbjct  130  LLDIGEISIGPSRWKELEYCDTEAENYVPCFNVSESLEMGY  170



>ref|XP_008779373.1| PREDICTED: probable pectin methyltransferase QUA2, partial [Phoenix 
dactylifera]
Length=374

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  583  ENGYLSNPFSPGAG-RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGY  759
            ENG+     SPG G RS+   TLLLLKL LV + +LAL GS +W +SI++SSR  IYHGY
Sbjct  36   ENGFGHEATSPGRGARSRPSLTLLLLKLGLVLVTILALLGSLYWAVSISNSSRHNIYHGY  95

Query  760  RRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            RRLQEQ+V DL DIG LSLG ++LK+LE+CPPE ENYVPC +N+SESL+LG
Sbjct  96   RRLQEQLVADLSDIGELSLGKARLKELEFCPPEYENYVPCYYNISESLDLG  146



>ref|XP_008811174.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=662

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  583  ENGYLSNPFSPGAG-RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGY  759
            ENG+     SPG G RS+   TLLLLKL LV + +LAL GS +W +SI++SSR  IYHGY
Sbjct  36   ENGFGHEATSPGRGARSRPSLTLLLLKLGLVLVTILALLGSLYWAVSISNSSRHNIYHGY  95

Query  760  RRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            RRLQEQ+V DL DIG LSLG ++LK+LE+CPPE ENYVPC +N+SESL+LG
Sbjct  96   RRLQEQLVADLSDIGELSLGKARLKELEFCPPEYENYVPCYYNISESLDLG  146



>ref|XP_010416801.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Camelina sativa]
 ref|XP_010416802.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Camelina sativa]
Length=689

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK +KED    +S  D S L+++F    L T  +    G  +N +  +P++    R+
Sbjct  25   QMKDKTDKEDLIRGRSTTD-SHLTLRFPFAFLFTSSNHKHGG--DNAFPPDPYT---ART  78

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  L+ LK+SLV IVV AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DI  +
Sbjct  79   RHRLMLMFLKISLVLIVVFALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLLDIEEI  138

Query  811  SLGSSKLKDLEYCPPE-AENYVPCFNVSESLELGF  912
            SLG ++ KDL+YC    +EN+VPCFN SE+L LG+
Sbjct  139  SLGPNRWKDLDYCNINVSENFVPCFNASENLALGY  173



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  624
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  625  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIG  804
            R++ KF LL+L++SLV IV+LALTGSFWWTISI++SSRG I+H YRRLQEQ+V DL  I 
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSFWWTISISTSSRGHIFHSYRRLQEQLVSDLTAIS  147

Query  805  HLSLGSSKLKDLEYC  849
             LSLG +KL++L++C
Sbjct  148  ELSLGPAKLRELDFC  162



>ref|XP_010472034.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=688

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 8/155 (5%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK +KED    +S  D S L+++F    L T  S  K+G  +N +  +P++    R+
Sbjct  25   QMKDKTDKEDLIRGRSTTD-SHLTLRFPFAFLFT--SNHKHG-GDNAFPPDPYT---ART  77

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  L+ LK+SLV IVV AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DI  +
Sbjct  78   RHRLMLMFLKISLVLIVVFALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLLDIEEI  137

Query  811  SLGSSKLKDLEYC-PPEAENYVPCFNVSESLELGF  912
            SLG ++ KDL+YC   ++EN+VPCFN SE+L LG+
Sbjct  138  SLGPNRWKDLDYCNIDDSENFVPCFNASENLALGY  172



>gb|KJB59914.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=712

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 40/158 (25%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ+K++ EKE+FD +QS+                                       
Sbjct  77   LLDSQVKEQTEKEEFDRNQSSH--------------------------------------  98

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL D
Sbjct  99   --RSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLWD  156

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  157  IGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  194



>gb|KJB59919.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=660

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 40/158 (25%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ+K++ EKE+FD +QS+                                       
Sbjct  25   LLDSQVKEQTEKEEFDRNQSSH--------------------------------------  46

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
              RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL D
Sbjct  47   --RSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLWD  104

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  105  IGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  142



>gb|KJB59915.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=711

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 92/158 (58%), Gaps = 41/158 (26%)
 Frame = +1

Query  439  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  618
            L DSQ+K++ EKE+FD +QS+  +  L+M  L           K+ +     L+      
Sbjct  77   LLDSQVKEQTEKEEFDRNQSSHSRHRLTMLLL-----------KSSLVVIVILA------  119

Query  619  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKD  798
                                    LTGSFWWT+SI++SSRG I+H  RRLQEQ+V DL D
Sbjct  120  ------------------------LTGSFWWTLSISTSSRGHIFHSSRRLQEQLVSDLWD  155

Query  799  IGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IG LS G+S++K++E+CP E ENY+PCFNVSE+L+ GF
Sbjct  156  IGELSFGTSRMKEIEFCPGELENYIPCFNVSENLDSGF  193



>gb|KJB59031.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=608

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  694  TGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYV  873
            TGSFWWTISI++SSRG I+ GYRRLQEQ+V DL DIG LSLG S+LK++E+C  E ENY+
Sbjct  17   TGSFWWTISISTSSRGHIFRGYRRLQEQLVSDLWDIGELSLGPSRLKEIEFCSEEFENYI  76

Query  874  PCFNVSESLELGF  912
            PCFNVSE++ LG+
Sbjct  77   PCFNVSENVALGY  89



>ref|XP_009128288.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=662

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 22/151 (15%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK EKE             L+++F    L T  S T++        ++P++    R+
Sbjct  26   QMKDKSEKE-----------GHLTLRFPFAFLFTSNSNTQS--------TDPYN---ART  63

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  LL LK+SLV IVVLAL GSFWWTISI+++SRG +YH YRRLQEQ+V DL DIG +
Sbjct  64   RHRLMLLFLKISLVLIVVLALAGSFWWTISISTTSRGHVYHNYRRLQEQLVSDLLDIGEI  123

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            S G ++ K++EYC  E+ENYVPCFNVSESL+
Sbjct  124  SAGPTRWKEMEYCSVESENYVPCFNVSESLD  154



>ref|NP_001288873.1| probable pectin methyltransferase QUA2 [Brassica rapa]
 gb|ABV89659.1| dehydration-responsive protein-related [Brassica rapa]
Length=662

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 22/151 (15%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK EKE             L+++F    L T  S T++        ++P++    R+
Sbjct  26   QMKDKSEKE-----------GHLTLRFPFAFLFTSNSNTQS--------TDPYN---ART  63

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  LL LK+SLV IVVLAL GSFWWTISI+++SRG +YH YRRLQEQ+V DL DIG +
Sbjct  64   RHRLMLLFLKISLVLIVVLALAGSFWWTISISTTSRGHVYHNYRRLQEQLVSDLLDIGEI  123

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            S G ++ K++EYC  E+ENYVPCFNVSESL+
Sbjct  124  SAGPTRWKEIEYCSVESENYVPCFNVSESLD  154



>gb|EPS65073.1| hypothetical protein M569_09706, partial [Genlisea aurea]
Length=682

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 90/150 (60%), Gaps = 15/150 (10%)
 Frame = +1

Query  463  KIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRSQIKF  642
            K + ED        D   +S KF    L T +  +K+   ENGY           S I+F
Sbjct  33   KAKMEDRSRKNGEDDDMQVSFKFPFAYLFTGRLSSKH---ENGYRHR-----VAVSFIRF  84

Query  643  TllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHLSLGS  822
            +LL++ +  +       TGSFWWT+SIT +SRGKI+ GYRRLQEQ+V DL DIG LS G 
Sbjct  85   SLLIVVVLAL-------TGSFWWTLSITKASRGKIFRGYRRLQEQLVSDLYDIGDLSAGL  137

Query  823  SKLKDLEYCPPEAENYVPCFNVSESLELGF  912
             + ++LEYC  E ENYVPCFNVSE+L LGF
Sbjct  138  VRSRELEYCSEEYENYVPCFNVSENLALGF  167



>gb|ERN14661.1| hypothetical protein AMTR_s00038p00207680 [Amborella trichopoda]
Length=727

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 97/177 (55%), Gaps = 22/177 (12%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG-------VSENGYLSN  603
            DSQMKDKIEKE FD  +          K +    S+D    K G       ++ENG+ S+
Sbjct  35   DSQMKDKIEKEGFDKPRPLPYVVSFWTKLIGFDASSDHIFLKQGPRLSSKSLAENGFGSD  94

Query  604  PF-------------SPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssR-G  741
            P              SP A R +     + L    +A++VL     F W     SSSR G
Sbjct  95   PKDLSSQIHSRIDLDSPSARRIRQGMVAMRLLQWALALIVLISVSGFLWWTISISSSRSG  154

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLG-SSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             +Y GYRRLQEQV++DL DIG LS G S+KLK+L++C  + EN+VPCFNVSE+L LG
Sbjct  155  TVYRGYRRLQEQVIVDLVDIGVLSSGVSNKLKELDFCSHDLENFVPCFNVSENLALG  211



>ref|XP_006853194.2| PREDICTED: probable pectin methyltransferase QUA2 [Amborella 
trichopoda]
Length=728

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 97/177 (55%), Gaps = 22/177 (12%)
 Frame = +1

Query  445  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG-------VSENGYLSN  603
            DSQMKDKIEKE FD  +          K +    S+D    K G       ++ENG+ S+
Sbjct  36   DSQMKDKIEKEGFDKPRPLPYVVSFWTKLIGFDASSDHIFLKQGPRLSSKSLAENGFGSD  95

Query  604  PF-------------SPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssR-G  741
            P              SP A R +     + L    +A++VL     F W     SSSR G
Sbjct  96   PKDLSSQIHSRIDLDSPSARRIRQGMVAMRLLQWALALIVLISVSGFLWWTISISSSRSG  155

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLG-SSKLKDLEYCPPEAENYVPCFNVSESLELG  909
             +Y GYRRLQEQV++DL DIG LS G S+KLK+L++C  + EN+VPCFNVSE+L LG
Sbjct  156  TVYRGYRRLQEQVIVDLVDIGVLSSGVSNKLKELDFCSHDLENFVPCFNVSENLALG  212



>emb|CDY14622.1| BnaC02g24910D [Brassica napus]
Length=662

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 22/151 (15%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK EKE             L+++F    L T  S T++        ++P+S    R+
Sbjct  26   QMKDKSEKE-----------GHLTLRFPFAFLFTSNSNTQS--------TDPYS---ART  63

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  LL LK+SLV IVVLAL GSFWWTISI+++SRG +YH YRRLQEQ+V DL DIG +
Sbjct  64   RHRLMLLFLKISLVLIVVLALAGSFWWTISISTTSRGHVYHNYRRLQEQLVSDLLDIGEI  123

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            S G ++ K+LEYC  ++ENYVPCFNVS+SL+
Sbjct  124  SAGPTRWKELEYCSVDSENYVPCFNVSKSLD  154



>ref|XP_010428946.1| PREDICTED: probable pectin methyltransferase QUA2 [Camelina sativa]
Length=692

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSA-GDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGR  627
            QMKDK +K+D    +S   D   L+++F    L T       G  +N + +    P   R
Sbjct  25   QMKDKTDKDDLIRGRSTTADSPHLTLRFPFAFLFTSNHNKHGG--DNAFPAA--DPYTAR  80

Query  628  SQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGH  807
            ++ +  L+ LK+SLV IVV AL GSFWWTISI++SSRG +YH YRRLQEQ+V DL DI  
Sbjct  81   TRHRLMLMFLKISLVLIVVFALAGSFWWTISISTSSRGHVYHNYRRLQEQLVSDLLDIEE  140

Query  808  LSLGSSKLKDLEYC-PPEAENYVPCFNVSESLELGF  912
            +SLG ++ KDL+YC   ++EN+VPCFN SE+L LG+
Sbjct  141  ISLGPNRWKDLDYCNIDDSENFVPCFNASENLALGY  176



>emb|CDY26858.1| BnaA02g18830D [Brassica napus]
Length=684

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 101/151 (67%), Gaps = 22/151 (15%)
 Frame = +1

Query  451  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  630
            QMKDK EKE             L+++F    L T  S T++        ++P++    R+
Sbjct  48   QMKDKSEKE-----------GHLTLRFPFAFLFTSNSNTQS--------TDPYN---SRT  85

Query  631  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLQEQVVLDLKDIGHL  810
            + +  LL LK+SLV IVVLAL GSFWWTISI+++SRG +YH YRRLQEQ+V DL DIG +
Sbjct  86   RHRLMLLFLKISLVLIVVLALAGSFWWTISISTTSRGHVYHNYRRLQEQLVSDLLDIGEI  145

Query  811  SLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            S G ++ K+LEYC  ++ENYVPCFNVSESL+
Sbjct  146  SAGPTRWKELEYCSVDSENYVPCFNVSESLD  176



>ref|XP_008790887.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
 ref|XP_008790888.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Phoenix dactylifera]
Length=659

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            IY+GYRRLQEQ+V DL DIG LSLG ++LK+LE+CPPE ENYVPC +N+SESL+LG
Sbjct  88   IYNGYRRLQEQLVADLSDIGELSLGKARLKELEFCPPEYENYVPCYYNISESLDLG  143



>ref|XP_010937423.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
 ref|XP_010937424.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +1

Query  583  ENGYLSNPFSPGAG-RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGY  759
            ENG+     SPG G RS+   T LLLKL LV + +LAL GS +W +SI++SSR  + HGY
Sbjct  36   ENGFGHEATSPGRGARSRPSLTFLLLKLGLVFVTILALLGSLYWAVSISNSSRHNVSHGY  95

Query  760  RRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            RRLQEQ+V DL DIG LSLG ++LK+LE+C PE ENYVPC +NVSE L+LG
Sbjct  96   RRLQEQLVADLSDIGELSLGKARLKELEFCSPEYENYVPCYYNVSEGLDLG  146



>ref|XP_009380861.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +1

Query  553  DKSPTKNGVSENGYLSNPFSP-GAGRSQIKFTllllklslvaivvlalTGSFwwtisits  729
            D S     + ENG+     SP G  RS+       LKL LV  +VL+L+ S +W ISI+ 
Sbjct  25   DVSYQAKDLGENGFGHELMSPAGTNRSRQSLIFTFLKLGLVVFIVLSLSSSLYWAISISI  84

Query  730  ssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCF-NVSESLEL  906
            SSRG I+HGYRRLQEQVV DL +IG LSLG ++LK+LE+CPPE ENY PC+ NVSE  +L
Sbjct  85   SSRGNIHHGYRRLQEQVVADLTEIGELSLGIARLKELEFCPPEYENYAPCYNNVSEDFDL  144



>ref|XP_010939668.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=662

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  583  ENGYLSNPFSPG-AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGY  759
            ENG+     SPG   RS+   TLLLLKL+L+ + ++AL+GS +W ISI++SSR  IY+GY
Sbjct  36   ENGFGHEATSPGRVARSRPSLTLLLLKLALLIVTIIALSGSLYWAISISTSSRHNIYNGY  95

Query  760  RRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            RRLQEQ+V DL DIG LSLG ++ K+LE+CP E ENYVPC +N+SESL+LG
Sbjct  96   RRLQEQLVADLSDIGALSLGKTRSKELEFCPLEYENYVPCYYNISESLDLG  146



>ref|XP_009387117.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +1

Query  580  SENGYLSNPFSP-GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHG  756
            +ENG+     SP G  RS+      LLKL LVAI VLAL GS +W ISI++S+RG +YHG
Sbjct  34   AENGHDHEAGSPAGTNRSRQSLIFALLKLGLVAITVLALFGSLYWAISISTSARGNVYHG  93

Query  757  YRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            YR+LQEQVV DL +IG LSLG ++  +LE+CPPE EN+VPC +NVSES +L
Sbjct  94   YRQLQEQVVADLAEIGELSLGIARPNELEFCPPEYENFVPCYYNVSESFDL  144



>ref|XP_009409275.1| PREDICTED: probable pectin methyltransferase QUA2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 82/125 (66%), Gaps = 6/125 (5%)
 Frame = +1

Query  547  STDKSPTKNGVSENGY---LSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwti  717
            S D S     + ENG+   L NP      R  + FT+L L L +  ++ L  +GS +W I
Sbjct  23   SFDVSYQTKELGENGFGYELMNPAGINRARQNLIFTILKLGLVVFIVLAL--SGSLYWAI  80

Query  718  sitsssRGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCF-NVSE  894
            SI++SS   IYHG+RRLQEQVV DL +IG LSLG S+LK+LE+CPPE ENY PC+ NVSE
Sbjct  81   SISTSSPSSIYHGFRRLQEQVVSDLTEIGELSLGISRLKELEFCPPEYENYAPCYNNVSE  140

Query  895  SLELG  909
            + +L 
Sbjct  141  NFDLA  145



>emb|CDX87461.1| BnaA07g34120D [Brassica napus]
Length=658

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = +1

Query  739  GKIY---HGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            G +Y   H YRRLQEQ+V DL DIG +S+G ++ K+LEYC  ++E+YVPCFNVSESL+
Sbjct  96   GHVYQRSHSYRRLQEQLVSDLLDIGDISVGPTRWKELEYCDVDSESYVPCFNVSESLD  153



>ref|XP_009106531.1| PREDICTED: probable pectin methyltransferase QUA2 [Brassica rapa]
Length=658

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = +1

Query  739  GKIY---HGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLE  903
            G +Y   H YRRLQEQ+V DL DIG +S+G ++ K+LEYC  ++E+YVPCFNVSESL+
Sbjct  96   GHVYQRSHSYRRLQEQLVSDLLDIGDISVGPTRWKELEYCDVDSESYVPCFNVSESLD  153



>emb|CDX88430.1| BnaC06g38740D [Brassica napus]
Length=667

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  739  GKIY---HGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELG  909
            G +Y   H YRRLQEQ V DL DIG +S+G ++ K+LEYC  ++E+YVPCFNVSE++  G
Sbjct  92   GHVYQRSHSYRRLQEQFVSDLLDIGDISVGPTRWKELEYCSIDSESYVPCFNVSENIAFG  151

Query  910  F  912
            +
Sbjct  152  Y  152



>ref|XP_010916838.1| PREDICTED: probable pectin methyltransferase QUA2 [Elaeis guineensis]
Length=657

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            IY GYRRLQ+Q+V DL +IG LSL S+KL++LE+C  E E+YVPC +NVSES + G
Sbjct  85   IYRGYRRLQQQLVSDLSEIGELSLASAKLRELEFCSSEFEDYVPCYYNVSESFDAG  140



>ref|XP_008781887.1| PREDICTED: probable pectin methyltransferase QUA2 [Phoenix dactylifera]
Length=658

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            +IY GYRRLQEQ+V DL +IG LSL S+K+++LE+C  E E+YVPC +NVS+S + G
Sbjct  85   RIYRGYRRLQEQLVSDLSEIGELSLASAKMRELEFCSSEYEDYVPCYYNVSDSSDAG  141



>ref|XP_010926317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Elaeis guineensis]
Length=656

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCF-NVSESLELG  909
            I+ GYRRLQE +V DL +IG LSLGS+KL++L++C  E E+YVPC+ NVSESL+ G
Sbjct  85   IFRGYRRLQELLVSDLSEIGELSLGSTKLRELKFCSSEYEDYVPCYNNVSESLDSG  140



>ref|XP_010926316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Elaeis guineensis]
Length=659

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCF-NVSESLELG  909
            I+ GYRRLQE +V DL +IG LSLGS+KL++L++C  E E+YVPC+ NVSESL+ G
Sbjct  85   IFRGYRRLQELLVSDLSEIGELSLGSTKLRELKFCSSEYEDYVPCYNNVSESLDSG  140



>ref|XP_002452533.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
 gb|EES05509.1| hypothetical protein SORBIDRAFT_04g027500 [Sorghum bicolor]
Length=656

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +1

Query  757  YRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            YRRLQEQ+V DL DIG L+ G  + K+ E CPPE ENYVPC +NV++++++
Sbjct  93   YRRLQEQLVTDLLDIGELAGGGVRAKEAEVCPPEYENYVPCYYNVTDAVDV  143



>ref|XP_010680526.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680527.1| PREDICTED: probable pectin methyltransferase QUA2 [Beta vulgaris 
subsp. vulgaris]
Length=679

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  751  HGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESL  900
            + +  LQEQ++ D  DI  LSLGSS+L+++E+C  E ENYVPCFN+SE+L
Sbjct  114  YWWLSLQEQLISDFTDIQELSLGSSRLREVEFCSQEYENYVPCFNISENL  163



>ref|XP_007045901.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
 gb|EOY01733.1| Quasimodo2 like 2 isoform 6 [Theobroma cacao]
Length=619

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D  ++  LSLG+S+ ++L+ C  E ENYVPC+NV+ +L +GF
Sbjct  54   EIYTNYRRLKEQAAVDYFELRTLSLGASRQRELDLCAKERENYVPCYNVTANLLVGF  110



>ref|XP_007045897.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045898.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045899.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045900.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045902.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 ref|XP_007045903.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01729.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01730.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01731.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01732.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01734.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
 gb|EOY01735.1| Quasimodo2 like 2 isoform 2 [Theobroma cacao]
Length=619

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D  ++  LSLG+S+ ++L+ C  E ENYVPC+NV+ +L +GF
Sbjct  54   EIYTNYRRLKEQAAVDYFELRTLSLGASRQRELDLCAKERENYVPCYNVTANLLVGF  110



>ref|XP_007045896.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
 gb|EOY01728.1| Quasimodo2 like 2 isoform 1 [Theobroma cacao]
Length=618

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D  ++  LSLG+S+ ++L+ C  E ENYVPC+NV+ +L +GF
Sbjct  54   EIYTNYRRLKEQAAVDYFELRTLSLGASRQRELDLCAKERENYVPCYNVTANLLVGF  110



>gb|EAY87574.1| hypothetical protein OsI_08986 [Oryza sativa Indica Group]
Length=660

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  754  GYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            GYRRLQEQ+V DL DIG L+ G  + ++ E C PE ENYVPC +NVS+++++ 
Sbjct  95   GYRRLQEQLVTDLLDIGELAGGGVRAREAEVCVPEYENYVPCYYNVSDTVDVA  147



>dbj|BAD17245.1| putative early-responsive to dehydration stress protein [Oryza 
sativa Japonica Group]
Length=660

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  754  GYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            GYRRLQEQ+V DL DIG L+ G  + ++ E C PE ENYVPC +NVS+++++ 
Sbjct  95   GYRRLQEQLVTDLLDIGELAGGGVRAREAEVCVPEYENYVPCYYNVSDAVDVA  147



>gb|EAZ24662.1| hypothetical protein OsJ_08431 [Oryza sativa Japonica Group]
Length=660

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  754  GYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLELG  909
            GYRRLQEQ+V DL DIG L+ G  + ++ E C PE ENYVPC +NVS+++++ 
Sbjct  95   GYRRLQEQLVTDLLDIGELAGGGVRAREAEVCVPEYENYVPCYYNVSDAVDVA  147



>gb|KDO81798.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
Length=372

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+++ K+L+ C  E EN+VPC+NVS +L  GF
Sbjct  55   IYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGF  110



>ref|XP_003570613.2| PREDICTED: probable pectin methyltransferase QUA2 [Brachypodium 
distachyon]
Length=1014

 Score = 63.5 bits (153),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            + GYRRLQEQ+V DL DIG L+ G  + ++ + C PE ENYVPC +NVS+++++
Sbjct  93   HRGYRRLQEQLVTDLLDIGELAGGGVRSREADVCAPEYENYVPCYYNVSDAVDV  146



>ref|XP_011012134.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012142.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
 ref|XP_011012150.1| PREDICTED: probable methyltransferase PMT5 [Populus euphratica]
Length=619

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y GYRRL+EQ  +D  ++  +SLG+ +  +LE C  E ENYVPC+NVS +L  GF
Sbjct  55   VYSGYRRLKEQAAVDYLELRTISLGAGRQTELELCGREKENYVPCYNVSANLFAGF  110



>emb|CAN64161.1| hypothetical protein VITISV_040644 [Vitis vinifera]
Length=320

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG S+ ++L  C  E ENYVPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAIDYLELRTLSLGVSRQRELGLCGKEXENYVPCYNVSANLLAGF  110



>ref|XP_006484179.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484180.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484181.1| PREDICTED: probable methyltransferase PMT5-like isoform X3 [Citrus 
sinensis]
Length=619

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+++ K+L+ C  E EN+VPC+NVS +L  GF
Sbjct  55   IYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGF  110



>gb|KDO81792.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
 gb|KDO81793.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
 gb|KDO81794.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
 gb|KDO81795.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
 gb|KDO81796.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
 gb|KDO81797.1| hypothetical protein CISIN_1g012595mg [Citrus sinensis]
Length=460

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+++ K+L+ C  E EN+VPC+NVS +L  GF
Sbjct  55   IYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGF  110



>ref|XP_006437954.1| hypothetical protein CICLE_v10031472mg [Citrus clementina]
 gb|ESR51194.1| hypothetical protein CICLE_v10031472mg [Citrus clementina]
Length=460

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+++ K+L+ C  E EN+VPC+NVS +L  GF
Sbjct  55   IYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGF  110



>ref|XP_008221508.1| PREDICTED: probable methyltransferase PMT5 [Prunus mume]
Length=620

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E ENYVPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCGRERENYVPCYNVSANLFAGF  110



>emb|CBI27261.3| unnamed protein product [Vitis vinifera]
Length=429

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG S+ ++L  C  E ENYVPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAIDYLELRTLSLGVSRQRELGLCGKELENYVPCYNVSANLLAGF  110



>ref|XP_007226959.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
 gb|EMJ28158.1| hypothetical protein PRUPE_ppa002650mg [Prunus persica]
Length=648

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E ENYVPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCGRERENYVPCYNVSANLFAGF  110



>ref|XP_010649494.1| PREDICTED: probable methyltransferase PMT5 [Vitis vinifera]
Length=620

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG S+ ++L  C  E ENYVPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAIDYLELRTLSLGVSRQRELGLCGKELENYVPCYNVSANLLAGF  110



>ref|XP_009802931.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=616

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ + D  ++  LSLG+++LKD+ +C  E ENYVPC+NVS +L  G 
Sbjct  53   IYTSYRKLKEQALSDYLELKSLSLGANQLKDIGFCGKERENYVPCYNVSANLLAGL  108



>ref|XP_011075591.1| PREDICTED: probable methyltransferase PMT5 [Sesamum indicum]
Length=615

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +1

Query  736  RGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            R  IY  YRRL+EQ V D  ++ +L  G+++LKD + C  E ENYVPC+NVS +L +GF
Sbjct  52   RPDIYSNYRRLKEQAVSDYLELKNL--GANRLKDFDLCGREKENYVPCYNVSANLLVGF  108



>ref|XP_008361773.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
Length=620

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E EN+VPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCSKERENHVPCYNVSANLLAGF  110



>ref|XP_008339821.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
 ref|XP_008339822.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
Length=227

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E E +VPC+NVS +L  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCSKEREXHVPCYNVSANLLAGF  110



>ref|XP_002512094.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50763.1| ATP binding protein, putative [Ricinus communis]
Length=620

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+++ K+L  C  E E+YVPC+NVS +L  GF
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSLGATRQKELGLCGREIEHYVPCYNVSANLLAGF  110



>ref|XP_008390042.1| PREDICTED: probable methyltransferase PMT5, partial [Malus domestica]
Length=426

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E EN+VPC+NVS ++  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCGKERENHVPCYNVSANVLAGF  110



>ref|XP_002316092.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEF02263.1| dehydration-responsive family protein [Populus trichocarpa]
Length=617

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YRRL+EQ  +D  ++  +SLG+ +  +LE C  E ENYVPC+NVS +L  GF
Sbjct  55   VYSSYRRLKEQAAVDYLELRTISLGAGRQTELELCGREKENYVPCYNVSANLFAGF  110



>ref|XP_008360171.1| PREDICTED: probable methyltransferase PMT5 [Malus domestica]
Length=524

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E EN+VPC+NVS ++  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCGKERENHVPCYNVSANVLAGF  110



>ref|XP_009356400.1| PREDICTED: probable methyltransferase PMT5 [Pyrus x bretschneideri]
Length=620

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG+S+ ++L  C  E EN+VPC+NVS ++  GF
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGASRQRELGLCGKERENHVPCYNVSANVLAGF  110



>gb|KDP41290.1| hypothetical protein JCGZ_15697 [Jatropha curcas]
Length=450

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LS G+S+ K+L  C  E ENYVPC+N+S +L  GF
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSSGASRQKELGLCGRERENYVPCYNLSANLLAGF  110



>gb|KJB30457.1| hypothetical protein B456_005G145000 [Gossypium raimondii]
Length=431

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            Y  YRRL+EQ  +D  ++  LS G+S+ ++L +C  E ENYVPC+NV+ +L  GF
Sbjct  56   YKNYRRLKEQAAVDYFELRTLSSGASRQRELGFCGKERENYVPCYNVTANLLFGF  110



>ref|XP_010258081.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258082.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
 ref|XP_010258083.1| PREDICTED: probable methyltransferase PMT5 [Nelumbo nucifera]
Length=621

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR+++Q   D  +I  LSLG S  ++L+ C  E ENYVPC+NVS +L  GF
Sbjct  55   IYKNYRRIKQQAASDYLEITSLSLGISHPRELDLCSKERENYVPCYNVSANLFAGF  110



>ref|XP_012067761.1| PREDICTED: probable methyltransferase PMT5 [Jatropha curcas]
Length=619

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LS G+S+ K+L  C  E ENYVPC+N+S +L  GF
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSSGASRQKELGLCGRERENYVPCYNLSANLLAGF  110



>gb|KJB30458.1| hypothetical protein B456_005G145000 [Gossypium raimondii]
Length=617

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            Y  YRRL+EQ  +D  ++  LS G+S+ ++L +C  E ENYVPC+NV+ +L  GF
Sbjct  56   YKNYRRLKEQAAVDYFELRTLSSGASRQRELGFCGKERENYVPCYNVTANLLFGF  110



>ref|XP_010906131.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906132.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
 ref|XP_010906133.1| PREDICTED: probable methyltransferase PMT5 [Elaeis guineensis]
Length=623

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ   DL +I  LS G + L +L++C  E +N VPC+NVS +L  GF
Sbjct  55   IYRNYRRLREQTTSDLLEIQALSFGITPLGELQFCGRERDNNVPCYNVSANLLAGF  110



>ref|XP_010527954.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527955.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527956.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
 ref|XP_010527957.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=619

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +  YRR++EQ  +D  D+  LS G+S+LK+   C  E ENYVPC+NVS ++  G 
Sbjct  56   HRNYRRIKEQAAVDYLDLRSLSFGASRLKEFPLCGKEKENYVPCYNVSANMLAGL  110



>gb|ERN00004.1| hypothetical protein AMTR_s00110p00151520 [Amborella trichopoda]
Length=607

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+E+ V D  +I  LS+G    K+L+ C  E+EN+VPC+NVS +L+ G 
Sbjct  37   IYTNYRKLREKAVADFSEIRSLSVGIVNPKELDLCGKESENFVPCYNVSANLQAGL  92



>ref|XP_011621117.1| PREDICTED: probable methyltransferase PMT5 [Amborella trichopoda]
Length=649

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+E+ V D  +I  LS+G    K+L+ C  E+EN+VPC+NVS +L+ G 
Sbjct  72   IYTNYRKLREKAVADFSEIRSLSVGIVNPKELDLCGKESENFVPCYNVSANLQAGL  127



>ref|XP_008807815.1| PREDICTED: probable methyltransferase PMT5 [Phoenix dactylifera]
Length=623

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   DL +I   S G + L +L++C  E +N+VPC+NVS +L  GF
Sbjct  55   IYRNYRKLREQTTSDLSEIQAFSFGITPLGELQFCGKERDNHVPCYNVSANLLAGF  110



>ref|XP_008679296.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
Length=659

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +1

Query  766  LQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            LQEQ+V DL DIG L+ G ++ K+ E CPPE E+YVPC +NV++++++
Sbjct  99   LQEQLVADLLDIGELAGGGARAKEAEVCPPEYEDYVPCYYNVTDAVDV  146



>gb|AFW64432.1| hypothetical protein ZEAMMB73_102169 [Zea mays]
Length=699

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +1

Query  766  LQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            LQEQ+V DL DIG L+ G ++ K+ E CPPE E+YVPC +NV++++++
Sbjct  99   LQEQLVADLLDIGELAGGGARAKEAEVCPPEYEDYVPCYYNVTDAVDV  146



>gb|KHG00547.1| hypothetical protein F383_17617 [Gossypium arboreum]
Length=600

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            Y  YRRL+EQ  +D  ++  LS G+S+ ++L +C  E ENYVPC+NV+ +L  GF
Sbjct  56   YKNYRRLKEQAAIDYFELRTLSSGASRQRELGFCGKERENYVPCYNVTANLLSGF  110



>ref|XP_004953963.1| PREDICTED: probable pectin methyltransferase QUA2-like [Setaria 
italica]
Length=656

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  766  LQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            LQEQ+V DL DIG ++ G  + K+ E CPPE ENYVPC +NV++++++
Sbjct  95   LQEQLVTDLLDIGEVAGGGVRAKEAEVCPPEYENYVPCYYNVTDAVDV  142



>ref|XP_008446426.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
 ref|XP_008446427.1| PREDICTED: probable methyltransferase PMT5 [Cucumis melo]
Length=649

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR +E+  +DL D+  LSL +++LK+   C  E EN+VPC+NV+ +L  G+
Sbjct  87   IYASYRRQKERAAIDLFDLKSLSLATTRLKEFGLCGKERENHVPCYNVTANLLAGY  142



>gb|KGN51971.1| hypothetical protein Csa_5G606620 [Cucumis sativus]
Length=656

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR +E+  +DL D+  LSL +++LK+   C  E EN+VPC+NV+ +L  G+
Sbjct  87   IYASYRRQKERAAIDLFDLKSLSLATTRLKEFGLCGKERENHVPCYNVTANLLAGY  142



>ref|XP_008797048.1| PREDICTED: probable methyltransferase PMT5 isoform X3 [Phoenix 
dactylifera]
Length=559

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR L+EQ   DL +I  LSLG + L +L+ C  E EN+VPC+NVS ++  GF
Sbjct  57   IYRNYRGLREQTTSDLLEIQALSLGITPLGELQLCGKERENHVPCYNVSGNMLAGF  112



>ref|XP_011655706.1| PREDICTED: probable methyltransferase PMT5 [Cucumis sativus]
Length=649

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR +E+  +DL D+  LSL +++LK+   C  E EN+VPC+NV+ +L  G+
Sbjct  87   IYASYRRQKERAAIDLFDLKSLSLATTRLKEFGLCGKERENHVPCYNVTANLLAGY  142



>dbj|BAJ94920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            + GYRRLQEQ+V DL DIG L+ G  + ++ E C  E ENYVPC +N S+++++
Sbjct  81   HRGYRRLQEQLVTDLLDIGVLAGGGLRSREAEVCAAEYENYVPCYYNGSDAVDV  134



>ref|XP_008797047.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Phoenix 
dactylifera]
Length=625

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR L+EQ   DL +I  LSLG + L +L+ C  E EN+VPC+NVS ++  GF
Sbjct  57   IYRNYRGLREQTTSDLLEIQALSLGITPLGELQLCGKERENHVPCYNVSGNMLAGF  112



>ref|XP_008797046.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Phoenix 
dactylifera]
Length=643

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR L+EQ   DL +I  LSLG + L +L+ C  E EN+VPC+NVS ++  GF
Sbjct  57   IYRNYRGLREQTTSDLLEIQALSLGITPLGELQLCGKERENHVPCYNVSGNMLAGF  112



>dbj|BAJ86389.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            + GYRRLQEQ+V DL DIG L+ G  + ++ E C  E ENYVPC +N S+++++
Sbjct  91   HRGYRRLQEQLVTDLLDIGVLAGGGLRSREAEVCAAEYENYVPCYYNGSDAVDV  144



>gb|AFW73497.1| hypothetical protein ZEAMMB73_264626 [Zea mays]
Length=562

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  766  LQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            LQEQ+V DL DIG L+ G  + K+ E CPPE +NYVPC +N+++++++
Sbjct  97   LQEQLVTDLLDIGELAGGGVRAKEAEVCPPEYDNYVPCYYNITDAVDV  144



>ref|XP_010109369.1| putative methyltransferase PMT5 [Morus notabilis]
 gb|EXC22074.1| putative methyltransferase PMT5 [Morus notabilis]
Length=579

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  L L  S+ K+++ C  E EN+VPC+NVS SL  G+
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLFLAPSRQKEIDLCGKERENHVPCYNVSASLIAGY  110



>ref|XP_010066852.1| PREDICTED: probable methyltransferase PMT5 [Eucalyptus grandis]
 gb|KCW64894.1| hypothetical protein EUGRSUZ_G02456 [Eucalyptus grandis]
Length=618

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ  +D  ++  LS G+S++K+L  C  E EN+VPC+NVS ++  G+
Sbjct  55   IYTNYRKLKEQAAVDYLELKSLSGGASRVKELGLCGKERENFVPCYNVSANMLAGY  110



>ref|XP_008646287.1| PREDICTED: probable pectin methyltransferase QUA2 [Zea mays]
 gb|AFW73498.1| hypothetical protein ZEAMMB73_264626 [Zea mays]
Length=657

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +1

Query  766  LQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPC-FNVSESLEL  906
            LQEQ+V DL DIG L+ G  + K+ E CPPE +NYVPC +N+++++++
Sbjct  97   LQEQLVTDLLDIGELAGGGVRAKEAEVCPPEYDNYVPCYYNITDAVDV  144



>ref|XP_009777410.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
sylvestris]
Length=617

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  +SLG++++KD+  C  E ENYVPC+NVS +L  G 
Sbjct  55   IYTNYRKLKEQARNDYLELKSISLGANRIKDVGLCGKERENYVPCYNVSANLLTGL  110



>ref|XP_009777411.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
sylvestris]
Length=616

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  +SLG++++KD+  C  E ENYVPC+NVS +L  G 
Sbjct  55   IYTNYRKLKEQARNDYLELKSISLGANRIKDVGLCGKERENYVPCYNVSANLLTGL  110



>ref|XP_010458849.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT4 
[Camelina sativa]
Length=606

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            +Y  Y R++EQ  +D  D+   SLG ++LK+   C  E ENYVPC+NV+ES
Sbjct  53   VYKNYGRIKEQAAIDYLDLRFFSLGVNRLKEFPLCGKERENYVPCYNVTES  103



>ref|XP_006307032.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
 gb|EOA39930.1| hypothetical protein CARUB_v10008622mg [Capsella rubella]
Length=606

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESL  900
            I+  Y R++EQ  +D  D+   SLG ++LK+   C  E ENYVPC+NVSE++
Sbjct  50   IFSNYGRIREQAAIDYLDLRFFSLGVNRLKEFPLCGKERENYVPCYNVSETI  101



>ref|XP_006573141.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Glycine 
max]
 ref|XP_006573142.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Glycine 
max]
Length=620

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ V+D  ++  ++ G S+ ++ + C  E EN+VPC+NVS +L  GF
Sbjct  55   IYTNYRRVKEQAVVDYLELRSVARGVSRQREFDLCGKERENFVPCYNVSANLLAGF  110



>gb|KHN03641.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ V+D  ++  ++ G S+ ++ + C  E EN+VPC+NVS +L  GF
Sbjct  55   IYTNYRRVKEQAVVDYLELRSVARGVSRQREFDLCGKERENFVPCYNVSANLLAGF  110



>ref|XP_009798763.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798764.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
 ref|XP_009798765.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana sylvestris]
Length=617

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  LS+G +++KD+  C  E ENYVPC+NVS +   GF
Sbjct  55   IYTNYRKLKEQARSDYLELKSLSVGENQIKDVGLCGKERENYVPCYNVSANTLAGF  110



>ref|NP_027543.2| QUASIMODO2 like 2 [Arabidopsis thaliana]
 sp|Q3EC77.2|PMT5_ARATH RecName: Full=Probable methyltransferase PMT5 [Arabidopsis thaliana]
 gb|AEC05705.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=606

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+  +C  E E+YVPC+N++ +L  G 
Sbjct  56   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPFCGKERESYVPCYNITGNLLAGL  110



>gb|KJB50580.1| hypothetical protein B456_008G177800 [Gossypium raimondii]
Length=445

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D  ++  +S G+ +  +L  C  E ENYVPC+NV+ ++ LGF
Sbjct  54   EIYSNYRRLKEQTAVDYFELRTVSSGAGRQGELGLCGKERENYVPCYNVTANVLLGF  110



>ref|XP_010476413.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=595

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESL  900
            +Y  Y R++EQ  +D  D+   SLG ++LK+   C  E ENYVPC+NV+E++
Sbjct  49   VYSNYGRIKEQAAIDYLDLRFFSLGVNRLKEFPLCGKERENYVPCYNVTENV  100



>ref|NP_973410.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
 gb|AEC05706.1| QUASIMODO2 like 2 [Arabidopsis thaliana]
Length=595

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+  +C  E E+YVPC+N++ +L  G 
Sbjct  56   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPFCGKERESYVPCYNITGNLLAGL  110



>ref|XP_010495624.1| PREDICTED: probable methyltransferase PMT4 [Camelina sativa]
Length=597

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESL  900
            +Y  Y R++EQ  +D  D+   SLG ++LK+   C  E ENYVPC+NV+E++
Sbjct  51   VYSNYGRIKEQAAIDYLDLRFFSLGVNRLKEFPLCGKERENYVPCYNVTENV  102



>ref|XP_009631772.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Nicotiana 
tomentosiformis]
Length=619

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  +SLG++++KD+  C  + ENYVPC+NVS +L  G 
Sbjct  57   IYTNYRKLKEQARNDYLELKSISLGANRIKDVGLCGKDRENYVPCYNVSANLLTGL  112



>ref|XP_009631773.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Nicotiana 
tomentosiformis]
Length=618

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  +SLG++++KD+  C  + ENYVPC+NVS +L  G 
Sbjct  57   IYTNYRKLKEQARNDYLELKSISLGANRIKDVGLCGKDRENYVPCYNVSANLLTGL  112



>ref|XP_006574934.1| PREDICTED: probable methyltransferase PMT4-like isoform X1 [Glycine 
max]
 ref|XP_006574935.1| PREDICTED: probable methyltransferase PMT4-like isoform X2 [Glycine 
max]
 ref|XP_006574936.1| PREDICTED: probable methyltransferase PMT4-like isoform X3 [Glycine 
max]
Length=620

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  ++  ++ G S+ ++ + C  E EN+VPC+NVS SL  GF
Sbjct  55   IYTNYRRVKEQAAVDYLELRSVAQGVSRQREFDLCGKERENFVPCYNVSASLLAGF  110



>ref|XP_009129088.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=614

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG++ LK+   C  E E+YVPC+N +E+L  G 
Sbjct  56   IYSNYRRIKEQAAVDYLDLRSLSLGTT-LKEFPLCAKERESYVPCYNSTENLLAGL  110



>gb|KJB50579.1| hypothetical protein B456_008G177800 [Gossypium raimondii]
Length=618

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D  ++  +S G+ +  +L  C  E ENYVPC+NV+ ++ LGF
Sbjct  54   EIYSNYRRLKEQTAVDYFELRTVSSGAGRQGELGLCGKERENYVPCYNVTANVLLGF  110



>gb|KHN29999.1| Putative methyltransferase PMT4 [Glycine soja]
Length=623

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  ++  ++ G S+ ++ + C  E EN+VPC+NVS SL  GF
Sbjct  55   IYTNYRRVKEQAAVDYLELRSVAQGVSRQREFDLCGKERENFVPCYNVSASLLAGF  110



>ref|XP_006574937.1| PREDICTED: probable methyltransferase PMT4-like isoform X4 [Glycine 
max]
Length=576

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  ++  ++ G S+ ++ + C  E EN+VPC+NVS SL  GF
Sbjct  55   IYTNYRRVKEQAAVDYLELRSVAQGVSRQREFDLCGKERENFVPCYNVSASLLAGF  110



>emb|CDY53946.1| BnaA02g36960D [Brassica napus]
Length=615

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG++ LK+   C  E E+YVPC+N +E+L  G 
Sbjct  56   IYSNYRRIKEQAAVDYLDLRSLSLGTT-LKEFPLCAKERESYVPCYNSTENLLAGL  110



>ref|XP_009152172.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=620

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+NV+ +L  G 
Sbjct  57   IYSNYRRIKEQAAVDYLDLRSLSLGTS-LKEFPLCGKERESYVPCYNVTGNLLAGL  111



>dbj|BAH56871.1| AT1G13860 [Arabidopsis thaliana]
Length=650

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            IY  Y R++EQ  +D  D+   SLG ++LK+   C  E +NYVPC+NV+ES
Sbjct  50   IYSNYGRVKEQAAVDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNVTES  100



>dbj|BAC42014.1| unknown protein [Arabidopsis thaliana]
Length=603

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            IY  Y R++EQ  +D  D+   SLG ++LK+   C  E +NYVPC+NV+ES
Sbjct  50   IYSNYGRVKEQAAVDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNVTES  100



>ref|XP_006379687.1| hypothetical protein POPTR_0008s09440g [Populus trichocarpa]
 gb|ERP57484.1| hypothetical protein POPTR_0008s09440g [Populus trichocarpa]
Length=433

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LS G+ + +++  C  E ENYVPC+NVS +L  G 
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSSGAGRQREVGLCGREQENYVPCYNVSANLLTGL  110



>gb|AAF79416.1|AC068197_26 F16A14.7 [Arabidopsis thaliana]
Length=724

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            IY  Y R++EQ  +D  D+   SLG ++LK+   C  E +NYVPC+NV+ES
Sbjct  50   IYSNYGRVKEQAAVDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNVTES  100



>ref|NP_172839.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_849657.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 ref|NP_973819.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 sp|Q8GYW9.2|PMT4_ARATH RecName: Full=Probable methyltransferase PMT4 [Arabidopsis thaliana]
 gb|AEE29075.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29076.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
 gb|AEE29077.1| QUASIMODO2 LIKE 1 [Arabidopsis thaliana]
Length=603

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            IY  Y R++EQ  +D  D+   SLG ++LK+   C  E +NYVPC+NV+ES
Sbjct  50   IYSNYGRVKEQAAVDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNVTES  100



>ref|XP_004237055.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
 ref|XP_010319469.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  736  RGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +  IY  YR+L+EQ   D  ++  L++G +++KD+  C  E ENYVPC+NVS ++  G 
Sbjct  51   KNDIYTNYRKLKEQARSDYLELKSLAVGENQIKDVGVCGKERENYVPCYNVSANILAGL  109



>ref|XP_007157839.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
 gb|ESW29833.1| hypothetical protein PHAVU_002G102600g [Phaseolus vulgaris]
Length=611

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  ++  +S G ++LK++  C  E EN+VPC NVS +L  GF
Sbjct  56   IYTSYRRIKEQAAVDYLELRSVSSGGARLKEVGLCGKERENFVPCHNVSANLISGF  111



>ref|XP_006348706.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=617

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YR+L+EQ   D  ++  +SLG++ +KD+  C  E ENYVPC+NVS +L  G 
Sbjct  55   VYTNYRKLKEQARNDYLELKSISLGANLIKDVGLCGKERENYVPCYNVSANLLAGL  110



>ref|XP_006348707.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YR+L+EQ   D  ++  +SLG++ +KD+  C  E ENYVPC+NVS +L  G 
Sbjct  55   VYTNYRKLKEQARNDYLELKSISLGANLIKDVGLCGKERENYVPCYNVSANLLAGL  110



>ref|XP_010425141.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Camelina 
sativa]
Length=620

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N++ +L  G 
Sbjct  57   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNITGNLLAGL  111



>ref|XP_010514117.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N++ +L  G 
Sbjct  57   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNITGNLLAGL  111



>ref|XP_010425139.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
 ref|XP_010425140.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Camelina 
sativa]
Length=621

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N++ +L  G 
Sbjct  57   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNITGNLLAGL  111



>ref|XP_010502360.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
 ref|XP_010502361.1| PREDICTED: probable methyltransferase PMT5 [Camelina sativa]
Length=620

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N++ +L  G 
Sbjct  57   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNITGNLLAGL  111



>ref|XP_002892777.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69036.1| hypothetical protein ARALYDRAFT_471543 [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSES  897
            IY  Y R++EQ  +D  D+   SLG ++LK+   C  E +NYVPC+N++E+
Sbjct  50   IYSNYGRIKEQAAIDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNITET  100



>gb|KHG21066.1| hypothetical protein F383_04870 [Gossypium arboreum]
Length=621

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +IY  YRRL+EQ  +D   +  +S G+ +  +L  C  E ENYVPC+NV+ ++ LGF
Sbjct  54   EIYSNYRRLKEQAAVDYFQLRTVSSGAGRQGELGLCGKERENYVPCYNVTANVLLGF  110



>ref|XP_002875206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51465.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=619

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N++ +L  G 
Sbjct  56   IYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNITGNLLAGL  110



>ref|XP_011463023.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463024.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463025.1| PREDICTED: probable methyltransferase PMT5 [Fragaria vesca subsp. 
vesca]
Length=621

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LSLG SK K+L  C  + E+ VPC+NVS +L  G+
Sbjct  55   IYTNYRRLKEQAAVDYLELRSLSLGGSKEKELGLCGRDKEHSVPCYNVSANLLAGY  110



>ref|XP_006365134.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
Length=616

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YR+L++ V  D  D+  LS+G++ +KD+ +C  E ENYVPC+NVS +   G 
Sbjct  55   VYTSYRKLKKLVRNDYLDLNSLSVGANWIKDIGFCGKERENYVPCYNVSANTLTGL  110



>ref|XP_010323873.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=616

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L + V  D  D+  LS+G++ +KD+ +C  E ENYVPC+NVS +   G 
Sbjct  55   IYVSYRKLTKLVRNDYLDLNSLSVGANWIKDIGFCGKERENYVPCYNVSANTVTGL  110



>gb|KJB80352.1| hypothetical protein B456_013G093300 [Gossypium raimondii]
Length=439

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +I+  YRRL+EQ  +D  ++  +  GSS+ ++L  C  E ENYVPC+NV+ +L  GF
Sbjct  54   EIFTNYRRLKEQAAVDYFELRTILSGSSRQRELGLCGKERENYVPCYNVTANLISGF  110



>ref|XP_010320876.1| PREDICTED: probable methyltransferase PMT5 [Solanum lycopersicum]
Length=617

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  +SLG++ +KD+  C  E ENYVPC NVS +L  G 
Sbjct  55   IYTNYRKLKEQARNDYLELKSISLGANLIKDVGLCGKERENYVPCHNVSANLLAGL  110



>gb|KHG30605.1| hypothetical protein F383_04558 [Gossypium arboreum]
Length=673

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +I+  YRRL+EQ  +D  ++  +  GSS+ ++L  C  E ENYVPC+NV+ +L  GF
Sbjct  83   EIFTNYRRLKEQAAVDYFELRTILSGSSRQRELGLCCKERENYVPCYNVTANLISGF  139



>ref|XP_007153532.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
 gb|ESW25526.1| hypothetical protein PHAVU_003G043400g [Phaseolus vulgaris]
Length=608

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  ++  ++ G S+ ++ + C  E EN+VPC+NVS +L  GF
Sbjct  55   IYTNYRRVKEQAAVDYLELRSVARGISRQREFDLCGKERENFVPCYNVSANLLSGF  110



>ref|XP_010554289.1| PREDICTED: probable methyltransferase PMT5 [Tarenaya hassleriana]
Length=620

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  748  YHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            Y  YRR++EQ  +D  D+  LS  +S+ K+   C  E EN+VPC+NVS ++  G 
Sbjct  57   YSNYRRIKEQAAVDYLDLSSLSFEASRFKEFPLCGKEKENHVPCYNVSSNMLAGL  111



>gb|KJB80353.1| hypothetical protein B456_013G093300 [Gossypium raimondii]
Length=618

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  742  KIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +I+  YRRL+EQ  +D  ++  +  GSS+ ++L  C  E ENYVPC+NV+ +L  GF
Sbjct  54   EIFTNYRRLKEQAAVDYFELRTILSGSSRQRELGLCGKERENYVPCYNVTANLISGF  110



>ref|XP_011018345.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
 ref|XP_011018353.1| PREDICTED: probable methyltransferase PMT5 isoform X1 [Populus 
euphratica]
Length=619

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LS  + + ++L  C  E ENYVPC+NVS +L  G 
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSSAAGRQRELGLCGREQENYVPCYNVSANLLTGL  110



>ref|XP_006395700.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 ref|XP_006395701.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32986.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
 gb|ESQ32987.1| hypothetical protein EUTSA_v10003873mg [Eutrema salsugineum]
Length=595

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+NV+ +L  G 
Sbjct  56   MYSNYRRIKEQAAVDYLDLRSLSLGAS-LKEFPLCGKERESYVPCYNVTGNLLAGL  110



>ref|XP_011018362.1| PREDICTED: probable methyltransferase PMT5 isoform X2 [Populus 
euphratica]
Length=560

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRRL+EQ  +D  ++  LS  + + ++L  C  E ENYVPC+NVS +L  G 
Sbjct  55   IYSNYRRLKEQAAVDYLELRTLSSAAGRQRELGLCGREQENYVPCYNVSANLLTGL  110



>ref|XP_009114154.1| PREDICTED: probable methyltransferase PMT5 [Brassica rapa]
Length=613

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YRR++EQ  +D  D+  LSLG++ L++   C  E E+YVPC+NV+ +L  G 
Sbjct  50   VYSNYRRIKEQAAVDYLDLRSLSLGTT-LREFPLCGKERESYVPCYNVTGNLLAGL  104



>ref|XP_006292704.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
 gb|EOA25602.1| hypothetical protein CARUB_v10018950mg [Capsella rubella]
Length=606

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++EQ  +D  D+  L+LG+S +K+   C  E E+YVPC+N++ +L  G 
Sbjct  56   IYSNYRRIKEQAAIDYLDLRSLALGAS-VKEFPLCGKERESYVPCYNITGNLLAGL  110



>gb|AES89995.2| methyltransferase PMT16, putative [Medicago truncatula]
Length=606

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++E+V +D  ++  +S G  K K+L  C  E EN+VPC NV+ +L  GF
Sbjct  55   IYTNYRRIKERVAVDYLELKSVSSGGLKQKELGLCGKERENFVPCHNVTANLLSGF  110



>ref|XP_003607798.1| hypothetical protein MTR_4g083030 [Medicago truncatula]
Length=628

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++E+V +D  ++  +S G  K K+L  C  E EN+VPC NV+ +L  GF
Sbjct  55   IYTNYRRIKERVAVDYLELKSVSSGGLKQKELGLCGKERENFVPCHNVTANLLSGF  110



>ref|XP_009590890.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590891.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
 ref|XP_009590893.1| PREDICTED: probable methyltransferase PMT5 [Nicotiana tomentosiformis]
Length=617

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YR+L+EQ   D  ++  LS+  +++KD+  C  E ENYVPC+NVS +   GF
Sbjct  55   IYTNYRKLKEQARSDYLELKGLSVRENQIKDVGLCGKERENYVPCYNVSANTLAGF  110



>ref|XP_004505366.1| PREDICTED: probable methyltransferase PMT5-like [Cicer arietinum]
Length=619

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            IY  YRR++E+V +D  ++  +S G ++ ++L  C  E EN+VPC NV+ +L  GF
Sbjct  55   IYTNYRRIKERVAVDYLELKSVSSGGARQRELGLCGKERENFVPCHNVTANLLSGF  110



>ref|XP_006344244.1| PREDICTED: probable methyltransferase PMT5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006344245.1| PREDICTED: probable methyltransferase PMT5-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  736  RGKIYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +  IY  YR+L+EQ   D  ++  L++G +++KD+  C  E EN VPC+NVS ++  G 
Sbjct  51   KNDIYTNYRKLKEQARSDYLELKSLAVGENQIKDVGVCGKERENCVPCYNVSANILAGL  109



>ref|XP_010680718.1| PREDICTED: probable methyltransferase PMT5 [Beta vulgaris subsp. 
vulgaris]
Length=623

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSS-KLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YR+L+EQ V+D  D+  L+ GS+ + K+L  C  E ENYV C+N+S ++E GF
Sbjct  57   VYTNYRKLKEQAVVDYFDLRFLASGSNPRQKELPLCGKERENYVLCYNLSANVEGGF  113



>emb|CDY02989.1| BnaC07g22380D [Brassica napus]
Length=619

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSE  894
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N  E
Sbjct  58   IYSNYRRIKEQAAVDYLDLRSLSLGTS-LKEFPLCGKERESYVPCYNGDE  106



>emb|CDY51215.1| BnaA06g39940D [Brassica napus]
Length=631

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSE  894
            IY  YRR++EQ  +D  D+  LSLG+S LK+   C  E E+YVPC+N  E
Sbjct  58   IYSNYRRIKEQAAVDYLDLRSLSLGTS-LKEFPLCGKERESYVPCYNGDE  106



>emb|CDY37197.1| BnaC02g35050D [Brassica napus]
Length=604

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  745  IYHGYRRLQEQVVLDLKDIGHLSLGSSKLKDLEYCPPEAENYVPCFNVSESLELGF  912
            +Y  YRR++EQ  +D  D+  LSLG++ LK+   C  E E+ VPC+N +E+L  G 
Sbjct  56   VYSSYRRIKEQAAVDYLDLRSLSLGTT-LKEFPLCGKERESCVPCYNSTENLLAGL  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610