BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5973

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   297   1e-96   Citrus sinensis [apfelsine]
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   298   2e-96   Citrus sinensis [apfelsine]
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             297   8e-96   Prunus persica
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   296   1e-95   Citrus sinensis [apfelsine]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    296   1e-95   Citrus sinensis [apfelsine]
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     296   3e-95   Prunus mume [ume]
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     295   4e-95   Solanum lycopersicum
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    295   4e-95   Nicotiana tomentosiformis
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             296   6e-95   
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     295   7e-95   Vitis vinifera
emb|CDP15204.1|  unnamed protein product                                294   8e-95   Coffea canephora [robusta coffee]
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   293   3e-94   Solanum tuberosum [potatoes]
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             293   3e-94   Populus trichocarpa [western balsam poplar]
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          291   5e-94   
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    292   7e-94   Nicotiana sylvestris
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     291   1e-93   Populus euphratica
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     291   1e-93   
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     291   2e-93   
gb|AEQ94156.1|  shaggy-related protein kinase                           284   2e-93   Elaeis guineensis
gb|KJB45482.1|  hypothetical protein B456_007G308500                    286   4e-93   Gossypium raimondii
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      290   4e-93   Fragaria vesca [alpine strawberry]
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     283   5e-93   Elaeis guineensis
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     290   5e-93   Sesamum indicum [beniseed]
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     290   5e-93   Nelumbo nucifera [Indian lotus]
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    289   9e-93   Pyrus x bretschneideri [bai li]
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    289   1e-92   Tarenaya hassleriana [spider flower]
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    289   1e-92   
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    289   1e-92   Pyrus x bretschneideri [bai li]
ref|XP_012088843.1|  PREDICTED: shaggy-related protein kinase alpha     289   1e-92   Jatropha curcas
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             288   2e-92   Phaseolus vulgaris [French bean]
gb|KJB49765.1|  hypothetical protein B456_008G136600                    288   2e-92   Gossypium raimondii
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        288   2e-92   Gossypium arboreum [tree cotton]
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    288   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             288   2e-92   
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    289   3e-92   
gb|ABB55385.1|  Ser/Thr protein kinase-like                             288   3e-92   Solanum tuberosum [potatoes]
gb|KJB45480.1|  hypothetical protein B456_007G308500                    285   3e-92   Gossypium raimondii
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    286   3e-92   
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    287   4e-92   Vitis vinifera
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     287   5e-92   Pyrus x bretschneideri [bai li]
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    287   5e-92   Glycine max [soybeans]
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             287   5e-92   Capsella rubella
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   287   5e-92   Glycine soja [wild soybean]
gb|AFH00876.1|  glycogen synthase kinase-3                              287   6e-92   Glycine soja [wild soybean]
ref|XP_006841582.1|  PREDICTED: glycogen synthase kinase-3 homolo...    287   7e-92   Amborella trichopoda
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             286   8e-92   
gb|ACQ91102.1|  glycogen synthase kinase                                286   9e-92   Glycine max [soybeans]
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                290   9e-92   
gb|ACJ83284.1|  unknown                                                 278   1e-91   Medicago truncatula
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    286   1e-91   
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    286   2e-91   Malus domestica [apple tree]
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    286   2e-91   Nicotiana tabacum [American tobacco]
gb|ERN02393.1|  hypothetical protein AMTR_s00096p00102520               283   4e-91   Amborella trichopoda
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             285   4e-91   Eutrema salsugineum [saltwater cress]
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             285   5e-91   Prunus persica
ref|NP_001242661.1|  glycogen synthase kinase-3                         285   5e-91   
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    285   5e-91   Prunus mume [ume]
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   281   6e-91   Citrus sinensis [apfelsine]
gb|KJB45479.1|  hypothetical protein B456_007G308500                    284   7e-91   Gossypium raimondii
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     280   8e-91   Eucalyptus grandis [rose gum]
gb|ABK93098.1|  unknown                                                 284   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    284   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    284   1e-90   Glycine max [soybeans]
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     284   1e-90   Populus euphratica
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    283   1e-90   Populus euphratica
ref|XP_011622016.1|  PREDICTED: shaggy-related protein kinase eps...    283   2e-90   Amborella trichopoda
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     283   2e-90   Nicotiana tomentosiformis
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          283   3e-90   Ricinus communis
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    282   4e-90   Elaeis guineensis
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      282   4e-90   Morus notabilis
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     282   4e-90   Gossypium arboreum [tree cotton]
gb|ABY60447.1|  serine/threonine protein kinase                         282   4e-90   Adonis aestivalis var. palaestina
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    282   5e-90   Nelumbo nucifera [Indian lotus]
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     282   5e-90   
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    282   5e-90   Populus euphratica
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             280   6e-90   
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   280   6e-90   Citrus sinensis [apfelsine]
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    282   7e-90   Nelumbo nucifera [Indian lotus]
emb|CAN64359.1|  hypothetical protein VITISV_041427                     282   2e-89   Vitis vinifera
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     280   2e-89   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    281   2e-89   Cucumis sativus [cucumbers]
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...    280   2e-89   Sesamum indicum [beniseed]
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    280   2e-89   Phoenix dactylifera
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             280   3e-89   
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1     280   3e-89   Nicotiana sylvestris
ref|NP_001242406.1|  uncharacterized protein LOC100788612               280   4e-89   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    280   4e-89   Glycine max [soybeans]
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    280   4e-89   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    280   4e-89   Sesamum indicum [beniseed]
gb|AES82237.2|  glycogen synthase kinase                                278   4e-89   Medicago truncatula
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             280   5e-89   
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    280   5e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     279   7e-89   Eucalyptus grandis [rose gum]
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    279   7e-89   Eucalyptus grandis [rose gum]
emb|CAA48472.1|  protein kinase                                         279   7e-89   Medicago sativa [alfalfa]
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    279   8e-89   Medicago sativa [alfalfa]
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    279   1e-88   
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   278   1e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CAA53181.1|  shaggy related kinase                                  278   1e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CAA04265.1|  shaggy-like kinase alpha                               278   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012082965.1|  PREDICTED: shaggy-related protein kinase alp...    278   1e-88   Jatropha curcas
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     278   1e-88   
gb|ACJ85178.1|  unknown                                                 277   2e-88   Medicago truncatula
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    278   2e-88   Camelina sativa [gold-of-pleasure]
ref|XP_003626019.1|  Protein kinase, putative                           278   3e-88   
gb|AFK38277.1|  unknown                                                 278   3e-88   Medicago truncatula
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    278   3e-88   Eucalyptus grandis [rose gum]
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    277   3e-88   
dbj|BAD95892.1|  Ser/Thr protein kinase                                 277   4e-88   Lotus japonicus
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1     277   4e-88   Cucumis melo [Oriental melon]
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alpha     277   5e-88   Cucumis sativus [cucumbers]
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    277   5e-88   Camelina sativa [gold-of-pleasure]
ref|XP_003626020.1|  Protein kinase, putative                           278   6e-88   
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 276   7e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    276   7e-88   Vitis vinifera
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    275   8e-88   Nelumbo nucifera [Indian lotus]
ref|XP_003591238.1|  Glycogen synthase kinase                           276   9e-88   Medicago truncatula
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...    276   1e-87   Fragaria vesca subsp. vesca
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    276   2e-87   Medicago sativa [alfalfa]
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             275   2e-87   
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    274   3e-87   Nelumbo nucifera [Indian lotus]
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    275   3e-87   Elaeis guineensis
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             275   4e-87   Eutrema salsugineum [saltwater cress]
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             275   4e-87   Eutrema salsugineum [saltwater cress]
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   275   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    275   5e-87   Glycine max [soybeans]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     274   5e-87   Tarenaya hassleriana [spider flower]
emb|CDX87033.1|  BnaC09g03480D                                          274   6e-87   
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             274   6e-87   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    274   6e-87   Nelumbo nucifera [Indian lotus]
emb|CDY19757.1|  BnaA09g04100D                                          274   7e-87   Brassica napus [oilseed rape]
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    274   7e-87   Phoenix dactylifera
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    274   8e-87   Glycine max [soybeans]
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    273   1e-86   Phoenix dactylifera
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                273   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    272   3e-86   
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    272   5e-86   Brassica rapa
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     272   6e-86   Brassica rapa
dbj|BAJ34573.1|  unnamed protein product                                271   6e-86   Eutrema halophilum
emb|CDX80585.1|  BnaC07g28590D                                          271   6e-86   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     271   7e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             271   9e-86   Capsella rubella
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   276   1e-85   Glycine soja [wild soybean]
emb|CDY49981.1|  BnaC03g34380D                                          270   2e-85   Brassica napus [oilseed rape]
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    270   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    270   3e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     270   4e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                270   4e-85   Erythranthe guttata [common monkey flower]
gb|ABG74911.1|  AtSK12-like protein                                     270   5e-85   Brassica napus [oilseed rape]
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    269   5e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    269   7e-85   Camelina sativa [gold-of-pleasure]
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...    269   9e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    268   1e-84   Nelumbo nucifera [Indian lotus]
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     268   1e-84   Brassica rapa
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     268   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    268   2e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma     268   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63877.1|  hypothetical protein M569_10905                         267   3e-84   Genlisea aurea
emb|CAB87631.1|  protein kinase MSK-3-like                              267   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             267   4e-84   
ref|NP_196968.2|  Shaggy-related protein kinase 13                      267   4e-84   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    267   5e-84   Camelina sativa [gold-of-pleasure]
emb|CDY05202.1|  BnaC05g46010D                                          267   5e-84   
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             266   6e-84   Eutrema salsugineum [saltwater cress]
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    266   7e-84   Pyrus x bretschneideri [bai li]
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...    266   7e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...    267   7e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KGN65982.1|  hypothetical protein Csa_1G560660                       265   9e-84   Cucumis sativus [cucumbers]
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...    266   1e-83   Oryza brachyantha
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     265   1e-83   Brassica rapa
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    265   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX70574.1|  BnaC03g06580D                                          265   2e-83   
ref|XP_002873682.1|  kinase family protein                              265   2e-83   
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...    265   2e-83   Oryza brachyantha
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    264   4e-83   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM82575.1|  unnamed protein product                                264   5e-83   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF36565.1|  Shaggy-like kinase                                     264   6e-83   Triticum aestivum [Canadian hard winter wheat]
emb|CDX78587.1|  BnaA03g04990D                                          263   1e-82   
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein           264   1e-82   
emb|CDY27737.1|  BnaA05g31460D                                          266   1e-82   Brassica napus [oilseed rape]
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     263   2e-82   Brachypodium distachyon [annual false brome]
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    263   2e-82   Cicer arietinum [garbanzo]
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    262   4e-82   Tarenaya hassleriana [spider flower]
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    261   1e-81   Brassica rapa
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...    260   3e-81   
ref|NP_001042602.1|  Os01g0252100                                       259   4e-81   
gb|EPS73818.1|  hypothetical protein M569_00937                         259   4e-81   Genlisea aurea
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    256   5e-81   
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    259   8e-81   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            258   8e-81   
gb|AES61591.2|  glycogen synthase kinase                                258   9e-81   Medicago truncatula
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    258   9e-81   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          258   1e-80   Sorghum bicolor [broomcorn]
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    258   1e-80   Medicago sativa [alfalfa]
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             258   2e-80   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    256   2e-80   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    257   2e-80   Prunus mume [ume]
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    257   4e-80   Setaria italica
gb|AFW79696.1|  putative glycogen synthase kinase family protein        256   4e-80   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   256   5e-80   
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    256   6e-80   Nicotiana tomentosiformis
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    256   6e-80   Nicotiana sylvestris
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    256   9e-80   
ref|NP_001150105.1|  LOC100283734                                       256   9e-80   Zea mays [maize]
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    255   1e-79   
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1                 256   2e-79   Zea mays [maize]
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...    256   2e-79   
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    253   7e-79   Solanum tuberosum [potatoes]
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    253   8e-79   
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                          253   9e-79   Zea mays [maize]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    253   1e-78   Solanum lycopersicum
emb|CBI39647.3|  unnamed protein product                                252   1e-78   Vitis vinifera
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  247   2e-78   Citrus sinensis [apfelsine]
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  247   2e-78   Citrus sinensis [apfelsine]
emb|CAA58594.1|  Petunia Shaggy kinase 4                                252   2e-78   Petunia x hybrida [garden petunia]
emb|CDP02094.1|  unnamed protein product                                252   3e-78   Coffea canephora [robusta coffee]
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    251   4e-78   Fragaria vesca subsp. vesca
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                251   4e-78   Erythranthe guttata [common monkey flower]
gb|EPS68300.1|  hypothetical protein M569_06467                         251   6e-78   Genlisea aurea
gb|EMT09676.1|  Shaggy-related protein kinase alpha                     251   9e-78   
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    251   9e-78   Selaginella moellendorffii
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    250   1e-77   Sesamum indicum [beniseed]
dbj|BAJ99594.1|  predicted protein                                      250   1e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    249   1e-77   Solanum lycopersicum
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                250   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...    249   2e-77   Sesamum indicum [beniseed]
gb|EMS62368.1|  Shaggy-related protein kinase alpha                     251   3e-77   Triticum urartu
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    250   3e-77   Citrus sinensis [apfelsine]
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             249   6e-77   Citrus clementina [clementine]
emb|CBI37005.3|  unnamed protein product                                247   9e-77   Vitis vinifera
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    247   3e-76   Cucumis melo [Oriental melon]
emb|CDX78658.1|  BnaA03g05700D                                          251   4e-76   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             246   6e-76   Phaseolus vulgaris [French bean]
ref|XP_004141099.2|  PREDICTED: shaggy-related protein kinase eps...    246   8e-76   Cucumis sativus [cucumbers]
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    245   1e-75   Solanum lycopersicum
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              259   2e-75   
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    244   2e-75   Solanum tuberosum [potatoes]
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    244   4e-75   Solanum tuberosum [potatoes]
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3           246   4e-75   Triticum urartu
ref|XP_009124961.1|  PREDICTED: shaggy-related protein kinase gam...    243   4e-75   Brassica rapa
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   239   6e-75   Citrus sinensis [apfelsine]
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...    243   6e-75   
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...    242   2e-74   Brachypodium distachyon [annual false brome]
gb|ABR16348.1|  unknown                                                 241   5e-74   Picea sitchensis
emb|CDY18828.1|  BnaAnng02930D                                          241   5e-74   Brassica napus [oilseed rape]
ref|XP_001781582.1|  predicted protein                                  241   6e-74   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         241   7e-74   Physcomitrella patens
gb|AFW57486.1|  putative glycogen synthase kinase family protein        238   7e-74   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             241   1e-73   Selaginella moellendorffii
gb|AAQ23107.1|  shaggy-related protein kinase 2                         240   1e-73   Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                  240   1e-73   
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...    240   1e-73   Setaria italica
gb|ACJ85100.1|  unknown                                                 234   1e-73   Medicago truncatula
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   238   2e-73   Citrus sinensis [apfelsine]
emb|CDP17018.1|  unnamed protein product                                238   2e-73   Coffea canephora [robusta coffee]
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710          239   3e-73   Sorghum bicolor [broomcorn]
ref|XP_001781586.1|  predicted protein                                  239   3e-73   
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...    238   5e-73   
ref|NP_001288361.1|  uncharacterized protein LOC103641344               238   6e-73   Zea mays [maize]
gb|AAT85177.1|  putative glycogen synthase kinase                       236   6e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    235   1e-72   Brassica rapa
gb|ABG29426.1|  GSK-like kinase 1                                       238   1e-72   Aegilops speltoides
ref|XP_006857847.2|  PREDICTED: shaggy-related protein kinase eps...    236   1e-72   
gb|EAY96448.1|  hypothetical protein OsI_18343                          237   2e-72   Oryza sativa Indica Group [Indian rice]
gb|ACJ84453.1|  unknown                                                 236   2e-72   Medicago truncatula
gb|ABC94949.1|  GSK-like kinase                                         236   2e-72   Aegilops tauschii
gb|AFK37839.1|  unknown                                                 236   3e-72   Medicago truncatula
gb|ABG29424.1|  GSK-like kinase 1D                                      236   3e-72   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001054564.1|  Os05g0134000                                       236   4e-72   
ref|XP_001763270.1|  predicted protein                                  236   4e-72   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            235   4e-72   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         236   5e-72   Physcomitrella patens
gb|AAY98510.1|  glycogen synthase kinase                                236   5e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             237   9e-72   
gb|KDO86031.1|  hypothetical protein CISIN_1g011138mg                   237   2e-71   Citrus sinensis [apfelsine]
ref|XP_001762052.1|  predicted protein                                  234   2e-71   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         234   3e-71   Physcomitrella patens
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    235   3e-71   Nelumbo nucifera [Indian lotus]
gb|ABC94947.1|  GSK-like kinase                                         234   3e-71   Triticum monococcum [einkorn wheat]
gb|ABG29422.1|  GSK-like kinase 1A                                      234   3e-71   
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    235   4e-71   
ref|XP_001765207.1|  predicted protein                                  234   4e-71   
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    235   5e-71   
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    235   6e-71   
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    234   7e-71   
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     234   8e-71   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   231   9e-71   
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             231   2e-70   
gb|ABG29423.1|  GSK-like kinase 1B                                      231   3e-70   
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    233   3e-70   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             231   4e-70   
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             232   5e-70   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    229   5e-70   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    229   6e-70   
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    232   6e-70   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   229   9e-70   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    229   1e-69   
ref|XP_006375322.1|  shaggy-related protein kinase theta                231   1e-69   
ref|XP_010090625.1|  Shaggy-related protein kinase theta                232   1e-69   
ref|XP_007051909.1|  Shaggy-like protein kinase 32 isoform 2            230   2e-69   
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             231   2e-69   
ref|XP_007051910.1|  Shaggy-like protein kinase 32 isoform 3            230   2e-69   
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     230   4e-69   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   227   4e-69   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    228   4e-69   
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             232   5e-69   
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...    227   1e-68   
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            230   1e-68   
ref|XP_012083467.1|  PREDICTED: shaggy-related protein kinase the...    229   1e-68   
gb|ABK24355.1|  unknown                                                 225   2e-68   
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                     225   3e-68   
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          228   3e-68   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               225   3e-68   
gb|KJB22348.1|  hypothetical protein B456_004G042400                    227   5e-68   
gb|AFN42826.1|  GSK3-like protein                                       225   5e-68   
gb|KJB22347.1|  hypothetical protein B456_004G042400                    226   6e-68   
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            223   1e-67   
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             224   1e-67   
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    226   2e-67   
ref|XP_004967591.1|  PREDICTED: shaggy-related protein kinase alp...    224   2e-67   
dbj|BAD95891.1|  Ser/Thr protein kinase                                 225   3e-67   
ref|XP_004510856.1|  PREDICTED: shaggy-related protein kinase the...    224   4e-67   
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     224   4e-67   
gb|KJB41235.1|  hypothetical protein B456_007G096100                    223   6e-67   
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     224   9e-67   
gb|ABC94948.1|  GSK-like kinase                                         221   2e-66   
ref|XP_011023409.1|  PREDICTED: shaggy-related protein kinase the...    222   2e-66   
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase theta     223   2e-66   
gb|KJB41237.1|  hypothetical protein B456_007G096100                    223   2e-66   
emb|CAC08564.1|  wound-induced GSK-3-like protein                       223   2e-66   
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    223   2e-66   
gb|KJB41234.1|  hypothetical protein B456_007G096100                    223   2e-66   
gb|AAM77397.1|  GSK-like kinase                                         220   2e-66   
gb|KEH18946.1|  shaggy-like kinase                                      223   3e-66   
gb|ABD97992.1|  glycogen synthase kinase                                219   4e-66   
emb|CDP08875.1|  unnamed protein product                                221   6e-66   
ref|XP_011023410.1|  PREDICTED: shaggy-related protein kinase the...    221   7e-66   
ref|XP_011023408.1|  PREDICTED: shaggy-related protein kinase NtK...    221   7e-66   
ref|XP_010671733.1|  PREDICTED: shaggy-related protein kinase eps...    221   1e-65   
emb|CAA11862.1|  shaggy kinase 7                                        220   2e-65   
ref|XP_010419626.1|  PREDICTED: shaggy-related protein kinase the...    214   5e-65   
ref|XP_003574217.1|  PREDICTED: shaggy-related protein kinase alp...    219   6e-65   
gb|ABK24513.1|  unknown                                                 218   7e-65   
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             218   2e-64   
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    216   2e-64   
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     218   2e-64   
gb|KHN27286.1|  Shaggy-related protein kinase theta                     218   3e-64   
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    215   3e-64   
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             217   4e-64   
ref|XP_011628612.1|  PREDICTED: shaggy-related protein kinase kappa     216   5e-64   
ref|XP_007139956.1|  hypothetical protein PHAVU_008G072800g             216   5e-64   
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     217   5e-64   
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                     215   6e-64   
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    216   7e-64   
ref|NP_191981.1|  Shaggy-related protein kinase theta                   216   8e-64   
gb|ERN20048.1|  hypothetical protein AMTR_s00071p00186380               215   1e-63   
emb|CDX91895.1|  BnaC03g31970D                                          215   1e-63   
gb|ADE76936.1|  unknown                                                 213   1e-63   
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    215   2e-63   
emb|CAA58595.1|  Petunia Shaggy kinase 6                                214   2e-63   
emb|CAA05329.1|  shaggy-like kinase 59                                  215   2e-63   
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     215   2e-63   
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    215   2e-63   
ref|XP_006389512.1|  hypothetical protein POPTR_0022s00480g             207   2e-63   
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               213   2e-63   
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    213   2e-63   
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    215   2e-63   
ref|NP_001190762.1|  Shaggy-related protein kinase eta                  209   2e-63   
dbj|BAO02525.1|  predicted Shaggy-like kinase ortholog                  213   2e-63   
emb|CAA64408.1|  shaggy-like kinase dzeta                               213   3e-63   
ref|XP_010053665.1|  PREDICTED: shaggy-related protein kinase eps...    215   3e-63   
ref|XP_007025343.1|  Kinase superfamily protein isoform 2               212   3e-63   
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    215   3e-63   
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     214   3e-63   
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    214   3e-63   
ref|XP_011047893.1|  PREDICTED: shaggy-related protein kinase kappa     207   4e-63   
emb|CDX74346.1|  BnaA03g27010D                                          214   4e-63   
emb|CDY07202.1|  BnaCnng02170D                                          214   4e-63   
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     214   4e-63   
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     214   4e-63   
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             214   4e-63   
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    214   4e-63   
ref|XP_010100748.1|  Shaggy-related protein kinase eta                  210   5e-63   
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          214   5e-63   
gb|ABR68632.1|  RIM11-like protein                                      213   6e-63   
emb|CAA11861.1|  shaggy kinase 6                                        214   6e-63   
ref|XP_003623822.1|  Shaggy-related protein kinase                      214   7e-63   
ref|XP_006294432.1|  hypothetical protein CARUB_v10023447mg             211   7e-63   
ref|XP_010686226.1|  PREDICTED: shaggy-related protein kinase eta       211   8e-63   
gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   210   8e-63   
gb|KDO77888.1|  hypothetical protein CISIN_1g016950mg                   209   9e-63   
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    212   1e-62   
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      212   1e-62   
ref|XP_009141120.1|  PREDICTED: shaggy-related protein kinase zeta      212   1e-62   
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    212   1e-62   
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    213   1e-62   
gb|ABR17316.1|  unknown                                                 213   1e-62   
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    213   1e-62   
ref|XP_009610982.1|  PREDICTED: shaggy-related protein kinase eps...    213   1e-62   
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   210   1e-62   
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    213   1e-62   
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    213   1e-62   
gb|ACJ85155.1|  unknown                                                 204   1e-62   
ref|XP_004149276.1|  PREDICTED: shaggy-related protein kinase eta...    212   1e-62   
ref|XP_008448253.1|  PREDICTED: shaggy-related protein kinase eta...    211   2e-62   
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        210   2e-62   
emb|CBI22011.3|  unnamed protein product                                209   2e-62   
emb|CAA64409.1|  shaggy-like kinase etha                                210   2e-62   
dbj|BAJ93751.1|  predicted protein                                      212   2e-62   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    211   2e-62   
gb|KHN29413.1|  Shaggy-related protein kinase theta                     212   2e-62   
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    211   3e-62   
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    212   3e-62   
ref|NP_001065093.1|  Os10g0521700                                       212   3e-62   
dbj|BAJ33611.1|  unnamed protein product                                209   3e-62   
gb|KGN58535.1|  hypothetical protein Csa_3G664590                       209   3e-62   
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3           210   3e-62   
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    209   3e-62   
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             210   3e-62   
gb|EMT00762.1|  Glycogen synthase kinase-3-MsK-3-like protein           210   4e-62   
ref|XP_002870026.1|  hypothetical protein ARALYDRAFT_914806             209   4e-62   
emb|CAA05328.1|  shaggy-like kinase 111                                 212   4e-62   
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    209   4e-62   
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    212   4e-62   
ref|NP_193606.1|  Shaggy-related protein kinase eta                     209   4e-62   
gb|AAL77705.1|  AT4g18710/F28A21_120                                    209   4e-62   
ref|XP_006449527.1|  hypothetical protein CICLE_v10015608mg             209   4e-62   
ref|XP_012066688.1|  PREDICTED: shaggy-related protein kinase kappa     210   4e-62   
ref|XP_007048725.1|  SHAGGY-related protein kinase dZeta isoform 1      210   4e-62   
dbj|BAJ33892.1|  unnamed protein product                                207   4e-62   
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    211   4e-62   
emb|CAA11860.1|  shaggy-like kinase 91                                  212   4e-62   
gb|EEC67328.1|  hypothetical protein OsI_34360                          213   4e-62   
ref|XP_006644095.1|  PREDICTED: glycogen synthase kinase-3 homolo...    210   5e-62   
gb|KDO63404.1|  hypothetical protein CISIN_1g014750mg                   209   5e-62   
ref|XP_012091803.1|  PREDICTED: shaggy-related protein kinase eta       209   6e-62   
gb|EMT29598.1|  Shaggy-related protein kinase theta                     212   6e-62   
gb|KJB34904.1|  hypothetical protein B456_006G089400                    207   6e-62   
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   210   7e-62   
ref|XP_003527338.1|  PREDICTED: shaggy-related protein kinase zet...    210   7e-62   
gb|ABR17117.1|  unknown                                                 210   7e-62   
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    211   7e-62   
ref|NP_001141576.1|  uncharacterized protein LOC100273692               207   7e-62   
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             210   7e-62   
gb|KHG20282.1|  Shaggy-related protein kinase theta                     209   7e-62   
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    209   8e-62   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    209   8e-62   
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    210   8e-62   
ref|XP_010557132.1|  PREDICTED: shaggy-related protein kinase zet...    209   8e-62   
ref|XP_009132133.1|  PREDICTED: shaggy-related protein kinase eta       208   8e-62   
gb|KJB34903.1|  hypothetical protein B456_006G089400                    207   9e-62   
ref|XP_003633016.1|  PREDICTED: shaggy-related protein kinase eta...    208   9e-62   
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    209   9e-62   
gb|KFK42959.1|  hypothetical protein AALP_AA1G061200                    209   9e-62   
ref|XP_010104417.1|  Shaggy-related protein kinase zeta                 210   9e-62   
ref|XP_010557131.1|  PREDICTED: shaggy-related protein kinase zet...    209   9e-62   
ref|XP_010556679.1|  PREDICTED: shaggy-related protein kinase alp...    209   1e-61   
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    209   1e-61   
emb|CDP15948.1|  unnamed protein product                                209   1e-61   
gb|ABG74917.1|  BIN2-like protein                                       208   1e-61   
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             209   1e-61   
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta      209   1e-61   
ref|XP_009136953.1|  PREDICTED: shaggy-related protein kinase eta...    208   1e-61   
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    209   1e-61   
ref|XP_010457765.1|  PREDICTED: shaggy-related protein kinase iota      209   2e-61   
ref|XP_010671741.1|  PREDICTED: shaggy-related protein kinase the...    207   2e-61   
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                210   2e-61   
ref|XP_010475366.1|  PREDICTED: shaggy-related protein kinase iot...    208   2e-61   
gb|KJB34905.1|  hypothetical protein B456_006G089400                    207   2e-61   
ref|XP_010486052.1|  PREDICTED: shaggy-related protein kinase iot...    208   2e-61   
gb|ABK24428.1|  unknown                                                 210   2e-61   
gb|KHG20434.1|  Shaggy-related protein kinase eta                       207   2e-61   
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    208   2e-61   
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    209   2e-61   
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      210   3e-61   
ref|XP_007148030.1|  hypothetical protein PHAVU_006G1745000g            202   3e-61   
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    209   3e-61   
ref|XP_011657086.1|  PREDICTED: shaggy-related protein kinase zet...    207   3e-61   
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       208   3e-61   
ref|XP_006417928.1|  hypothetical protein EUTSA_v10007772mg             208   3e-61   
gb|KJB34902.1|  hypothetical protein B456_006G089400                    207   3e-61   
ref|XP_008448254.1|  PREDICTED: shaggy-related protein kinase zet...    207   3e-61   
ref|XP_010538570.1|  PREDICTED: shaggy-related protein kinase eta...    207   4e-61   
emb|CDO96835.1|  unnamed protein product                                207   4e-61   
gb|EYU28104.1|  hypothetical protein MIMGU_mgv1a008133mg                207   4e-61   
ref|XP_006285118.1|  hypothetical protein CARUB_v10006451mg             207   4e-61   
gb|AAT81407.1|  shaggy-related protein kinase 6                         209   4e-61   
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...    207   4e-61   
ref|XP_002522231.1|  Glycogen synthase kinase-3 beta, putative          206   5e-61   
ref|XP_002317404.1|  GSK3/SHAGGY-LIKE protein KINASE 1                  206   5e-61   
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    209   5e-61   
gb|EYU30769.1|  hypothetical protein MIMGU_mgv1a006689mg                206   5e-61   
ref|XP_011039408.1|  PREDICTED: shaggy-related protein kinase eta...    206   6e-61   
gb|KJB24673.1|  hypothetical protein B456_004G156700                    207   6e-61   
gb|KJB24672.1|  hypothetical protein B456_004G156700                    207   7e-61   
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   206   7e-61   
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kappa     207   7e-61   
gb|KJB24670.1|  hypothetical protein B456_004G156700                    207   7e-61   
emb|CAN73053.1|  hypothetical protein VITISV_015513                     207   7e-61   
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             207   8e-61   



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>gb|KDO45355.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=371

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score =   297 bits (760),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG+RE SGH VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLREPSGHAVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG+RE SGH VGVD LPEE+NDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLREPSGHAVGVDKLPEELNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   295 bits (756),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_006428242.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
 gb|ESR41482.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
Length=453

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P S +RESSGHTVGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSCVRESSGHTVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score =   295 bits (754),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RE SGH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPTSGLREPSGHNAGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>emb|CDP15204.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG+RESS H VGVD LPEEMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPTSGLRESSAHVVGVDRLPEEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEA +VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEATIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVGV P+SG+RE+S H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MGSVGVAPSSGLREASAHNAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_002512564.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50016.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=383

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 147/153 (96%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P +G+RE+SGH VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAP-TGLREASGHNVGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+VDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQ KQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQAKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVGV P+SG+RE+S H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MGSVGVAPSSGLREASVHNAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_008388444.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388445.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
 ref|XP_008388446.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=412

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  347
            MASVGV P SG+RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGVREPSGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTEXGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_008363964.1| PREDICTED: shaggy-related protein kinase alpha [Malus domestica]
Length=406

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  347
            MASVGV P SG RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGRREPSGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   284 bits (727),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>ref|NP_001269276.1| glycogen synthase kinase-3 homolog MsK-1-like [Fragaria vesca]
 ref|XP_011465886.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011465887.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Fragaria vesca subsp. vesca]
 gb|AEH02865.1| protein kinase [Fragaria vesca]
Length=412

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAV--VDGNGTEAGHIIVT  347
            MASVGV P +G+RE SGH VGVD LPEEMNDMKIRDDK+MEA V  VDGNGTE GHIIVT
Sbjct  1    MASVGVVPTAGLREPSGHAVGVDKLPEEMNDMKIRDDKEMEATVTVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   283 bits (725),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RE+  H VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNSGLREAGSHAVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG+RE+SG  VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVVPTSGLRETSGSNVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_009363099.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Pyrus x 
bretschneideri]
Length=409

 Score =   289 bits (740),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+RE SG+ VGVD+LP EMNDMKIRDDK+MEA VV+GNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPSGNAVGVDNLPNEMNDMKIRDDKEMEATVVNGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLRHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG R+S+GH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGLAPTSGARDSTGHASGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
             DHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  FDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_009366055.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
 ref|XP_009366056.1| PREDICTED: shaggy-related protein kinase alpha-like [Pyrus x 
bretschneideri]
Length=412

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHIIVT  347
            MASVGV P S  RE SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSSRREPSGHVVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_012088843.1| PREDICTED: shaggy-related protein kinase alpha [Jatropha curcas]
 gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 146/153 (95%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P +G+RE+SGH  GVD LPEEMN+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAP-TGLREASGHNAGVDKLPEEMNEMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|KJB49765.1| hypothetical protein B456_008G136600 [Gossypium raimondii]
Length=409

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+G+ P SG+RE SG+ VGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASIGMAPTSGLREPSGNAVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KHG00969.1| Glycogen synthase kinase-3 MsK-3 [Gossypium arboreum]
Length=409

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+G+ P SG+RE SG+ VGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASIGMAPTSGLREPSGNAVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+R++ G+T GVD LPEEMNDMKI DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPASGLRDTLGNTTGVDKLPEEMNDMKISDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+ H +GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTTHAIGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|ABB55385.1| Ser/Thr protein kinase-like [Solanum tuberosum]
Length=409

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESSGH  GVD LPEEMNDM+IRDDK+MEAA+V G GTE GHIIVTTI
Sbjct  1    MASVGLAPTSGLRESSGHNAGVDRLPEEMNDMRIRDDKEMEAAMVAGIGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>gb|KJB45480.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=332

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>ref|XP_008343189.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Malus 
domestica]
Length=372

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+RE  G+ VGVD+LP EMNDMKIRDDK+M A VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPGGNAVGVDNLPNEMNDMKIRDDKEMGATVVDGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLRHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + PASG+RE +G+TVGVD LP+EMNDMKIRDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVSIAPASGLREPNGNTVGVDRLPDEMNDMKIRDDKEMEDTVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_009335521.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335522.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
 ref|XP_009335523.1| PREDICTED: shaggy-related protein kinase alpha [Pyrus x bretschneideri]
Length=414

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 148/157 (94%), Gaps = 4/157 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRE--SSGHTVGVDSLPEEMNDMKIRDDKDMEA--AVVDGNGTEAGHII  341
            MASVGV P SG+RE  +SGH VGVD LPEEMNDMKIRDDK+ME+  AVVDGNGTE GHII
Sbjct  1    MASVGVAPTSGVREPCASGHAVGVDKLPEEMNDMKIRDDKEMESTVAVVDGNGTETGHII  60

Query  342  VTTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  521
            VTTIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ
Sbjct  61   VTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ  120

Query  522  TMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            TMRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  TMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  157



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+ H  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPIPGARDSTAHASGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_006841582.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1 [Amborella 
trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score =   287 bits (734),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PA+G RE SG T+GVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPATGFRELSGSTMGVDKLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_007051226.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 ref|XP_007051227.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95383.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOX95384.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=409

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P SG+RE SG+TVGVD LP+EMNDMKIRDDK++EA +VDGNGTE GHIIVTTI
Sbjct  1    MASVSIVPTSGLREPSGNTVGVDRLPDEMNDMKIRDDKEVEATIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 144/153 (94%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV PA G RE SGH  GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPA-GAREPSGHAAGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  152



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVGV P SG +ES G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFKESLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+RE  G+  GVD+LP EMNDMKIRDDK+MEA VV+GNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPXGNAAGVDNLPNEMNDMKIRDDKEMEATVVNGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLRHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_008353866.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
 ref|XP_009367184.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
 ref|XP_009367186.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Pyrus 
x bretschneideri]
Length=409

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+RE  G+ VGVD+LP EMNDMKIRDDK+M A VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGLREPGGNAVGVDNLPNEMNDMKIRDDKEMGATVVDGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLRHCFFSTTEKDELYLNLVLEYVPE  153



>sp|Q40518.1|MSK1_TOBAC RecName: Full=Shaggy-related protein kinase NtK-1 [Nicotiana 
tabacum]
 emb|CAA54803.1| shaggy like protein kinase [Nicotiana tabacum]
 prf||2106142A Ser/Thr protein kinase
Length=409

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVG+ P SG+RESS H+VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTTI
Sbjct  1    MTSVGLAPVSGLRESSSHSVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDE+YLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDEVYLNLVLEYVPE  153



>gb|ERN02393.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
Length=356

 Score =   283 bits (725),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+PPAS +R+S+G  +GVD LPEE+N+MKI+DDK+MEA VVDGNGTE G IIVTTI
Sbjct  1    MASVGLPPASAVRKSNGSAIGVDKLPEEINEMKIKDDKEMEANVVDGNGTETGQIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQ ISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQNISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTTDKDELYLNLV+EYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTDKDELYLNLVMEYVPE  153



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   285 bits (729),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPIPGARDSTAQATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_007221484.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
 gb|EMJ22683.1| hypothetical protein PRUPE_ppa006462mg [Prunus persica]
Length=410

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+R+ SG+ VGVDSLP  MNDMKIRD+K+MEA +VDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGIRDPSGNVVGVDSLPSGMNDMKIRDEKEMEATIVDGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTT KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTGKDELYLNLVLEYVPE  153



>ref|NP_001242661.1| glycogen synthase kinase-3 [Glycine max]
 gb|ACU18223.1| unknown [Glycine max]
Length=410

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH   GVD LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  1    MTSVGVAPTSGLREASGHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKC ETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCSETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_008227813.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Prunus mume]
Length=410

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+R+ SG+  GVDSLP  MNDMKIRD+K+MEA +VDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASGIRDPSGNVAGVDSLPSGMNDMKIRDEKEMEATIVDGNGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 142/153 (93%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 145/153 (95%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESS  T GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TAGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>gb|KCW84977.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=293

 Score =   280 bits (717),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P S +RE SG +VGVD LPEEMN+MKIRDDK+ME  VVDGNGTEAGHIIVTTI
Sbjct  6    MASVGIAPNS-VREPSGQSVGVDRLPEEMNEMKIRDDKEMETTVVDGNGTEAGHIIVTTI  64

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  65   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  124

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFS T+KDELYLNLVLEYVPE
Sbjct  125  LDHPNVVSLKHCFFSETEKDELYLNLVLEYVPE  157



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRDDKDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHNAGVDKLPEEMNDMKIRDDKDMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCF STT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFLSTTEKDELYLNLVLEYVPE  153



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRDDKDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHNAGVDKLPEEMNDMKIRDDKDMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCF STT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFLSTTEKDELYLNLVLEYVPE  153



>ref|XP_003555781.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Glycine max]
 ref|XP_006605787.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Glycine max]
 ref|XP_006605788.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Glycine max]
 ref|XP_006605789.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Glycine max]
Length=426

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            M SVGV P SG+RE+SGH     D LPEEMNDMKIRDD++MEA VVDGNGTE GHIIVTT
Sbjct  17   MTSVGVAPTSGLREASGHGAAAADRLPEEMNDMKIRDDREMEATVVDGNGTETGHIIVTT  76

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  77   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  136

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  137  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  170



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG+RE+  H  GVD LPEEMNDMKIRD+KDMEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPTSGLREAGVHDAGVDKLPEEMNDMKIRDEKDMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+R++ G+T G+D LP+EMN MKI DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPASGLRDTRGNTTGIDKLPDEMNGMKISDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_011622016.1| PREDICTED: shaggy-related protein kinase epsilon [Amborella trichopoda]
Length=409

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+PPAS +R+S+G  +GVD LPEE+N+MKI+DDK+MEA VVDGNGTE G IIVTTI
Sbjct  1    MASVGLPPASAVRKSNGSAIGVDKLPEEINEMKIKDDKEMEANVVDGNGTETGQIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQ ISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQNISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTTDKDELYLNLV+EYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTDKDELYLNLVMEYVPE  153



>ref|XP_009617298.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617299.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
 ref|XP_009617301.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana tomentosiformis]
Length=409

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVG+ P SG+RESS H VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTT 
Sbjct  1    MTSVGLAPVSGLRESSSHNVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTT  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDE+YLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDEVYLNLVLEYVPE  153



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P SG+R+  G+  GVD LP+EMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVAPTSGIRDPGGNAAGVDRLPDEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASV V PASG+ RESSG+  GVD LP+EMNDMKIRD+K++EA +VDGNGTE GHIIVTT
Sbjct  1    MASVSVVPASGVVRESSGNAAGVDRLPDEMNDMKIRDEKEVEATIVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 144/153 (94%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+RESS  T  V+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMVPTSGLRESS--TASVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P SG+R+ +G+  G D LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSMAPPSGLRDPTGNAGGADRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + PASG++E SG+ VGVD LPEEMN MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSIVPASGVKEPSGNCVGVDKLPEEMNGMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+SGM+ +SG  VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGMKNTSGTHVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PA G+R+ + ++ GVD LP+EMNDM+IRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVSVVPAPGLRDRNRNSTGVDKLPDEMNDMRIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_006444574.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57814.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
Length=354

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 142/153 (93%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>gb|KDO86864.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=354

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 142/153 (93%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + PASG++E SG+ VGVD LPEEMN MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  26   MASVSIVPASGVKEPSGNCVGVDKLPEEMNGMKIRDDKEMEATVVDGNGTETGHIIVTTI  85

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  86   GGRNGQPKQTISYMAERVVGNGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  145

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  146  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  178



>emb|CAN64359.1| hypothetical protein VITISV_041427 [Vitis vinifera]
Length=442

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G+PPAS + + SG+T+ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIPPASAVGKPSGNTMFVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 142/153 (93%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG+R+ SG  +GVD LPEEMNDMKIRDDKDME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVVPTSGIRDPSG--LGVDRLPEEMNDMKIRDDKDMEPTVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR 
Sbjct  59   GGKNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRP  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  119  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  151



>ref|XP_004148581.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Cucumis 
sativus]
Length=409

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SV V PAS +R+  G T+GVD LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MTSVSVAPASMIRDHGGSTIGVDRLPDEMNDMKIRDDKEIEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_011087526.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
 ref|XP_011087527.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X1 [Sesamum 
indicum]
Length=409

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG  P+SG+RESS H VG+DSLP+EMNDMKIRD+KD+EA +VDGNGTE GH+IVT+I
Sbjct  1    MASVGTAPSSGLRESSSHAVGMDSLPDEMNDMKIRDEKDIEATLVDGNGTETGHVIVTSI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLE GETVAIKKVLQDKRYKNRELQTM L
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLENGETVAIKKVLQDKRYKNRELQTMCL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFS T++DELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSPTEEDELYLNLVLEYVPE  153



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+S M+ +SG +VGVD LP+EMN+MKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSRMKNTSGTSVGVDRLPDEMNEMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P S +RES+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMAPTSVLRESNA--AGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>ref|XP_009757512.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
 ref|XP_009757513.1| PREDICTED: shaggy-related protein kinase NtK-1 [Nicotiana sylvestris]
Length=409

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVG+ P SG+RESS H+VGVD LPEEMNDM+IRDDK++EAA+VDGNGTE GHIIVTT 
Sbjct  1    MTSVGLAPVSGLRESSSHSVGVDRLPEEMNDMRIRDDKEIEAAIVDGNGTETGHIIVTTT  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCF STT+KDE+YLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFSSTTEKDEVYLNLVLEYVPE  153



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 144/154 (94%), Gaps = 5/154 (3%)
 Frame = +3

Query  174  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  116

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LLDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 144/154 (94%), Gaps = 5/154 (3%)
 Frame = +3

Query  174  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  116

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LLDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 144/154 (94%), Gaps = 5/154 (3%)
 Frame = +3

Query  174  MASVGVPP-ASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV P +SG+RESSG    VD LPEEMNDM+IRDDK+MEA VVDGNGTE GHIIVTT
Sbjct  1    MASVGVAPTSSGLRESSG----VDRLPEEMNDMRIRDDKEMEATVVDGNGTETGHIIVTT  56

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  57   IGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  116

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LLDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M S+GVPPASG+R+ S    G+D LP+EMN+MK+RDDKDME AV+DGNGTE GHIIVTTI
Sbjct  1    MTSLGVPPASGVRDPSRKAGGLDKLPDEMNEMKLRDDKDMEPAVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  153



>gb|AES82237.2| glycogen synthase kinase [Medicago truncatula]
Length=373

 Score =   278 bits (712),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  122  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_006444573.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006444575.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 ref|XP_006492384.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like isoform 
X1 [Citrus sinensis]
 gb|ESR57813.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|ESR57815.1| hypothetical protein CICLE_v10020852mg [Citrus clementina]
 gb|KDO86860.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86861.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86862.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
 gb|KDO86863.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=403

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 142/153 (93%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG      +TVGVD LPEEMNDMKIRDDK+MEA VVDGNGTEAGHIIVTTI
Sbjct  1    MASVSVVPASG------NTVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTEAGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  55   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRES--SGHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  344
            MASVG+ P  G R+S  S H   GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTSAHAATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  156



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 143/153 (93%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P S +RE SG +VGVD LPEEMN+MKIRDDK+ME  VVDGNGTEAGHIIVTTI
Sbjct  6    MASVGIAPNS-VREPSGQSVGVDRLPEEMNEMKIRDDKEMETTVVDGNGTEAGHIIVTTI  64

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  65   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  124

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFS T+KDELYLNLVLEYVPE
Sbjct  125  LDHPNVVSLKHCFFSETEKDELYLNLVLEYVPE  157



>ref|XP_010070081.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070082.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070083.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070084.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070085.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070086.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070087.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010070088.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Eucalyptus grandis]
Length=412

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGVP ASG+R++SG+ +G   LPEEMNDMKIRD+++MEA V+DGNGTE GHIIVTTI
Sbjct  1    MASVGVPRASGLRDTSGYALGAHRLPEEMNDMKIRDEREMEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFST++KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVFLKHCFFSTSEKDELYLNLVLEYVPE  153



>emb|CAA48472.1| protein kinase [Medicago sativa]
Length=412

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +VGV+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  122  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>sp|P51139.2|MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3 [Medicago 
sativa]
Length=411

 Score =   279 bits (714),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +VGV+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVGVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010070089.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Eucalyptus grandis]
 gb|KCW58654.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58655.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58656.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58657.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
 gb|KCW58658.1| hypothetical protein EUGRSUZ_H01313 [Eucalyptus grandis]
Length=409

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGVP ASG+R++SG+ +G   LPEEMNDMKIRD+++MEA V+DGNGTE GHIIVTTI
Sbjct  1    MASVGVPRASGLRDTSGYALGAHRLPEEMNDMKIRDEREMEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFST++KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVFLKHCFFSTSEKDELYLNLVLEYVPE  153



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 4/153 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  116

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  149



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 4/153 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  116

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  149



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 142/153 (93%), Gaps = 4/153 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  57   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  116

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  149



>ref|XP_012082965.1| PREDICTED: shaggy-related protein kinase alpha-like [Jatropha 
curcas]
 gb|KDP28311.1| hypothetical protein JCGZ_14082 [Jatropha curcas]
Length=409

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P SG+RE SG+T G D LP+EMNDMKIRD+K+MEA VVD NGTE GHIIVTTI
Sbjct  1    MASVSVVPTSGLREPSGNTAGADKLPDEMNDMKIRDEKEMEATVVDDNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NG  KQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGNAKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010941497.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M+S+ + P+S ++ +SG+ + VD LP+EMNDMKIRDDK++EAAV+DGNGTE GHIIVTTI
Sbjct  1    MSSLSMAPSSRLKNTSGNGIAVDRLPDEMNDMKIRDDKEVEAAVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|ACJ85178.1| unknown [Medicago truncatula]
Length=384

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  122  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESS--GHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  344
            MASVG+ P  G R+S+   H   GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTTAHAATGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  156



>ref|XP_003626019.1| Protein kinase, putative [Medicago truncatula]
Length=411

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|AFK38277.1| unknown [Medicago truncatula]
 gb|AES82238.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  2    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  122  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_010038314.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 ref|XP_010038315.1| PREDICTED: shaggy-related protein kinase alpha-like [Eucalyptus 
grandis]
 gb|KCW50138.1| hypothetical protein EUGRSUZ_K03568 [Eucalyptus grandis]
Length=409

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P SG+R+ +G+TV  D LP+EMNDMKIRD+KDMEAAVV+GNG EAGHIIVTTI
Sbjct  1    MASVSMVPVSGLRDPTGNTVAFDRLPDEMNDMKIRDEKDMEAAVVNGNGAEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERAVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            L+HPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LEHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M+S  V  +SGM+ +SG +VG+D LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MSSASVVTSSGMKNASGTSVGMDRLPDEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>dbj|BAD95892.1| Ser/Thr protein kinase [Lotus japonicus]
Length=412

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH--TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNG-TEAGHIIV  344
            MASVGV P SG+RE+SG     GVD LPEEMNDMKIRDD++MEA VVDGN  TE GHIIV
Sbjct  1    MASVGVAPTSGVREASGCHGAAGVDRLPEEMNDMKIRDDREMEATVVDGNDVTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  156



>ref|XP_008450520.1| PREDICTED: shaggy-related protein kinase NtK-1 [Cucumis melo]
Length=409

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NG  KQTISYMAER VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_004135570.1| PREDICTED: shaggy-related protein kinase alpha [Cucumis sativus]
Length=409

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NG  KQTISYMAER VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 143/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESS--GHTV-GVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIV  344
            MASVG+ P  G R+S+   H   GV+ LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIV
Sbjct  1    MASVGIAPIPGARDSTTTAHAATGVEKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  156



>ref|XP_003626020.1| Protein kinase, putative [Medicago truncatula]
Length=451

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS GV PASG  + +  +V V+ LPEEMNDMKIRDDK+MEAA +VDGNGTE GHIIVTT
Sbjct  1    MASGGVAPASGFIDKNASSVAVEKLPEEMNDMKIRDDKEMEAATIVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   276 bits (707),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +RES+G+   VD LPEEM DMKI+DDK+MEA VV+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRESTGNVTDVDRLPEEMKDMKIQDDKEMEATVVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   276 bits (707),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+PPAS + + SG+T+ VD LPEE+N+MKIRDDK   +MEA VVDGNGTE GHIIV
Sbjct  1    MASAGIPPASAVGKPSGNTMFVDKLPEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPN+VSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNIVSLKHCFFSTTDKDELYLNLVLEYVPE  156



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score =   275 bits (702),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_003591238.1| Glycogen synthase kinase [Medicago truncatula]
 gb|AES61489.1| glycogen synthase kinase [Medicago truncatula]
 gb|AFK45213.1| unknown [Medicago truncatula]
Length=411

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVGV P SG +ES G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFKESLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_011466950.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011466953.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V PASG+R+ SG+TV +DSLP EMNDMKIRDDK+ME  VV+GN TE GHIIVTTI
Sbjct  1    MASVSVAPASGLRDRSGNTVALDSLPNEMNDMKIRDDKEMEGTVVNGNSTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NG  KQTISYMAER VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGLLKQTISYMAERAVGHGSFGLVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPN+VSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNIVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>sp|P51137.1|MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1 [Medicago 
sativa]
 emb|CAA48474.1| protein kinase [Medicago sativa]
Length=411

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDS-LPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVGV P SG RE  G   +GVD  LPEEM+DMKIRDD++MEA VVDGNGTE GHIIVT
Sbjct  1    MASVGVAPTSGFREVLGDGEIGVDDILPEEMSDMKIRDDREMEATVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 3/154 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P S +RES+    GVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGMAPTSVLRESNA--AGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  58

Query  354  GGQNGQPKQ-TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            GG+NGQPKQ TISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  59   GGRNGQPKQQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  118

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_010938176.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS  V  ASGM+ + G +VGVD LP+EMNDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASASVVTASGMKNAGGTSVGVDRLPDEMNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTI YMAER+VGHGSFG+VFQAKCLET ETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTIRYMAERVVGHGSFGIVFQAKCLETSETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_006408022.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49475.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=410

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|NP_187235.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 ref|NP_850520.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 sp|P43289.1|KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma; AltName: Full=ASK-gamma 
[Arabidopsis thaliana]
 gb|AAF26086.1|AC012393_12 shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 emb|CAA53180.1| ASK-gamma (Arabidopsis shaggy-related kinase) [Arabidopsis thaliana]
 emb|CAA73247.1| shaggy-like kinase gamma [Arabidopsis thaliana]
 gb|AAL32791.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 gb|AAM13346.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 dbj|BAE99095.1| shaggy related protein kinase [Arabidopsis thaliana]
 dbj|BAH19402.1| AT3G05840 [Arabidopsis thaliana]
 gb|AEE74303.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 gb|AEE74304.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
Length=409

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +RES+G+    D LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRESTGNVTDADRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_006588497.1| PREDICTED: uncharacterized protein LOC100817819 isoform X1 [Glycine 
max]
Length=409

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV PASG+R+ + ++V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPASGVRDVNANSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 139/153 (91%), Gaps = 10/153 (7%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV PASG          VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGVAPASG----------VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  50

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  51   GGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  110

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  111  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  143



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 3/153 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV +PP  G R+S   T G+D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVPGARDS---TTGLDKLPEEMNDMKLRDDKEMEPIVVDGNGTETGHIIVTTI  57

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  117

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
             DHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  118  FDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+S+G+   VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSTGNVTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G+ P S + +S+ +++ VD LPEE+N+MKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGIAPPSAVGKSTDNSMSVDKLPEEINEMKIRDDKEMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKEELYLNLVLEYVPE  153



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 139/153 (91%), Gaps = 3/153 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV +PP  G R+S   T G+D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVHGARDS---TTGLDKLPEEMNDMKLRDDKEMEPVVVDGNGTETGHIIVTTI  57

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  117

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
             DHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  118  FDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_008778092.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008778093.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+ +  +SG++ +SG+ + VD LP+EMNDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASLRITLSSGLKNASGNNIAVDRLPDEMNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPK+TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKRTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_003518657.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Glycine 
max]
Length=409

 Score =   274 bits (700),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV PASG+R+ +  +V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASAGVAPASGVRDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_008812956.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Phoenix 
dactylifera]
Length=409

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+ +  +SG++ ++ ++V VD LP+EMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASLSMARSSGLKNTNVNSVAVDRLPDEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 139/153 (91%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG        VGVD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPISG------EAVGVDRLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  55   GGRSGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>ref|XP_004494455.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3-like [Cicer 
arietinum]
Length=385

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAA-VVDGNGTEAGHIIVTT  350
            MAS  V PA+G  + +  + GV+ LPEEMNDMKIRDDK+MEAA VVDGNGTE GHIIVTT
Sbjct  1    MASGVVVPATGFTDKNASSGGVEKLPEEMNDMKIRDDKEMEAATVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV +PP  G R+S   T  +D LPEEMNDMK+RDDK+ME  VVDGNGTE GHIIVTTI
Sbjct  1    MASVAIPPVHGARDS---TTSLDKLPEEMNDMKLRDDKEMEPIVVDGNGTETGHIIVTTI  57

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  58   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  117

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
             DHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  118  FDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_009134851.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+VGV P++ +RES+G+ T  VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRESNGNVTADVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>dbj|BAJ34573.1| unnamed protein product [Thellungiella halophila]
Length=409

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+++G+   VD LPEEMNDMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAPVRDTAGNATDVDRLPEEMNDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LD PNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDRPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 140/153 (92%), Gaps = 7/153 (5%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV +PP    R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGN TE GHIIVTTI
Sbjct  1    MASVSIPPP---RDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNSTETGHIIVTTI  53

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  54   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  113

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  114  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  146



>ref|XP_009383704.1| PREDICTED: shaggy-related protein kinase alpha [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P+S ++ + G ++ VDSLP+E+NDMKIRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASVSMAPSSELKNNDGTSICVDSLPDELNDMKIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR+
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRI  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+S+G+    D LPEE+ DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSTGNATDADRLPEELKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|KHN00229.1| Glycogen synthase kinase-3 like MsK-3 [Glycine soja]
Length=585

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV PASG+R+ +  +V V+ LP+EMN MKIRD+++MEA VVDGNGTE GHIIVTTI
Sbjct  177  MASAGVAPASGVRDVNASSVAVERLPDEMNGMKIRDEREMEATVVDGNGTETGHIIVTTI  236

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG+GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  237  GGKNGQPKQTISYMAERVVGNGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  296

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  297  LDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPE  329



>emb|CDY49981.1| BnaC03g34380D [Brassica napus]
 emb|CDX74129.1| BnaA03g29180D [Brassica napus]
Length=411

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 144/154 (94%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+VGV P++ +R+S+G+ T  VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRDSNGNVTADVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_009384996.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+ +PP+S +++++G +V VD+LP  MN MKI+DDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASISLPPSSRLKDTTGSSVSVDTLPHAMNVMKIKDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETVETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+K+ELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKEELYLNLVLEYVPE  153



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVG  PAS M  ++S+      D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQSNASICAADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_010679446.1| PREDICTED: shaggy-related protein kinase NtK-1 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG+++  G+   +D LP+EMNDMKIR+DK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPTSGLKDPGGNVGAIDKLPDEMNDMKIREDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQ KQT+SYMAERIVG GSFGVVFQA+CLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQAKQTVSYMAERIVGQGSFGVVFQARCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNV SLKHCFFSTT KDELYLNLVLE+VPE
Sbjct  121  LDHPNVTSLKHCFFSTTGKDELYLNLVLEFVPE  153



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+ G+R+    T  +D LP+EMN+MK+RD+KDME AVVDGNGTE GHIIVTTI
Sbjct  1    MASVSVAPSLGVRDPGRKTGSLDRLPDEMNEMKLRDEKDMEPAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  153



>gb|ABG74911.1| AtSK12-like protein [Brassica napus]
Length=410

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGH-TVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+VGV P++ +RES+G+ T  VD LPEE N MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRESNGNVTADVDRLPEETNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010432712.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=407

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 2/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P++ +R+SS  T  VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASVGIEPSAAVRDSS--TTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  58

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  59   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  118

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  151



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   269 bits (687),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVG  PAS M  ++++      D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQTNASVCAADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_009384446.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384447.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384448.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P+SG++ +SG ++G+D LP+EM+DMKIRDDK++EA V++G GTEAGHIIVTTI
Sbjct  1    MASVNMVPSSGLKNTSGTSLGMDKLPQEMSDMKIRDDKEVEATVINGKGTEAGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G+NGQPKQT+SYMAER VGHGSFGVVFQAKCLETGE+VAIKKVLQDKRYKNRELQTMRL
Sbjct  61   NGKNGQPKQTVSYMAERAVGHGSFGVVFQAKCLETGESVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNV+ LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVIYLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_010248490.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248491.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
 ref|XP_010248492.1| PREDICTED: shaggy-related protein kinase epsilon [Nelumbo nucifera]
Length=408

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G+ P S + +  G+++ VD LPEE+N+MKIRDDK+MEA VVD NGTE GHIIVTTI
Sbjct  1    MASAGIAP-SAVGKPDGNSMSVDKLPEEINEMKIRDDKEMEATVVDENGTETGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 139/153 (91%), Gaps = 6/153 (4%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV +PP     +S+G   GVD LPEEMNDMKIRDDK+MEA VVDGN TE GHIIVTTI
Sbjct  1    MASVSIPPPI---DSTG---GVDKLPEEMNDMKIRDDKEMEATVVDGNSTETGHIIVTTI  54

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  55   GGRNGQPKQTISYMAERVVGQGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  114

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  115  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  147



>ref|XP_010464137.1| PREDICTED: shaggy-related protein kinase gamma [Camelina sativa]
Length=410

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESS-GHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG+ P++ +R+SS G+   VD LP+EM DMKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MASVGIDPSAAVRDSSTGNATDVDRLPDEMKDMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010486058.1| PREDICTED: shaggy-related protein kinase gamma-like [Camelina 
sativa]
Length=408

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 142/153 (93%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+G+ P++ +R+SS  T  VD LPEEM DMKI+DDK+MEA +V+GN TE GHIIVTTI
Sbjct  1    MASLGIEPSAAVRDSST-TTDVDRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  60   GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_009401663.1| PREDICTED: shaggy-related protein kinase gamma [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV V P+SG++ +SG +V VD LPEEM+DM+IR+DK++EA V++GNGTE GHIIVTTI
Sbjct  1    MASVSVVPSSGLKNTSGTSVRVDKLPEEMSDMRIREDKEVEATVINGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G+ GQPKQT+SYMAER+VGHGSFG+VFQAKCLETGETVAIKKV+QDKRYKNRELQTM L
Sbjct  61   NGKKGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVIQDKRYKNRELQTMHL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNV+SLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVISLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MA+V V  ++G+R+ S    G+D LP+EMN+MK+RDDKD+E AVVDGNGTE GHIIVTTI
Sbjct  1    MAAVSVSSSTGVRDPSNKPGGLDRLPDEMNEMKLRDDKDIEPAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDELFLNLVLEYVPE  153



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG  PAS M  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG  PAS M  + S  ++  D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KD+LYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDDLYLNLVLEYVPE  154



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG  PAS M  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSMATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGVPPASGM--RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVG  PAS M  ++S+      D LPE +++MKI+DDK+MEAAVVDGNGTE GHIIVT
Sbjct  1    MASVGTLPASSMATKQSNASICPADKLPEGIDEMKIKDDKEMEAAVVDGNGTETGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            TIGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   TIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            RLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  RLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>emb|CDY05202.1| BnaC05g46010D [Brassica napus]
Length=410

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVG-VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+VGV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATVGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG  P+S   + +  ++  D LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGTLPSSMTTKQNNASICADKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_009334099.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334100.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
 ref|XP_009334101.1| PREDICTED: shaggy-related protein kinase epsilon [Pyrus x bretschneideri]
Length=410

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVG-VPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MAS G  P AS ++   G  +  D LPEE+NDMKI+D+K++EAAVV+GNGTE GHIIVTT
Sbjct  1    MASAGTAPAASAVKNRGGSAMFADKLPEEINDMKIKDEKEIEAAVVNGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  154



>ref|XP_009382471.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382472.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=409

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASV + P S ++ +S  +VG+D LP+EM+DMKIRDDK++EA V+DGNGTE GHIIVTT+
Sbjct  1    MASVSLVPPSRLKITSSTSVGMDRLPDEMSDMKIRDDKEVEATVIDGNGTETGHIIVTTV  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G NGQPKQT+SYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   NGINGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDELYLNLVLEYVPE  153



>gb|AAB61055.1| Similar to shaggy related protein kinase. Belongs to the CDC2/CDKX 
subfamily [Arabidopsis thaliana]
Length=447

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 142/172 (83%), Gaps = 23/172 (13%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P  G R+S+G    VD LPEEMNDMKIRDDK+MEA VVDGNGTE GHIIVTTI
Sbjct  1    MASVGIAPNPGARDSTG----VDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTI  56

Query  354  GGQNGQPKQ-------------------TISYMAERIVGHGSFGVVFQAKCLETGETVAI  476
            GG+NGQPKQ                   TISYMAER+VGHGSFGVVFQAKCLETGETVAI
Sbjct  57   GGRNGQPKQLVDWLVFRVFINFSTMSMQTISYMAERVVGHGSFGVVFQAKCLETGETVAI  116

Query  477  KKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            KKVLQD+RYKNRELQTMRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  117  KKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  168



>gb|KGN65982.1| hypothetical protein Csa_1G560660 [Cucumis sativus]
Length=387

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 138/153 (90%), Gaps = 3/153 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+GV   S +RE +GH VGVD LPEEMNDMKIRDDK++EA VVDGNGTE GHIIVTTI
Sbjct  1    MASMGVVSTSNLREPAGHNVGVDRLPEEMNDMKIRDDKEVEATVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NG  KQTISYMAER VGHGSFGV   AKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGYSKQTISYMAERAVGHGSFGV---AKCLETGETVAIKKVLQDKRYKNRELQTMRL  117

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  118  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  150



>ref|XP_006643997.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006643998.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=408

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 142/153 (93%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG++ SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGLKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_009147201.1| PREDICTED: shaggy-related protein kinase gamma [Brassica rapa]
Length=410

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVG-VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA++GV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  1    MATMGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  61   IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_009403747.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403755.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M S+ V P+ G+R +SG    VD LP+EM DMKIRDDK+ E  VVDGNGTE GHIIVTTI
Sbjct  1    MTSISVVPSMGLRNTSGTIGAVDRLPDEMKDMKIRDDKEAEETVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR 
Sbjct  61   GGRNGQPKQTISYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRF  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNV+S+KHCFFSTT KD+LYLNLVLEYVPE
Sbjct  121  LDHPNVISMKHCFFSTTTKDDLYLNLVLEYVPE  153



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG  P+S        +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASVGTLPSSTATRKMNDSVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  153



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG  PAS +  + S  ++  + LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPASSVATKQSNASICAEKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_006650852.1| PREDICTED: shaggy-related protein kinase alpha-like [Oryza brachyantha]
Length=409

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ PASG+R++ G ++GVDSL +EMND+KIRD+K++EA +++GNGTE GHIIVTTI
Sbjct  1    MASVGMAPASGLRDAGGTSLGVDSLHDEMNDLKIRDEKEVEATIINGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+ GQ KQTISYMAER++G GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQ MRL
Sbjct  61   GGRGGQRKQTISYMAERVIGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQMMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  153



>ref|XP_009386339.1| PREDICTED: shaggy-related protein kinase alpha-like [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS+ + P+SG +  SG  V VD LP EM+DM+IRDDK++EA V+DGNGTE GHIIVTTI
Sbjct  1    MASMSMVPSSGSKNPSGTNVDVDRLPGEMSDMRIRDDKEVEATVIDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G+NGQPKQTISYMAER+VGHGSFG VFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  61   NGRNGQPKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT KDELYLNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTQKDELYLNLVLEYVPE  153



>emb|CDM82575.1| unnamed protein product [Triticum aestivum]
Length=406

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>dbj|BAF36565.1| Shaggy-like kinase [Triticum aestivum]
Length=406

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGM-RESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG  P+S M  + +  ++ VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPSSTMATKQNNASLCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG++GQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>gb|EMT32435.1| Glycogen synthase kinase-3-MsK-3-like protein [Aegilops tauschii]
Length=435

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVGV P SG + SSG ++G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  17   MASVGVAP-SGHKNSSGTSMGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  75

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  76   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  135

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  136  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  168



>emb|CDY27737.1| BnaA05g31460D [Brassica napus]
Length=514

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVG-VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA++GV P++ +R+S+ +    VD LPEEMN MKI+DDK+MEA +V+GN TE GHIIVTT
Sbjct  104  MATMGVEPSAAVRDSTANAATDVDRLPEEMNHMKIQDDKEMEATIVNGNVTETGHIIVTT  163

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VGHGSFGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMR
Sbjct  164  IGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMR  223

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  224  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  257



>ref|XP_003566380.1| PREDICTED: shaggy-related protein kinase alpha [Brachypodium 
distachyon]
Length=408

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MASVG+ P SG + SS  ++GV+ LP++MND+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASVGIVP-SGQKNSSSTSMGVEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_004495878.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-2-like [Cicer 
arietinum]
Length=410

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MAS GV PASG+ + ++   V  D LP+E++ MKI+DDK+MEA VVDGN TEAGH+IVT 
Sbjct  1    MASAGVAPASGLIDVNTSSVVAADRLPDEIHGMKIKDDKEMEANVVDGNSTEAGHVIVTI  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVTLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS G  P S   + +  ++  D LPE +NDMKI+DDK+MEAAVVDGNGTE GHIIVTTI
Sbjct  1    MASGGTLPTSVSGKQNNASLIADKLPEGINDMKIKDDKEMEAAVVDGNGTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTISYMAERIVG GSFG+VFQAKCLETGE VAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  153



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVG-VPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVG +P ++        +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTT
Sbjct  1    MASVGTLPSSTTATRKMNDSVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG++GQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKDGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  121  LLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_009382470.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  183  VGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQ  362
            V + P S ++ +S  +VG+D LP+EM+DMKIRDDK++EA V+DGNGTE GHIIVTT+ G 
Sbjct  16   VSLVPPSRLKITSSTSVGMDRLPDEMSDMKIRDDKEVEATVIDGNGTETGHIIVTTVNGI  75

Query  363  NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  542
            NGQPKQT+SYMAER+VGHGSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH
Sbjct  76   NGQPKQTVSYMAERVVGHGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  135

Query  543  PNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            PNVV LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  136  PNVVCLKHCFFSTTEKDELYLNLVLEYVPE  165



>ref|NP_001042602.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAA92214.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAB40983.1| shaggy-related protein kinase gamma [Oryza sativa (japonica cultivar-group)]
 dbj|BAF04516.1| Os01g0252100 [Oryza sativa Japonica Group]
 dbj|BAG94276.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70327.1| hypothetical protein OsI_01196 [Oryza sativa Indica Group]
 gb|EEE54244.1| hypothetical protein OsJ_01119 [Oryza sativa Japonica Group]
Length=408

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M SVGV P SG++ SS  ++G + LP++M+D+KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MGSVGVAP-SGLKNSSSTSMGAEKLPDQMHDLKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGRNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MA+  V  +SG+R+ +    G+D LP+EMN+MK+RDDKD+E AVVDGN TE GHIIVTTI
Sbjct  1    MAATSVDSSSGVRDPTKKPGGMDRLPDEMNEMKLRDDKDIEPAVVDGNVTETGHIIVTTI  60

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQTI YMAERIVG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  61   GGRNGQPKQTIGYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  120

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV LKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  121  LDHPNVVCLKHCFFSTTEKDELFLNLVLEYVPE  153



>tpg|DAA53953.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=320

 Score =   256 bits (654),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+   S + + +G+T  VD LPEE+N+MKI+D+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASTGMAATSVVGKPTGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQT
Sbjct  61   TTIGGRNGEPKQTISYMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  156



>ref|XP_003591340.1| Glycogen synthase kinase-3-like protein [Medicago truncatula]
Length=411

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  1    MATAGVAPASGLVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  121  LLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPE  154



>gb|AES61591.2| glycogen synthase kinase [Medicago truncatula]
Length=412

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  2    MATAGVAPASGLVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  122  LLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPE  155



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+   S + + +G+T  VD LPEE+N+MKI+D+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASTGMAATSVVGKPTGNTTFVDKLPEEINEMKIKDEKVEKEMEATVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQT
Sbjct  61   TTIGGRNGEPKQTISYMAERVVGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  156



>ref|XP_002455378.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
 gb|EES00498.1| hypothetical protein SORBIDRAFT_03g009580 [Sorghum bicolor]
Length=408

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++GV+ L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGFKNSSSASIGVEKLQDQMNEIKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>sp|P51138.1|MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2 [Medicago 
sativa]
 emb|CAA48473.1| protein kinase [Medicago sativa]
Length=411

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRE-SSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MA+ GV PASG+ + ++   + VD LP+E+  M+I+DDK+MEA VVDGN TEAGH+IVTT
Sbjct  1    MATAGVAPASGIVDVNASSAIAVDKLPDEILGMRIKDDKEMEAHVVDGNSTEAGHVIVTT  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER VG GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHPNVV+LKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  121  LLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPE  154



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  219  SGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMA  398
            SG+T   D LPEE+N+MKI+D+K+ME AVV+GNGTE GHIIVTTIGG+NGQPKQTISYMA
Sbjct  16   SGNTKFADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMA  75

Query  399  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  578
            ER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS
Sbjct  76   ERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  135

Query  579  TTDKDELYLNLVLEYVPE  632
            TTDKDELYLNLVLEYVPE
Sbjct  136  TTDKDELYLNLVLEYVPE  153



>tpg|DAA53950.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=373

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  219  SGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMA  398
            SG+T   D LPEE+N+MKI+D+K+ME AVV+GNGTE GHIIVTTIGG+NGQPKQTISYMA
Sbjct  16   SGNTKFADKLPEEINEMKIKDEKEMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMA  75

Query  399  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  578
            ER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS
Sbjct  76   ERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  135

Query  579  TTDKDELYLNLVLEYVPE  632
            TTDKDELYLNLVLEYVPE
Sbjct  136  TTDKDELYLNLVLEYVPE  153



>ref|XP_004967857.1| PREDICTED: shaggy-related protein kinase alpha-like [Setaria 
italica]
Length=408

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS   VG D L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKHSSSTNVGADKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>gb|AFW79696.1| putative glycogen synthase kinase family protein [Zea mays]
Length=402

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|NP_001148880.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 ref|XP_008654975.1| PREDICTED: glycogen synthase kinase-3 MsK-3 isoform X1 [Zea mays]
 gb|ACG33274.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
 gb|AFW79697.1| putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L ++MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDQMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_009598967.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
Length=410

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 141/156 (90%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGGIIPSAGGKPQTDAML-VDKLPEEINEMKIRDDKVEKEMEAAVVDGNGTEKGHIIV  59

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  119

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +RLLDHPNVVSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  IRLLDHPNVVSLRHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 141/156 (90%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGGIIPSAGGKPQTDAML-VDKLPEEINEMKIRDDKVEKEMEAAVVDGNGTEKGHIIV  59

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  119

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +RLLDHPNVVSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  IRLLDHPNVVSLRHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_008357735.1| PREDICTED: shaggy-related protein kinase epsilon [Malus domestica]
Length=410

 Score =   256 bits (653),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = +3

Query  222  GHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAE  401
            G     D LPEE+NDMKI+D+K++EAAVV+GNGTE GHIIVTTIGG+NGQPKQTISYMAE
Sbjct  18   GSAXFADKLPEEINDMKIKDEKEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTISYMAE  77

Query  402  RIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  581
            R+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST
Sbjct  78   RVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137

Query  582  TDKDELYLNLVLEYVPE  632
            TDKDELYLNLVLEYVPE
Sbjct  138  TDKDELYLNLVLEYVPE  154



>ref|NP_001150105.1| LOC100283734 [Zea mays]
 gb|ACG37853.1| glycogen synthase kinase-3 MsK-3 [Zea mays]
Length=408

 Score =   256 bits (653),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>tpg|DAA53951.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=408

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_008672929.1| PREDICTED: LOC100283734 isoform X1 [Zea mays]
Length=438

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>tpg|DAA53952.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=450

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQT+SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQTVSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_006364003.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364004.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=410

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS  + P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGCIMPSAGGKPQTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  59

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  119

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +RLLDHPNVVSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  IRLLDHPNVVSLRHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKIRDDK   +MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+
Sbjct  3    VDKLPEEINEMKIRDDKVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  62

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPN+VSLKHCFFSTTD
Sbjct  63   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNIVSLKHCFFSTTD  122

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLEYVPE
Sbjct  123  KDELYLNLVLEYVPE  137



>gb|AEN14336.1| hypothetical protein rf1-C1-g7 [Zea mays]
Length=408

 Score =   253 bits (646),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MAS GV P SG + SS  ++G + L + MN++KIRDDK++EA +++G GTE GHIIVTT 
Sbjct  1    MASAGVAP-SGYKNSSSTSIGAEKLQDHMNELKIRDDKEVEATIINGKGTETGHIIVTTT  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG+NGQPKQ +SYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL
Sbjct  60   GGKNGQPKQAMSYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVV+LKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  LDHPNVVALKHCFFSTTEKDELYLNLVLEYVPE  152



>ref|XP_004252661.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS  + P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MASGCIMPSAGGKPHTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  59

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  60   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  119

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +RLLDHPNVVSL+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  IRLLDHPNVVSLRHCFFSTTEKDELYLNLVLEYVPE  155



>emb|CBI39647.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/125 (95%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  258  MNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGHGSFGVVF  437
            MNDMKIRDDK+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+VGHGSFGVVF
Sbjct  1    MNDMKIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVF  60

Query  438  QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVL  617
            QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTT+KDELYLNLVL
Sbjct  61   QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVL  120

Query  618  EYVPE  632
            EYVPE
Sbjct  121  EYVPE  125



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKI---RDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKI   R +K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+
Sbjct  39   VDKLPEEINEMKIKGERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  158

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLE+VPE
Sbjct  159  KDELYLNLVLEFVPE  173



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKI---RDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKI   R +K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+
Sbjct  39   VDKLPEEINEMKIKGERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  158

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLE+VPE
Sbjct  159  KDELYLNLVLEFVPE  173



>emb|CAA58594.1| Petunia Shaggy kinase 4 [Petunia x hybrida]
Length=409

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 141/156 (90%), Gaps = 5/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+ P++G +  +   + VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIV
Sbjct  1    MAS-GIMPSAGGKHRTDAML-VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIV  58

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NG+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  59   TTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  118

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +RLLDHPNVV+L+HCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  IRLLDHPNVVALRHCFFSTTEKDELYLNLVLEYVPE  154



>emb|CDP02094.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS GV P S + +     + VD LPEE+N+MKI+D+K   +M+AAVVDGNGTE GHIIV
Sbjct  1    MASGGVMP-SAVGKPKIDAMLVDKLPEEINEMKIKDEKVEKEMDAAVVDGNGTETGHIIV  59

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQ+ISYMAERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  60   TTIGGKNGQPKQSISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  119

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  120  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  155



>ref|XP_004304635.1| PREDICTED: shaggy-related protein kinase epsilon [Fragaria vesca 
subsp. vesca]
Length=412

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  240  DSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGHG  419
            D LPEE+N+MKI+D+K++EAAVV+GNGTE GHIIVTTIGG+NGQPKQT+SYMAER+VG G
Sbjct  26   DKLPEEINEMKIKDEKEIEAAVVNGNGTETGHIIVTTIGGRNGQPKQTVSYMAERVVGQG  85

Query  420  SFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDEL  599
            SFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV+LKHCFFSTTDKDEL
Sbjct  86   SFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTDKDEL  145

Query  600  YLNLVLEYVPE  632
            YLNLVLEYVPE
Sbjct  146  YLNLVLEYVPE  156



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            V  LPEE+N+MKI+D+K   +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISYMAERI
Sbjct  18   VSKLPEEINEMKIKDEKVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERI  77

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD
Sbjct  78   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  137

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLEYVPE
Sbjct  138  KDELYLNLVLEYVPE  152



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score =   251 bits (641),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  201  SGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQ  380
            +G+R  +     +D LP+EMN+MKIRDDKD+E AVVDGNGTE GHIIVTTIGG+NGQPKQ
Sbjct  11   AGVRGPAKKPGCLDRLPDEMNEMKIRDDKDIEPAVVDGNGTETGHIIVTTIGGRNGQPKQ  70

Query  381  TISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSL  560
             ISYMAERIVG GSFGVVFQAKCLETGE VAIKKVLQDKRYKNRELQTMRLLDHPNVV L
Sbjct  71   KISYMAERIVGQGSFGVVFQAKCLETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVCL  130

Query  561  KHCFFSTTDKDELYLNLVLEYVPE  632
            KHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  131  KHCFFSTTEKDELFLNLVLEYVPE  154



>gb|EMT09676.1| Shaggy-related protein kinase alpha [Aegilops tauschii]
Length=418

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDKLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQ KQTISYMAER++G GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQ MRL
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQMMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  152



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 137/167 (82%), Gaps = 14/167 (8%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTV-------GVDSLPEEMNDMKIRDDK-------DMEAAVVD  311
            MAS  V P   +R S+   V       GVD LPEEM++MKIRDDK       ++EA VVD
Sbjct  1    MASASVGPVGAIRGSTSAIVVSKVGGSGVDQLPEEMHEMKIRDDKTDHSDDKELEATVVD  60

Query  312  GNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQ  491
            GNGTE GHII TTIGG+NGQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQ
Sbjct  61   GNGTETGHIIATTIGGRNGQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQ  120

Query  492  DKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            DKRYKNRELQ MRLLDHPN+V+LKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  121  DKRYKNRELQIMRLLDHPNIVALKHCFFSTTDKDELYLNLVLEYVPE  167



>ref|XP_011097427.1| PREDICTED: shaggy-related protein kinase epsilon-like [Sesamum 
indicum]
Length=407

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKI+D+K   +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISYMAERI
Sbjct  18   VDKLPEEINEMKIKDEKVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERI  77

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLE+GETVAIKKVLQDKRYKNRELQTMRLLDHPNVV LKHCFFSTTD
Sbjct  78   VGQGSFGIVFQAKCLESGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKHCFFSTTD  137

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLEYVPE
Sbjct  138  KDELYLNLVLEYVPE  152



>dbj|BAJ99594.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDRLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQ KQTISYMAER++G GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQ MRL
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQMMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  152



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKIRDDK   +MEAAVVDGNGTE GHIIVTTIGG+NG+PKQTISYMAER+
Sbjct  3    VDKLPEEINEMKIRDDKAEKEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYMAERV  62

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT+RLLDHPNVVSL+HCFFSTT+
Sbjct  63   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTIRLLDHPNVVSLRHCFFSTTE  122

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLEYVPE
Sbjct  123  KDELYLNLVLEYVPE  137



>gb|EYU34725.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=410

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 6/138 (4%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDK------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMA  398
            V  LPEE+N+MKI+D+K      +MEAAVVDGNGTE GHIIVTTIGG+NGQPKQTISYMA
Sbjct  18   VSKLPEEINEMKIKDEKVEKVEIEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMA  77

Query  399  ERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  578
            ERIVG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS
Sbjct  78   ERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFS  137

Query  579  TTDKDELYLNLVLEYVPE  632
            TTDKDELYLNLVLEYVPE
Sbjct  138  TTDKDELYLNLVLEYVPE  155



>ref|XP_011087528.1| PREDICTED: shaggy-related protein kinase alpha isoform X2 [Sesamum 
indicum]
Length=388

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGH  416
            +DSLP+EMNDMKIRD+KD+EA +VDGNGTE GH+IVT+IGG+NGQPKQTISYMAER+VGH
Sbjct  1    MDSLPDEMNDMKIRDEKDIEATLVDGNGTETGHVIVTSIGGRNGQPKQTISYMAERVVGH  60

Query  417  GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDE  596
            GSFGVVFQAKCLE GETVAIKKVLQDKRYKNRELQTM LLDHPNVVSLKHCFFS T++DE
Sbjct  61   GSFGVVFQAKCLENGETVAIKKVLQDKRYKNRELQTMCLLDHPNVVSLKHCFFSPTEEDE  120

Query  597  LYLNLVLEYVPE  632
            LYLNLVLEYVPE
Sbjct  121  LYLNLVLEYVPE  132



>gb|EMS62368.1| Shaggy-related protein kinase alpha [Triticum urartu]
Length=455

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 139/153 (91%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            M S GV PASG+R++ G +  VD LP+E+++M+I D+K++EA +++GNGTEAGHIIVTTI
Sbjct  1    MTSFGVAPASGLRDAGGSS-EVDKLPDEISNMRISDEKEVEATIINGNGTEAGHIIVTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
            GG++GQ KQTISYMAER++G GSFGVVFQAKCLET ETVAIKKVLQDKRYKNRELQ MRL
Sbjct  60   GGRDGQRKQTISYMAERVIGQGSFGVVFQAKCLETSETVAIKKVLQDKRYKNRELQMMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTT+KDEL+LNLVLEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTEKDELFLNLVLEYVPE  152



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 138/173 (80%), Gaps = 20/173 (12%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTV-----------------GVDSLPEEMNDMKI---RDDKDM  293
            M S G+ PAS + +  G  V                  VD LPEE+N+MKI   R +K+M
Sbjct  1    MYSTGMAPASAVAKPDGDDVMIVDKLPAKPDDDDDAMPVDKLPEEINEMKIKGERVEKEM  60

Query  294  EAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVA  473
            EA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVA
Sbjct  61   EATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVA  120

Query  474  IKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            IKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLE+VPE
Sbjct  121  IKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEFVPE  173



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDD---KDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            VD LPEE+N+MKI+D+   K+MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+
Sbjct  39   VDKLPEEINEMKIKDERVEKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERV  98

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD
Sbjct  99   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  158

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLE+VPE
Sbjct  159  KDELYLNLVLEFVPE  173



>emb|CBI37005.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +3

Query  258  MNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGHGSFGVVF  437
            MNDMKIRDDK+ME  VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+VGHGSFGVVF
Sbjct  1    MNDMKIRDDKEMEDTVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVF  60

Query  438  QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVL  617
            QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTT+K+ELYLNLVL
Sbjct  61   QAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKEELYLNLVL  120

Query  618  EYVPE  632
            EYVPE
Sbjct  121  EYVPE  125



>ref|XP_008443540.1| PREDICTED: shaggy-related protein kinase epsilon [Cucumis melo]
Length=410

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+ P    +  SG  +  D LPE +N+MKIRD+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASSGMGPVG--KPGSGVALFADKLPEGINEMKIRDEKVEKEMEATVVDGNGTETGHIIV  58

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQ KQTISYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  59   TTIGGRNGQSKQTISYMAERTVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  118

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>emb|CDX78658.1| BnaA03g05700D [Brassica napus]
Length=568

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  189  VPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNG  368
            +P  S    ++G +V VD LPE +N+MKI+DDK+MEAAVVDGNGTE GHIIVTTIG ++G
Sbjct  83   LPSTSPTTHNNG-SVCVDKLPEGINEMKIKDDKEMEAAVVDGNGTETGHIIVTTIGCKDG  141

Query  369  QPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPN  548
            QPKQTISYMAER+V  GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPN
Sbjct  142  QPKQTISYMAERVVEQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPN  201

Query  549  VVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            VVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  202  VVSLKHCFFSTTEKDELYLNLVLEYVPE  229



>ref|XP_007140965.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
 gb|ESW12959.1| hypothetical protein PHAVU_008G156000g [Phaseolus vulgaris]
Length=402

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIVGH  416
            V+ LPEE+N+MKI+D+K+M+ A+VDGNGTE G IIVTTIGG+ GQPKQTISYMAERIVG 
Sbjct  15   VEKLPEEINEMKIKDEKEMDTAMVDGNGTETGRIIVTTIGGRLGQPKQTISYMAERIVGQ  74

Query  417  GSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDE  596
            GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDE
Sbjct  75   GSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDKDE  134

Query  597  LYLNLVLEYVPE  632
            LYLNLVLEYVPE
Sbjct  135  LYLNLVLEYVPE  146



>ref|XP_004141099.2| PREDICTED: shaggy-related protein kinase epsilon [Cucumis sativus]
 gb|KGN59685.1| hypothetical protein Csa_3G838640 [Cucumis sativus]
Length=410

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G+ P    +  SG  +  D LPE +N+MKIRD+K   +MEA VVDGNGTE GHIIV
Sbjct  1    MASSGMGPVG--KPGSGVALFADKLPEGINEMKIRDEKVEKEMEATVVDGNGTETGHIIV  58

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQ +QTISYMAER VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  59   TTIGGRNGQSRQTISYMAERPVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  118

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLEYVPE
Sbjct  119  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE  154



>ref|XP_004232308.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
 ref|XP_010316289.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=410

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 9/154 (6%)
 Frame = +3

Query  198  ASG--MRESSGHTVG----VDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTT  350
            ASG  M  ++G  +     +D+LP+E+N MKI DDK+   MEAAVVDGNGTE GHIIVTT
Sbjct  2    ASGSIMSSAAGKPITDVVLIDNLPKEINAMKINDDKEGKEMEAAVVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHP++VSLKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  122  LLDHPSIVSLKHCFFSTTEKDELYLNLVLEFVPE  155



>ref|XP_010108792.1| Shaggy-related protein kinase epsilon [Morus notabilis]
 gb|EXC20307.1| Shaggy-related protein kinase epsilon [Morus notabilis]
Length=1931

 Score =   259 bits (663),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDK---DMEAAVVDGNGTEAGHIIV  344
            MAS G  PAS + +  G+T   D LP+E+N+MKI+D+K   ++EAAVVDGNGTE GHIIV
Sbjct  1    MASAGAAPASTVGKPGGNTGFADKLPDEINEMKIKDEKAEKEVEAAVVDGNGTETGHIIV  60

Query  345  TTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQT  524
            TTIGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQT
Sbjct  61   TTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQT  120

Query  525  MRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            MRLLDHPNVVSLKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  121  MRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEFVPE  156



>ref|XP_006338576.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
Length=410

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 136/154 (88%), Gaps = 9/154 (6%)
 Frame = +3

Query  198  ASG--MRESSGHTVG----VDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTT  350
            ASG  M  ++G  +     +D+LP+E+N+MKI DDK+   MEA VVDGNGTE GHIIVTT
Sbjct  2    ASGSIMSSAAGKPITDAMLIDNLPKEINEMKINDDKEGKEMEATVVDGNGTETGHIIVTT  61

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            IGG+NGQPKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  62   IGGKNGQPKQTISYMAERVVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  121

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LLDHP++VSLKHCFFSTT+KDELYLNLVLE+VPE
Sbjct  122  LLDHPSIVSLKHCFFSTTEKDELYLNLVLEFVPE  155



>ref|XP_006338577.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=404

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 128/135 (95%), Gaps = 3/135 (2%)
 Frame = +3

Query  237  VDSLPEEMNDMKIRDDKD---MEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            +D+LP+E+N+MKI DDK+   MEA VVDGNGTE GHIIVTTIGG+NGQPKQTISYMAER+
Sbjct  15   IDNLPKEINEMKINDDKEGKEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERV  74

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHP++VSLKHCFFSTT+
Sbjct  75   VGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPSIVSLKHCFFSTTE  134

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLE+VPE
Sbjct  135  KDELYLNLVLEFVPE  149



>gb|EMS49677.1| Glycogen synthase kinase-3-like protein MsK-3 [Triticum urartu]
Length=473

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  231  VGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERIV  410
            +G + LP++MND+KIRDDK++EA +++G GTE GHIIVTT GG+NGQPKQT+SYMAERIV
Sbjct  1    MGAEKLPDQMNDLKIRDDKEVEATIINGKGTETGHIIVTTTGGKNGQPKQTVSYMAERIV  60

Query  411  GHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTDK  590
            G GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVV+LKHCFFSTT+K
Sbjct  61   GQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFSTTEK  120

Query  591  DELYLNLVLEYVPE  632
            DELYLNLVLEYVPE
Sbjct  121  DELYLNLVLEYVPE  134



>ref|XP_009124961.1| PREDICTED: shaggy-related protein kinase gamma-like [Brassica 
rapa]
Length=403

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MA+VGV P++ +RE  G+  GVD L EEM  M+I+DDK+ME  +V GN TE G+I VTTI
Sbjct  1    MATVGVEPSAAVREFIGNVTGVDRLHEEMIHMRIQDDKEMEDTIVYGNVTETGYI-VTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G+NGQP QTISYMAER VG G+FGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  60   AGRNGQPNQTISYMAERAVGQGAFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNL LEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTDKDELYLNLALEYVPE  152



>gb|KDO86034.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=272

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 134/164 (82%), Gaps = 11/164 (7%)
 Frame = +3

Query  174  MASVGVPPASGMRESSG----HTVGVDSLPEEMNDMKIRD-------DKDMEAAVVDGNG  320
            MAS  + P +   E++        G D LP+EMN+M+IRD       DKD+E ++V+GNG
Sbjct  56   MASTSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNG  115

Query  321  TEAGHIIVTTIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKR  500
            TEAG +I TT+GG+NGQPKQTISYMAER+VG GSFGVVFQAKCLETG++VAIKKVLQDKR
Sbjct  116  TEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKR  175

Query  501  YKNRELQTMRLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            YKNRELQ MRLL+HPNVVSLKHCFFSTT+KDELYLNLVLEY+ E
Sbjct  176  YKNRELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISE  219



>ref|XP_006654010.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Oryza brachyantha]
 ref|XP_006654011.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Oryza brachyantha]
Length=410

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPAS-GMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV  +S G +  +  +  VD LP EM+ M IRDDKD+E  VV+GNGTE GHIIVT+
Sbjct  1    MASVGVVRSSLGFQNETSTSGDVDRLPNEMSTMSIRDDKDIEDIVVNGNGTEPGHIIVTS  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            I G+NGQ KQTISYMAER+VGHGSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +LDHPNVVSLKHCFFS T+K+ELYLNLVLEYVPE
Sbjct  121  VLDHPNVVSLKHCFFSKTEKEELYLNLVLEYVPE  154



>ref|XP_003569078.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=411

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 2/155 (1%)
 Frame = +3

Query  174  MASVGV--PPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVT  347
            MASVG   P + G +  +  +   D LP EM +M IRDDKD+E  VV+GNGTE GHIIVT
Sbjct  1    MASVGAVRPSSMGFQNDTSTSGDADRLPNEMGNMSIRDDKDIEDIVVNGNGTEPGHIIVT  60

Query  348  TIGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  527
            +I G+NGQ KQTISYMAER+VGHGSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQTM
Sbjct  61   SIEGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTM  120

Query  528  RLLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            R+LDHPNVVSLKHCFFS T+K+ELYLNLVLEYVPE
Sbjct  121  RVLDHPNVVSLKHCFFSKTEKEELYLNLVLEYVPE  155



>gb|ABR16348.1| unknown [Picea sitchensis]
Length=422

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = +3

Query  234  GVDSLPEEMNDMKIRDDKDME--AAVVDGNGTEAGHIIVTTIGGQNGQPKQTISYMAERI  407
            GV+ LP EMN MKI+DDK+ME  A VV GN TEAGHII TTIGG+NG+PKQTISYMAER+
Sbjct  27   GVERLPREMNIMKIKDDKEMEEKATVVAGNVTEAGHIIATTIGGRNGEPKQTISYMAERV  86

Query  408  VGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTD  587
            VG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQTMR+LDHPNVVSLKHCFFSTTD
Sbjct  87   VGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRILDHPNVVSLKHCFFSTTD  146

Query  588  KDELYLNLVLEYVPE  632
            KDELYLNLVLEYVPE
Sbjct  147  KDELYLNLVLEYVPE  161



>emb|CDY18828.1| BnaAnng02930D [Brassica napus]
Length=404

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +3

Query  174  MASVGVPPASGMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTTI  353
            MA+VGV P++ +RE  G+   VD L EEM  M+I+DDK+ME  +V GN TE G+I VTTI
Sbjct  1    MATVGVEPSAAVREFIGNVTDVDRLHEEMIHMRIQDDKEMEDTIVYGNVTETGYI-VTTI  59

Query  354  GGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRL  533
             G+NGQP QTISYMAER VG G+FGVVFQAKCLETGETVAIKKVLQD+RYKNRELQTMRL
Sbjct  60   AGRNGQPNQTISYMAERAVGQGAFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL  119

Query  534  LDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            LDHPNVVSLKHCFFSTTDKDELYLNL LEYVPE
Sbjct  120  LDHPNVVSLKHCFFSTTDKDELYLNLALEYVPE  152



>ref|XP_001781582.1| predicted protein [Physcomitrella patens]
 gb|EDQ53633.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 7/150 (5%)
 Frame = +3

Query  204  GMRESSGHTVGVDSLPEEMNDMKIRDDK-------DMEAAVVDGNGTEAGHIIVTTIGGQ  362
            G+  +   + GV+ LP+EM+DMK+RDDK       ++EA++VDGNGTE GHII TTIGG+
Sbjct  18   GIAPTKAGSSGVELLPKEMHDMKLRDDKVDHSDDKEIEASIVDGNGTETGHIIATTIGGR  77

Query  363  NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  542
            NGQPKQTISY AER+VG GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNRELQ MRLLDH
Sbjct  78   NGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDH  137

Query  543  PNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            PN+V+LKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  138  PNIVALKHCFFSTTDKDELYLNLVLEYVPE  167



>gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella patens]
 gb|AAQ23113.1| shaggy-related protein kinase 3 [Physcomitrella patens]
Length=423

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 7/150 (5%)
 Frame = +3

Query  204  GMRESSGHTVGVDSLPEEMNDMKIRDDK-------DMEAAVVDGNGTEAGHIIVTTIGGQ  362
            G+  +   + GV+ LP+EM+DMK+RDDK       ++EA++VDGNGTE GHII TTIGG+
Sbjct  18   GIAPTKAGSSGVELLPKEMHDMKLRDDKVDHSDDKEIEASIVDGNGTETGHIIATTIGGR  77

Query  363  NGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDH  542
            NGQPKQTISY AER+VG GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNRELQ MRLLDH
Sbjct  78   NGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDH  137

Query  543  PNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            PN+V+LKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  138  PNIVALKHCFFSTTDKDELYLNLVLEYVPE  167



>gb|AFW57486.1| putative glycogen synthase kinase family protein, partial [Zea 
mays]
Length=341

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +3

Query  174  MASVGVPPAS-GMRESSGHTVGVDSLPEEMNDMKIRDDKDMEAAVVDGNGTEAGHIIVTT  350
            MASVGV  +S G +  +  +   D LP E+  M IRDDKD+E  VV+GNG E GHIIVT+
Sbjct  1    MASVGVARSSLGFQNGTSSSSDPDRLPNELGSMSIRDDKDVEDIVVNGNGAEPGHIIVTS  60

Query  351  IGGQNGQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  530
            I G+NGQ KQTISYMAER+VGHGSFG VFQAKCLETGETVAIKKVLQDKRYKNRELQTMR
Sbjct  61   IDGRNGQAKQTISYMAERVVGHGSFGTVFQAKCLETGETVAIKKVLQDKRYKNRELQTMR  120

Query  531  LLDHPNVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            +LDHPNVV+LKHCFFS T+K+ELYLNLVLEYVPE
Sbjct  121  VLDHPNVVALKHCFFSKTEKEELYLNLVLEYVPE  154



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 8/149 (5%)
 Frame = +3

Query  210  RESSGHTVGVDSLPEEMNDMKIRDDK--------DMEAAVVDGNGTEAGHIIVTTIGGQN  365
            R ++ ++  VD LP+EM++MKIRDDK        ++EAAV+DGNGTE GHII TTIGG+N
Sbjct  52   RAATVNSNVVDQLPDEMHEMKIRDDKAATHIDEKEVEAAVIDGNGTETGHIIATTIGGRN  111

Query  366  GQPKQTISYMAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHP  545
            GQPKQTISY+AER+VG GSFG+VFQAKCLETGETVAIKKVLQDKRYKNRELQ MRLLDHP
Sbjct  112  GQPKQTISYVAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQIMRLLDHP  171

Query  546  NVVSLKHCFFSTTDKDELYLNLVLEYVPE  632
            ++VSLKHCFFSTTDKDELYLNLVLEYVPE
Sbjct  172  SIVSLKHCFFSTTDKDELYLNLVLEYVPE  200



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 128/140 (91%), Gaps = 7/140 (5%)
 Frame = +3

Query  234  GVDSLPEEMNDMKIRDDK-------DMEAAVVDGNGTEAGHIIVTTIGGQNGQPKQTISY  392
            GV+SLP+EM+DMK+RDDK       ++EA+VVDGNGTE GHII TTIGG+NGQPKQTISY
Sbjct  28   GVESLPKEMHDMKLRDDKVDHSDDKEIEASVVDGNGTETGHIIATTIGGKNGQPKQTISY  87

Query  393  MAERIVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCF  572
             AER+VG GSFG+VFQAKC+ETGETVAIKKVLQDKRYKNRELQ MRLLDHPN+V+LKHCF
Sbjct  88   SAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRLLDHPNIVALKHCF  147

Query  573  FSTTDKDELYLNLVLEYVPE  632
            FSTTDKDEL+LNLVLEYVPE
Sbjct  148  FSTTDKDELFLNLVLEYVPE  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 955946848384