BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5941

Length=851
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604184.1|  PREDICTED: uncharacterized protein LOC104099022    110   8e-26   Nicotiana tomentosiformis
ref|XP_009787253.1|  PREDICTED: uncharacterized protein LOC104235230    109   2e-25   Nicotiana sylvestris
ref|XP_010322440.1|  PREDICTED: uncharacterized protein LOC101253793    109   3e-25   
ref|XP_006361081.1|  PREDICTED: uncharacterized protein LOC102600541    108   8e-25   Solanum tuberosum [potatoes]
ref|XP_011088914.1|  PREDICTED: uncharacterized protein LOC105170030    104   2e-23   Sesamum indicum [beniseed]
ref|XP_002274217.1|  PREDICTED: uncharacterized protein LOC100258720  97.4    7e-21   Vitis vinifera
gb|AFK38933.1|  unknown                                               96.3    2e-20   Medicago truncatula
gb|EYU26724.1|  hypothetical protein MIMGU_mgv1a014687mg              95.5    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_010102007.1|  hypothetical protein L484_016297                 94.7    7e-20   Morus notabilis
ref|XP_009377823.1|  PREDICTED: uncharacterized protein LOC103966390  94.4    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_008342303.1|  PREDICTED: uncharacterized protein LOC103405117  94.0    1e-19   
gb|KHN38621.1|  hypothetical protein glysoja_008170                   93.6    2e-19   Glycine soja [wild soybean]
ref|NP_001238654.1|  uncharacterized protein LOC100306681 precursor   93.6    2e-19   
emb|CDP06891.1|  unnamed protein product                              92.0    6e-19   Coffea canephora [robusta coffee]
gb|KHN21162.1|  hypothetical protein glysoja_006641                   91.7    9e-19   Glycine soja [wild soybean]
ref|XP_007206001.1|  hypothetical protein PRUPE_ppa012312mg           91.3    1e-18   Prunus persica
ref|XP_008391136.1|  PREDICTED: uncharacterized protein LOC103453370  90.9    2e-18   Malus domestica [apple tree]
ref|XP_004291583.1|  PREDICTED: uncharacterized protein LOC101302722  90.5    2e-18   Fragaria vesca subsp. vesca
ref|XP_010045194.1|  PREDICTED: uncharacterized protein LOC104433964  88.2    2e-17   Eucalyptus grandis [rose gum]
ref|XP_004514371.1|  PREDICTED: uncharacterized protein LOC101498249  86.7    4e-17   Cicer arietinum [garbanzo]
ref|XP_008229128.1|  PREDICTED: uncharacterized protein LOC103328506  86.3    6e-17   Prunus mume [ume]
ref|XP_003596840.1|  hypothetical protein MTR_2g086680                86.3    7e-17   Medicago truncatula
ref|XP_007132452.1|  hypothetical protein PHAVU_011G095400g           85.5    9e-17   Phaseolus vulgaris [French bean]
gb|KDO35857.1|  hypothetical protein CISIN_1g030378mg                 85.5    1e-16   Citrus sinensis [apfelsine]
ref|XP_006424206.1|  hypothetical protein CICLE_v10029378mg           84.7    2e-16   Citrus clementina [clementine]
ref|XP_007015774.1|  Pollen Ole e 1 allergen and extensin family ...  84.3    3e-16   
ref|XP_006487907.1|  PREDICTED: uncharacterized protein LOC102623586  83.6    6e-16   Citrus sinensis [apfelsine]
gb|KHN32866.1|  hypothetical protein glysoja_038795                   83.6    6e-16   Glycine soja [wild soybean]
ref|XP_002313489.1|  hypothetical protein POPTR_0009s02440g           82.4    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002523833.1|  conserved hypothetical protein                   82.0    2e-15   Ricinus communis
gb|AFK40698.1|  unknown                                               81.3    3e-15   Lotus japonicus
gb|AFK41233.1|  unknown                                               81.3    3e-15   Lotus japonicus
ref|NP_001234951.1|  uncharacterized protein LOC100306432 precursor   81.3    4e-15   
ref|XP_012076135.1|  PREDICTED: uncharacterized protein LOC105637309  80.9    4e-15   Jatropha curcas
gb|KJB54179.1|  hypothetical protein B456_009G084200                  80.9    5e-15   Gossypium raimondii
ref|XP_011014926.1|  PREDICTED: uncharacterized protein LOC105118643  80.5    7e-15   Populus euphratica
ref|XP_007150057.1|  hypothetical protein PHAVU_005G122600g           80.1    9e-15   Phaseolus vulgaris [French bean]
gb|AFK37535.1|  unknown                                               79.0    2e-14   Lotus japonicus
gb|KHG28557.1|  Bile acid-inducible operon CD                         79.0    2e-14   Gossypium arboreum [tree cotton]
ref|XP_004487486.1|  PREDICTED: uncharacterized protein LOC101502277  79.0    2e-14   Cicer arietinum [garbanzo]
gb|EPS71447.1|  hypothetical protein M569_03316                       74.7    8e-13   Genlisea aurea
gb|KJB54178.1|  hypothetical protein B456_009G084200                  72.8    3e-12   Gossypium raimondii
ref|XP_004139493.1|  PREDICTED: uncharacterized protein LOC101207654  71.2    1e-11   Cucumis sativus [cucumbers]
ref|XP_010271608.1|  PREDICTED: uncharacterized protein LOC104607635  70.9    1e-11   Nelumbo nucifera [Indian lotus]
ref|NP_001237809.1|  uncharacterized protein LOC100305605 precursor   69.7    2e-11   
ref|XP_008461260.1|  PREDICTED: uncharacterized protein LOC103499896  67.4    4e-10   Cucumis melo [Oriental melon]
ref|XP_010421032.1|  PREDICTED: uncharacterized protein LOC104706531  65.1    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010493327.1|  PREDICTED: uncharacterized protein LOC104770577  64.3    4e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010454505.1|  PREDICTED: uncharacterized protein LOC104736250  63.2    1e-08   Camelina sativa [gold-of-pleasure]
gb|AAM65948.1|  unknown                                               62.8    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400748.1|  hypothetical protein EUTSA_v10014830mg           62.0    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_006288782.1|  hypothetical protein CARUB_v10002103mg           61.6    4e-08   Capsella rubella
ref|XP_006408713.1|  hypothetical protein EUTSA_v10002110mg           61.2    4e-08   Eutrema salsugineum [saltwater cress]
ref|NP_568418.1|  pollen Ole e 1 allergen and extensin family pro...  60.5    9e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35685.1|  BnaC02g09510D                                        60.1    1e-07   Brassica napus [oilseed rape]
ref|XP_009126543.1|  PREDICTED: uncharacterized protein LOC103851442  59.7    1e-07   Brassica rapa
ref|XP_002872002.1|  hypothetical protein ARALYDRAFT_351266           59.3    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006845425.1|  PREDICTED: uncharacterized protein LOC18435316   58.9    4e-07   Amborella trichopoda
gb|KFK44754.1|  hypothetical protein AALP_AA1G298500                  58.2    5e-07   Arabis alpina [alpine rockcress]
gb|AFK49274.1|  unknown                                               57.0    6e-07   Medicago truncatula
emb|CDY09139.1|  BnaA02g05650D                                        57.8    7e-07   Brassica napus [oilseed rape]
ref|XP_010521643.1|  PREDICTED: uncharacterized protein LOC104800521  57.8    7e-07   Tarenaya hassleriana [spider flower]
ref|NP_001158898.1|  hypothetical protein precursor                   58.5    7e-07   Zea mays [maize]
ref|XP_004140163.2|  PREDICTED: uncharacterized protein LOC101219078  57.4    1e-06   Cucumis sativus [cucumbers]
ref|XP_008449582.1|  PREDICTED: uncharacterized protein LOC103491422  57.4    1e-06   Cucumis melo [Oriental melon]
emb|CDY04490.1|  BnaA07g13160D                                        57.0    1e-06   
ref|NP_001144082.1|  uncharacterized protein LOC100276913 precursor   57.4    2e-06   
gb|KFK23135.1|  hypothetical protein AALP_AAs65178U000400             56.6    2e-06   Arabis alpina [alpine rockcress]
ref|XP_010931111.1|  PREDICTED: uncharacterized protein LOC105052104  57.0    2e-06   Elaeis guineensis
emb|CDX71455.1|  BnaC04g16900D                                        55.8    4e-06   
ref|XP_006293390.1|  hypothetical protein CARUB_v10024152mg           55.5    5e-06   
ref|NP_850100.2|  pollen Ole e 1 allergen and extensin family pro...  55.1    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189617.1|  pollen Ole e 1 allergen and extensin family ...  54.7    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103596.1|  PREDICTED: uncharacterized protein LOC103829663  54.3    1e-05   Brassica rapa
ref|XP_002880912.1|  At2g27385                                        52.4    5e-05   
ref|XP_003581209.1|  PREDICTED: uncharacterized protein LOC100827343  52.8    7e-05   Brachypodium distachyon [annual false brome]
ref|XP_010473133.1|  PREDICTED: uncharacterized protein LOC104752641  51.6    9e-05   Camelina sativa [gold-of-pleasure]
gb|EMT13967.1|  hypothetical protein F775_04212                       51.2    2e-04   
ref|XP_010513307.1|  PREDICTED: uncharacterized protein LOC104789279  52.4    2e-04   
ref|XP_010417895.1|  PREDICTED: uncharacterized protein LOC104703563  50.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010236804.1|  PREDICTED: uncharacterized protein LOC104584272  50.4    3e-04   Brachypodium distachyon [annual false brome]



>ref|XP_009604184.1| PREDICTED: uncharacterized protein LOC104099022 [Nicotiana tomentosiformis]
Length=166

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 89/151 (59%), Gaps = 22/151 (15%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC    N    LSG+KVSVKC   K +AMATTEEDGSFET +   ++ + 
Sbjct  26   HVLKGSVTCLDC----NQHSDLSGIKVSVKCNQVKTLAMATTEEDGSFETNLPFDTTPTS  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
            ++   C AKILG  +QL++  K  +  VV      + D S +   T S+PL+FYT     
Sbjct  82   TAAHICYAKILGGPKQLFVSKKDTDPTVV----KSQEDDSSY---TISKPLKFYTN----  130

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
                       G SKT+DLP+P+EWGL PTS
Sbjct  131  -------YSKFGSSKTIDLPVPKEWGLAPTS  154



>ref|XP_009787253.1| PREDICTED: uncharacterized protein LOC104235230 [Nicotiana sylvestris]
Length=168

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 90/151 (60%), Gaps = 22/151 (15%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC    NH   LSG+KVSVKC   K +AMATTEEDGSF + +   +S + 
Sbjct  28   HVLKGSVTCLDC----NHHSDLSGIKVSVKCSQVKTLAMATTEEDGSFVSNLPFDTSPTS  83

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
            ++   C AKILG  +QL++  K  +  VV    + E D+S     T S+PL FYT+    
Sbjct  84   TAANICYAKILGGPKQLFVSKKDTDPTVV---KSQEVDNS----YTISKPLNFYTR----  132

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
                       G SKT+DLP+P+EWGL PTS
Sbjct  133  -------YSKFGSSKTIDLPVPKEWGLAPTS  156



>ref|XP_010322440.1| PREDICTED: uncharacterized protein LOC101253793 [Solanum lycopersicum]
Length=171

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V KGSVTCLDC+  HN    LSG++V VKCG  K +AMATTEEDGSFET          
Sbjct  25   YVLKGSVTCLDCSQ-HND---LSGIEVLVKCGQVKRLAMATTEEDGSFET------KLPS  74

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
            +    C AKILG   QL++     +  +V    + E D+S     T S PL+FYTKCP+ 
Sbjct  75   TPPNKCYAKILGGPNQLFVSRIETDPNIV---KSQEDDNS----YTISNPLKFYTKCPSP  127

Query  485  -KCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K   G      G SKT+DLPLP+EWG+ PTS
Sbjct  128  NKSAKGKCHDEFGSSKTIDLPLPKEWGIAPTS  159



>ref|XP_006361081.1| PREDICTED: uncharacterized protein LOC102600541 [Solanum tuberosum]
Length=171

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 88/157 (56%), Gaps = 28/157 (18%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V KGSVTCLDC+   +    LSG+KVSVKC   K + MATTEEDG FET          
Sbjct  25   YVLKGSVTCLDCSQHID----LSGIKVSVKCSQVKTLTMATTEEDGFFET------KLPF  74

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
            +    C AKILG   QL+I  K  +  +V    + E D+S     T S PL+FYTKCP  
Sbjct  75   TPTNKCYAKILGGPNQLFISRKETDPNIV---KSQEDDNS----YTISNPLKFYTKCPSS  127

Query  479  ----NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                N KC         G SKT+DLP+P+EWG+ PTS
Sbjct  128  NKNANGKC-----NDEFGSSKTIDLPVPKEWGIAPTS  159



>ref|XP_011088914.1| PREDICTED: uncharacterized protein LOC105170030 [Sesamum indicum]
Length=174

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 86/152 (57%), Gaps = 16/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSV CLDC    +    LSG++V VKC   K +AMA TEEDG+FET  +   S   
Sbjct  26   HVLKGSVACLDCPRRSD----LSGIQVLVKCNKVKKLAMAYTEEDGTFETN-LPSDSPKT  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            S   +C AK++G   QLY+ MK   + +V  A   ES H      TTS+PL FY  CP  
Sbjct  81   SDPSNCMAKLMGGPHQLYVAMK---NSIVPVAKTEESGH-----FTTSKPLNFYRSCPVE  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             KC  GG        KTVDLPLP EWG PPTS
Sbjct  133  GKC--GGKDTGFDSGKTVDLPLPGEWGFPPTS  162



>ref|XP_002274217.1| PREDICTED: uncharacterized protein LOC100258720 [Vitis vinifera]
 emb|CAN68427.1| hypothetical protein VITISV_031997 [Vitis vinifera]
 emb|CBI28296.3| unnamed protein product [Vitis vinifera]
Length=172

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 90/151 (60%), Gaps = 15/151 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV KGSVTCLDC   H+     SG+KV VKC   K +AMATTE DGSF+T  +   +++ 
Sbjct  25   HVMKGSVTCLDCHRHHD----FSGIKVLVKCDRVKKLAMATTEADGSFKTN-LPSDTQTS  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
            S  ++C AK+LG   QLY   K   SK+V   A  +S +      T S PL F T CP++
Sbjct  80   SPPLNCLAKLLGGPNQLYAFRKNTVSKIV--KARDDSSY------TISTPLSFSTTCPSS  131

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
              V G   G  G SKTVDLPLP EWGL P+S
Sbjct  132  --VKGAKYGEFGSSKTVDLPLPPEWGLAPSS  160



>gb|AFK38933.1| unknown [Medicago truncatula]
Length=170

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 91/152 (60%), Gaps = 19/152 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V+C+DCTH+++    LS +KV+VKC G KN+AM TTEEDGSF+       S + 
Sbjct  25   EILQGKVSCVDCTHSYD----LSDIKVTVKCEGVKNLAMTTTEEDGSFKVN---LPSDNT  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             + ++C AK+LG   QLY    A +   V +   G+ ++S  YI++T  PL F   CP N
Sbjct  78   KTSMNCLAKLLGGPIQLY----AKKQNQVSQVIKGKEENS--YIIST--PLSFLISCPQN  129

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C        IG SKT+DLPLP EWGL P+S
Sbjct  130  TNC---KATKPIGSSKTIDLPLPPEWGLAPSS  158



>gb|EYU26724.1| hypothetical protein MIMGU_mgv1a014687mg [Erythranthe guttata]
Length=181

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 85/152 (56%), Gaps = 12/152 (8%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KGSV C+DC    +    LSGV+V VKC   K +A+  T+EDG+F T +        
Sbjct  29   QLLKGSVACVDCPQDFD----LSGVQVLVKCDKVKKLAVTYTQEDGTFITELPSDEPTKS  84

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             +  +C AKI+G   QL++  K   + V+  A A ES  S   + TT++PL FY+ CP  
Sbjct  85   ENPSNCMAKIMGGPHQLFVSTKDAFAPVI--ANARESSGS---LFTTAKPLGFYSTCPLK  139

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             KC+    G +    KTVD PLPREWGL P+S
Sbjct  140  GKCIAKDNGFASS--KTVDFPLPREWGLAPSS  169



>ref|XP_010102007.1| hypothetical protein L484_016297 [Morus notabilis]
 gb|EXB91227.1| hypothetical protein L484_016297 [Morus notabilis]
Length=178

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 86/154 (56%), Gaps = 18/154 (12%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            + KG V+CLDC    +     +G+KV VKC   K +AMATT++DGSFE      ++  P 
Sbjct  27   LIKGKVSCLDCKSKSDL---TAGIKVLVKCDKVKKLAMATTKDDGSFEVEAPSDNTPQPR  83

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP---  478
            S+ +C +K+LG   QLY   K   S++V      E+D S  Y  T S PL  YT CP   
Sbjct  84   SLSNCLSKLLGGPNQLYTSKKFMTSQIV------ETDDSNSY--TISSPLSIYTSCPPTI  135

Query  479  -NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             +AKC         G SKTVDLPLP EWGL P+S
Sbjct  136  DHAKC---ETMKKWGSSKTVDLPLPPEWGLAPSS  166



>ref|XP_009377823.1| PREDICTED: uncharacterized protein LOC103966390 [Pyrus x bretschneideri]
Length=176

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 79/152 (52%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K MAMA TE DGSFE  +   ++   
Sbjct  25   QVLKAKVTCLDCHQNYD----FSGIKVLVKCDKVKKMAMAVTENDGSFEAKLPSNNNTKS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
                +C A+ILG   QLY   K   S++V      +   S  Y  TT+ PL F T CP N
Sbjct  81   PDAKNCLARILGGPDQLYASRKFMASEIV------KIQDSNSY--TTTTPLGFSTSCPLN  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K          G SKT++LPLP EWGL P+S
Sbjct  133  IKDAACKAMNKFGSSKTINLPLPPEWGLAPSS  164



>ref|XP_008342303.1| PREDICTED: uncharacterized protein LOC103405117 [Malus domestica]
Length=176

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 80/152 (53%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K MAMA TE DGSFE  +   ++   
Sbjct  25   QVLKAKVTCLDCHQNYD----FSGIKVLVKCDKVKKMAMAITENDGSFEAKLPSNNNTKS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
                +C A+ILG   QLY   K   S++V      ++  S  Y  TT+ PL F T CP N
Sbjct  81   PDAKNCLARILGGPDQLYTSRKFMASEIV------KTQDSNSY--TTTTPLGFSTSCPLN  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K          G SKT+++PLP EWGL P+S
Sbjct  133  IKDAACKAMNKFGSSKTINVPLPPEWGLAPSS  164



>gb|KHN38621.1| hypothetical protein glysoja_008170 [Glycine soja]
Length=173

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V +G V+C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+  + L  +K  
Sbjct  25   QVVQGKVSCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVDLPLDHTKPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S  Y ++TS  L F T CP  
Sbjct  81   SSVNNCLAKLLGGPVQLYVSRENQVSQII----KGKDQNS--YTISTS--LSFRTSCPLT  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             KC    GG  +G SKTVDLPLP EWGL P+S
Sbjct  133  TKC---KGGKQVGSSKTVDLPLPPEWGLAPSS  161



>ref|NP_001238654.1| uncharacterized protein LOC100306681 precursor [Glycine max]
 gb|ACU14977.1| unknown [Glycine max]
Length=173

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 95/152 (63%), Gaps = 16/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V +G V+C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+  + L  +K  
Sbjct  25   QVVQGKVSCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVDLPLDHTKPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S  Y ++TS  L F T CP  
Sbjct  81   SSVNNCLAKLLGGPVQLYVSRENQVSQII----KGKDQNS--YTISTS--LSFRTSCPLT  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             KC    GG  +G SKTVDLPLP EWGL P+S
Sbjct  133  TKC---KGGKQVGSSKTVDLPLPPEWGLAPSS  161



>emb|CDP06891.1| unnamed protein product [Coffea canephora]
Length=175

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 88/154 (57%), Gaps = 18/154 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +V +GSVTCLDC   HN    LSG+K+ VKC   K + +ATT++DG+FE T +   + + 
Sbjct  25   NVLRGSVTCLDC-DGHND---LSGIKIVVKCSNVKMVDVATTKKDGTFE-TELAKGTTTS  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
             + + C AKILG    LY   K   SKV       + +   HY  T +EPL FY  CP  
Sbjct  80   PNSLKCLAKILGGPSLLYTSGKKTISKV------EKVEGHDHY--TNTEPLNFYKSCPAE  131

Query  479  -NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             +A+C         G SKTVDLPLPREWGL P+S
Sbjct  132  KHAECA--SVDLEFGSSKTVDLPLPREWGLAPSS  163



>gb|KHN21162.1| hypothetical protein glysoja_006641 [Glycine soja]
Length=172

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 90/152 (59%), Gaps = 17/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+   +      P
Sbjct  25   QMVQGRVFCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVD-LPLDHTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S     T S PL F T CP N
Sbjct  80   SSVKNCLAKLLGGPVQLYVSRENQVSQII----KGKEQNS----YTISTPLSFRTSCPLN  131

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             KC     G  +G SKTVDLPLP EWGL P+S
Sbjct  132  TKC---KAGKKVGSSKTVDLPLPPEWGLAPSS  160



>ref|XP_007206001.1| hypothetical protein PRUPE_ppa012312mg [Prunus persica]
 gb|EMJ07200.1| hypothetical protein PRUPE_ppa012312mg [Prunus persica]
Length=174

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 81/152 (53%), Gaps = 16/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC    +     SG+KV VKCG  K +AMATTE+DGSFET        + 
Sbjct  26   QVVKAKVTCLDCHQNTD----FSGIKVLVKCGQVKKLAMATTEKDGSFET---KLPVGNS  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             S ++C A+ILG   QLY   K   S++V      ++     Y  T S PL F T CP N
Sbjct  79   KSPMNCLARILGGPDQLYASRKVVASEIV------KTQEPNSY--TISTPLGFTTSCPLN  130

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K          G SKTV+LPLP +WGL P+S
Sbjct  131  IKEAACKAMNKFGSSKTVNLPLPPDWGLAPSS  162



>ref|XP_008391136.1| PREDICTED: uncharacterized protein LOC103453370 [Malus domestica]
Length=176

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 81/152 (53%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG VTCLDC   ++     S +KV VKC   K +AMA TE+DGSFE  +   ++   
Sbjct  25   QVLKGKVTCLDCHQNYD----FSEIKVLVKCDKVKKLAMAITEKDGSFEAKLPSNNNPKT  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
               ++C A+ILG   QLY   K   S++V      ++  S  Y  TTS PL F T CP N
Sbjct  81   PEAMNCLARILGGPDQLYSSRKFLASEIV------KTQDSNTY--TTSTPLGFSTSCPLN  132

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K          G SKT+D+PLP  WGL P+S
Sbjct  133  IKDAACKAINKFGSSKTIDVPLPPGWGLAPSS  164



>ref|XP_004291583.1| PREDICTED: uncharacterized protein LOC101302722 [Fragaria vesca 
subsp. vesca]
Length=178

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 82/156 (53%), Gaps = 21/156 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTCLDC   ++     SG+KV VKC   K +A ATTE DGSFE   +       
Sbjct  27   QVLKAKVTCLDCHKNYD----FSGIKVLVKCDQVKKLATATTEADGSFE-VKLPSDDSKS  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
             + + C AKILG T+QLY+  K   SK++      ++  S  Y  T S PL F+T CP  
Sbjct  82   PASLHCLAKILGGTKQLYVSRKVVASKIL------KTHDSNSY--TISTPLSFFTSCPLS  133

Query  479  ---NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                A C        +G SKT +LPLP EWGL P+S
Sbjct  134  IEDQAAC---KAKNEVGSSKTFNLPLPPEWGLAPSS  166



>ref|XP_010045194.1| PREDICTED: uncharacterized protein LOC104433964 [Eucalyptus grandis]
 gb|KCW87355.1| hypothetical protein EUGRSUZ_B03836 [Eucalyptus grandis]
Length=195

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 84/161 (52%), Gaps = 20/161 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFET----------  274
            HV KG ++CLDC   H+    LSG+KV VKC G K  ++ATTE+DGSFE           
Sbjct  33   HVVKGKLSCLDCKQDHD----LSGIKVMVKCDGVKKASVATTEDDGSFEAELPSTKAAAA  88

Query  275  TvvlpsskspssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEP  454
            T       + +  +SC AK+LG   QLY       +KVV     G    +  Y + T  P
Sbjct  89   TTTDEGKTAAAPTLSCLAKVLGGPDQLYASRDHVVAKVV--EVEGRDGTATSYGLAT--P  144

Query  455  LRFYTKCPNAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
            L   T CP  K    G    +G SKTVDLPLP+EWGL P+S
Sbjct  145  LAVSTACPPTK--ECGAYNMVGSSKTVDLPLPKEWGLAPSS  183



>ref|XP_004514371.1| PREDICTED: uncharacterized protein LOC101498249 [Cicer arietinum]
Length=170

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 82/152 (54%), Gaps = 19/152 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C+DCTH +N    LS + VS+KC G K +AM TT++DGSF+       S   
Sbjct  25   QMVKGKVSCVDCTHNNN----LSDINVSLKCEGVKKLAMTTTKDDGSFKVN---LPSDHT  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             + ++C A +LG   QLY+  +   S+++      +    + Y  T S PL F   CP N
Sbjct  78   KTSMNCFATLLGGPIQLYVSKQNQVSQII------KGKEKKDY--TISTPLSFMISCPKN  129

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C       + G SKTVD PLP EWGL PTS
Sbjct  130  TNC---KASTAFGSSKTVDFPLPPEWGLAPTS  158



>ref|XP_008229128.1| PREDICTED: uncharacterized protein LOC103328506 [Prunus mume]
Length=174

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 80/152 (53%), Gaps = 16/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  VTC DC    +     SG+KV VKCG  K +AMATTE+DGSFET        + 
Sbjct  26   QVVKAKVTCHDCHQNTD----FSGIKVLVKCGQVKKLAMATTEKDGSFET---KLPLGNS  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             S ++C A+ILG   QLY   K   S++V      ++     Y  T S PL F T CP N
Sbjct  79   KSPMNCLARILGGPDQLYASRKFMASEIV------KTQEPNSY--TISTPLGFTTSCPLN  130

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K          G SKTV+LP+P EWGL P+S
Sbjct  131  IKEAACKAMNKFGSSKTVNLPVPPEWGLAPSS  162



>ref|XP_003596840.1| hypothetical protein MTR_2g086680 [Medicago truncatula]
 gb|AES67091.1| pollen Ole e I family allergen [Medicago truncatula]
Length=172

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 85/152 (56%), Gaps = 17/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DC   ++     SG+KVS+KC G KNMAMATTE DGSF   V L +S + 
Sbjct  25   QMVKGKVSCNDCAQDYD----FSGIKVSMKCEGVKNMAMATTENDGSF--MVDLSTSHAK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
                +C AK+LG    LY   +   S++V     G+ ++S     T S PL F+T CP N
Sbjct  79   LPYDNCHAKLLGGPNNLYASRRNQFSQIV----KGKEENS----YTLSTPLSFFTSCPQN  130

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             +C         G SK+++ PLP EWGL P+S
Sbjct  131  KEC--KTEKNEFGSSKSINFPLPPEWGLAPSS  160



>ref|XP_007132452.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris]
 gb|ESW04446.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris]
Length=166

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 86/152 (57%), Gaps = 23/152 (15%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V+C+DCT  ++    LS VKVSVKC G K + +ATTE DGSF+        + P
Sbjct  25   QILQGKVSCVDCTLNYD----LSDVKVSVKCDGVKKLGVATTENDGSFKV-------ELP  73

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC-PN  481
            S   +C AK+LG   QLY+  K   S++V     G+  +S     T S PL F T C P 
Sbjct  74   SDKGNCLAKVLGGPVQLYVSGKDQISEIV----KGKEQNS----YTISTPLIFRTSCPPR  125

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C    GG  +G SKTVDLPLP EWGL P+S
Sbjct  126  TSC---KGGTKVGSSKTVDLPLPPEWGLAPSS  154



>gb|KDO35857.1| hypothetical protein CISIN_1g030378mg [Citrus sinensis]
Length=178

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC++ ++    LSGVKV VKC   K +AMATT+  GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSNDYD----LSGVKVLVKCNHLKKLAMATTQVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F   CP N
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPSN  134

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K    G     G SKTVDLPLP EWGL P+S
Sbjct  135  VKDSKCGAANKFGSSKTVDLPLPPEWGLAPSS  166



>ref|XP_006424206.1| hypothetical protein CICLE_v10029378mg [Citrus clementina]
 gb|ESR37446.1| hypothetical protein CICLE_v10029378mg [Citrus clementina]
Length=178

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC+  ++    LSGVKV VKC   K +AMATT+  GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSKDYD----LSGVKVLVKCNHLKKLAMATTQVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F   CP N
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPSN  134

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K    G     G SKTVDLPLP EWGL P+S
Sbjct  135  VKDSKCGAANKFGSSKTVDLPLPPEWGLAPSS  166



>ref|XP_007015774.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY33393.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=175

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 84/155 (54%), Gaps = 20/155 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV +G ++CLDCT  ++     SG+KV VKC   K +A A T+E+GSF+   +   +   
Sbjct  25   HVLEGKISCLDCTRDYD----FSGIKVQVKCAQVKKLATANTQENGSFK-VELPSDTSKT  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
                +C AK+LG   QLY   +   SKVV      ++     Y  T S PL F T CP  
Sbjct  80   PRAETCLAKLLGGPDQLYAWKRNLVSKVV------KAHELNSY--TISTPLAFSTTCPLA  131

Query  479  --NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              +AKC   G    IG SKTV+LPLP EWGL P+S
Sbjct  132  SRDAKC---GAPTEIGSSKTVNLPLPPEWGLAPSS  163



>ref|XP_006487907.1| PREDICTED: uncharacterized protein LOC102623586 [Citrus sinensis]
Length=178

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+C DC++ ++    LSGVKV VKC   K +AMATT   GSF+  +   ++   
Sbjct  27   EVLKGKVSCSDCSNDYD----LSGVKVLVKCNHVKKLAMATTLVSGSFKVNLPSDAAMKT  82

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
             S + C AK+ G   QLY   K   SKV+      +  +S  Y ++T  PL F   CP N
Sbjct  83   PSPLHCHAKLFGGPVQLYASKKNMVSKVM------KPKNSNSYKIST--PLAFSISCPSN  134

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             K    G     G SKTVDLPLP EWGL P+S
Sbjct  135  VKDSKCGAANKFGSSKTVDLPLPPEWGLAPSS  166



>gb|KHN32866.1| hypothetical protein glysoja_038795 [Glycine soja]
Length=174

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 81/152 (53%), Gaps = 15/152 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DC   ++     SG+KVSVKC G KN+AMATTE+ G F+    LPS ++ 
Sbjct  25   QTVEGKVSCTDCADNYD----FSGIKVSVKCEGVKNLAMATTEDKGFFQVD--LPSDQTK  78

Query  305  ssvvscsAKILGA-TRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPN  481
               V+C  K+LG     LY   K   S++V     G+  ++     T S PL F+T CP 
Sbjct  79   PPSVNCFTKLLGGPNTNLYASKKNLVSQIV----KGKEKNT----YTISTPLSFFTSCPQ  130

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                        G SKT DLPLPREWGL P+S
Sbjct  131  NTECKAANYNQFGSSKTFDLPLPREWGLAPSS  162



>ref|XP_002313489.1| hypothetical protein POPTR_0009s02440g [Populus trichocarpa]
 gb|ABK96060.1| unknown [Populus trichocarpa]
 gb|EEE87444.1| hypothetical protein POPTR_0009s02440g [Populus trichocarpa]
Length=173

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 84/153 (55%), Gaps = 18/153 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+CLDC   +++    S +KV VKC   + +A  TT+ DGSFE   + P + + 
Sbjct  25   QVLKGKVSCLDCGGHYDY----SEIKVGVKCDKVRKLATTTTQSDGSFEV-KLPPGTSTA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
            ++ + C AK+LG   QLY+  +   SK+V      ++  S  Y  T S PL F + C   
Sbjct  80   ATPLICLAKLLGGPSQLYVSRQNMVSKIV------QTHDSNSY--TISTPLAFSSTCSAG  131

Query  479  NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              KC   G     G SKTVDLPLPREWGL P+S
Sbjct  132  GGKC---GVSNQFGSSKTVDLPLPREWGLAPSS  161



>ref|XP_002523833.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38559.1| conserved hypothetical protein [Ricinus communis]
Length=169

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 81/151 (54%), Gaps = 18/151 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V K  V+CLDCT  ++     SG+KV VKC   K +A  TT+  GSFE   +   +   
Sbjct  25   QVLKAKVSCLDCTAHYD----FSGIKVLVKCANVKKLATTTTKSKGSFEV-ELPSGNSKA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
             + ++C AK++G T Q+Y   K   S++V      ++  S  Y  T S PL F T  P  
Sbjct  80   ETPLNCLAKLIGGTSQIYATRKNMVSRIV------KTKDSSSY--TISTPLAFSTAFPEG  131

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
            +       G IG SKTVDLPLPREWGL P+S
Sbjct  132  QL-----KGGIGESKTVDLPLPREWGLAPSS  157



>gb|AFK40698.1| unknown [Lotus japonicus]
Length=172

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V  G V+C+DCT  H+    LS +KV VKC G K +A+A+TE++G F+   +      P
Sbjct  25   QVVNGKVSCVDCTQNHD----LSDIKVLVKCEGVKKLALASTEDNGFFKVD-LPSDKTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SS  +C AK++G   QLY   +   S+++      +S     Y  T S PL F   CP N
Sbjct  80   SSAGNCLAKLVGGPVQLYATRQNQVSQII------KSQEPNSY--TISTPLSFMKSCPQN  131

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C        +G SKTVDLPLP EWGL P+S
Sbjct  132  TNC---KAAKPVGSSKTVDLPLPPEWGLAPSS  160



>gb|AFK41233.1| unknown [Lotus japonicus]
Length=172

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V  G V+C+DCT  H+    LS +KV VKC G K +A+A+TE++G F+   +      P
Sbjct  25   QVVNGKVSCVDCTQNHD----LSDIKVLVKCEGVKKLALASTEDNGFFKVD-LPSDKTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SS  +C AK++G   QLY   +   S+++      +S     Y  T S PL F   CP N
Sbjct  80   SSAGNCLAKLVGGPVQLYATRQNQVSQII------KSQEPNSY--TISTPLSFMKSCPQN  131

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C        +G SKTVDLPLP EWGL P+S
Sbjct  132  TNC---KAAKPVGSSKTVDLPLPPEWGLAPSS  160



>ref|NP_001234951.1| uncharacterized protein LOC100306432 precursor [Glycine max]
 gb|ACU14606.1| unknown [Glycine max]
Length=174

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 75/151 (50%), Gaps = 13/151 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DC   ++     SG+KVSVKC G KN+AMATTE+ G F    +      P
Sbjct  25   QTVEGKVSCTDCADNYD----FSGIKVSVKCEGVKNLAMATTEDKG-FSQVDLPSDQTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
             SV   +  + G    LY   K   S++V     G+  ++     T S PL F+T CP  
Sbjct  80   PSVNCFTKLLGGPNTNLYASKKNLVSQIV----KGKEKNT----YTISTPLSFFTSCPQN  131

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
                       G SKT DLPLPREWGL P+S
Sbjct  132  TECKAANYNQFGSSKTFDLPLPREWGLAPSS  162



>ref|XP_012076135.1| PREDICTED: uncharacterized protein LOC105637309 [Jatropha curcas]
 gb|KDP34426.1| hypothetical protein JCGZ_12707 [Jatropha curcas]
Length=169

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 81/151 (54%), Gaps = 19/151 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + K +V+CL C   ++    LSG+K++VKC   K +A  TT   GSFE  +   +S++ 
Sbjct  26   QILKANVSCLQCISHYD----LSGIKIAVKCENVKRIATTTTRSKGSFEVKLPSETSRNH  81

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
             + ++C AK++G   Q+    K   SK+V      ++ HS     T S PL F T CP A
Sbjct  82   QTPLNCLAKLIGGKNQICASRKNMVSKIV---KTQKNSHS----YTISTPLAFSTTCPKA  134

Query  485  KCVggggggsiggsKTVDLPLPREWGLPPTS  577
                       G SKTVDLPLPREWGL P+S
Sbjct  135  --------AGFGSSKTVDLPLPREWGLAPSS  157



>gb|KJB54179.1| hypothetical protein B456_009G084200 [Gossypium raimondii]
Length=175

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 78/151 (52%), Gaps = 18/151 (12%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
                ++C DC H ++     SG++V+VKC   K +A ATTEE+GSF+         S  S
Sbjct  29   LNAKISCFDCPHNYD----FSGIQVAVKCEKVKKLATATTEENGSFKV-----QLPSGIS  79

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKC  490
              +C AK+LG   QLY   K   SKVV     G   ++     T S PL F T CP+A  
Sbjct  80   NTNCLAKLLGGPNQLYSKKKNLVSKVV---KVGHQPNT----YTLSTPLAFSTSCPSASI  132

Query  491  Vggg--gggsiggsKTVDLPLPREWGLPPTS  577
                      IG SKTVDLPLP EWGL P+S
Sbjct  133  DAKSCGAQKGIGSSKTVDLPLPPEWGLAPSS  163



>ref|XP_011014926.1| PREDICTED: uncharacterized protein LOC105118643 [Populus euphratica]
Length=173

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 83/153 (54%), Gaps = 18/153 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KG V+CLDC   +++    S +KV VKC   + +A  TT+ DGSFE   + P S + 
Sbjct  25   QVLKGKVSCLDCGGHYDY----SEIKVGVKCDKVRKLATTTTQSDGSFEV-KLPPGSSTA  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP--  478
            ++ + C AK+LG   QLY+  +   SK+V      ++  S  Y  T S PL F + C   
Sbjct  80   ATPLICLAKLLGGPSQLYVSRQNMVSKIV------QTHDSNSY--TISTPLSFSSTCSAG  131

Query  479  NAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              KC   G     G SKT DLPLPREWGL P+S
Sbjct  132  GGKC---GVSNEFGSSKTFDLPLPREWGLAPSS  161



>ref|XP_007150057.1| hypothetical protein PHAVU_005G122600g [Phaseolus vulgaris]
 gb|ESW22051.1| hypothetical protein PHAVU_005G122600g [Phaseolus vulgaris]
Length=174

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 80/152 (53%), Gaps = 17/152 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
               +G V+C DCTH ++     SG+ +SVKC G KN+AMA TEE G F+    LP   + 
Sbjct  25   QTLEGKVSCTDCTHNYD----FSGIMISVKCEGVKNLAMAITEEKGFFKVD--LPRDHTK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
               V+C  K+LG    LY   K   S++V     G+  ++     T S PL F T CP N
Sbjct  79   PPSVNCVVKLLGGPNHLYATKKNKVSEIV----KGKEKNT----YTISTPLSFLTSCPQN  130

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             +C         G SKT+D PLP EWGL P+S
Sbjct  131  TEC--KATKNQFGSSKTLDFPLPPEWGLAPSS  160



>gb|AFK37535.1| unknown [Lotus japonicus]
Length=149

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 84/150 (56%), Gaps = 19/150 (13%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAM-ATTEEDGSFETTvvlpsskspss  310
            KG+V+C DCT  ++     SG+KVSVKC G +N A+  TTEEDGSF+    LPS  + S 
Sbjct  3    KGNVSCTDCTDNYD----FSGIKVSVKCEGVQNKALTTTTEEDGSFKV--HLPSHYAKSP  56

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-NAK  487
             + C AK+LG    LY   K   ++V +   A E +     I T S PL F+T CP N++
Sbjct  57   SMKCLAKLLGGPDLLYASRK---NRVSLIVKAKEEN-----IYTISTPLSFFTYCPQNSE  108

Query  488  CVggggggsiggsKTVDLPLPREWGLPPTS  577
            C         G SKT D P+P  WGL P+S
Sbjct  109  C---KAANEFGSSKTFDFPMPPAWGLAPSS  135



>gb|KHG28557.1| Bile acid-inducible operon CD [Gossypium arboreum]
Length=175

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 77/147 (52%), Gaps = 18/147 (12%)
 Frame = +2

Query  143  VTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvvsc  322
            ++C DC H ++     SG++V+VKC   K +A ATTEE+GSF+         S  S  +C
Sbjct  33   ISCFDCPHNYD----FSGIQVAVKCEKVKKLATATTEENGSFKV-----QLPSGISNPNC  83

Query  323  sAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVggg  502
             AK+LG   QLY   K   SKVV      +  H  +   T S PL F T CP A      
Sbjct  84   LAKLLGGPNQLYSKKKNLVSKVV------KVGHQLN-TYTLSTPLAFSTSCPLASVDAKS  136

Query  503  --gggsiggsKTVDLPLPREWGLPPTS  577
                  IG SKTVDLPLP EWGL P+S
Sbjct  137  CGAQKGIGSSKTVDLPLPPEWGLAPSS  163



>ref|XP_004487486.1| PREDICTED: uncharacterized protein LOC101502277 [Cicer arietinum]
Length=172

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 80/152 (53%), Gaps = 19/152 (13%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DCT  ++     SG+KVSVKC G +N+A+ATT++DGSF     + +  + 
Sbjct  26   QIVKGKVSCTDCTQDYD----FSGIKVSVKCEGVQNLAVATTQDDGSFMVD--ISTYHAK  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
                +C AKILG    LY   K   S+ +V+   G S        T S P+ F T CP N
Sbjct  80   LPYDNCLAKILGGPNYLYASRKNQFSQ-IVKGKDGNS-------YTISTPISFLTSCPQN  131

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
             +C        I  SKT++  LP EWGL P S
Sbjct  132  KEC---KDENQIDSSKTINF-LPPEWGLAPAS  159



>gb|EPS71447.1| hypothetical protein M569_03316, partial [Genlisea aurea]
Length=180

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 76/152 (50%), Gaps = 15/152 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             V KGSV+C DC    +    LSG++V +KC G K ++MA T+  G F+   +   +  P
Sbjct  31   SVVKGSVSCADCKPGSD----LSGIQVLMKCDGVKKLSMAYTDTRGRFQAD-LPSDAAPP  85

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
                +C AKI+G   QLY+  KA E+ V V          R  +   S+P+ F   CP  
Sbjct  86   PPSSNCMAKIMGGPYQLYV--KASEASVPV-----SRTQRRAGVFAVSKPMSFVRDCPAG  138

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
              C  G        S TV LPLP+EWGL P+S
Sbjct  139  GNC--GAKDAGFVSSDTVGLPLPKEWGLAPSS  168



>gb|KJB54178.1| hypothetical protein B456_009G084200 [Gossypium raimondii]
Length=170

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 73/151 (48%), Gaps = 23/151 (15%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
                ++C DC H ++          SVKC   K +A ATTEE+GSF+         S  S
Sbjct  29   LNAKISCFDCPHNYDF---------SVKCEKVKKLATATTEENGSFKV-----QLPSGIS  74

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKC  490
              +C AK+LG   QLY   K   SKVV     G   ++     T S PL F T CP+A  
Sbjct  75   NTNCLAKLLGGPNQLYSKKKNLVSKVV---KVGHQPNT----YTLSTPLAFSTSCPSASI  127

Query  491  Vggg--gggsiggsKTVDLPLPREWGLPPTS  577
                      IG SKTVDLPLP EWGL P+S
Sbjct  128  DAKSCGAQKGIGSSKTVDLPLPPEWGLAPSS  158



>ref|XP_004139493.1| PREDICTED: uncharacterized protein LOC101207654 [Cucumis sativus]
 gb|KGN64941.1| hypothetical protein Csa_1G165730 [Cucumis sativus]
Length=178

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 76/152 (50%), Gaps = 13/152 (9%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +  K  ++CLDC   ++     SG  + VKC   KN+ +A T+ DGSFET++    +   
Sbjct  27   NTLKAKISCLDCQSNYD----FSGNLIMVKCERAKNLTIAITKADGSFETSLPSNMASEA  82

Query  305  ssvvsc-sAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPN  481
            +       AK+LG + QL+   K   S ++      +  +S+ + + T+  L+F T    
Sbjct  83   APSSPKCIAKLLGGSHQLFASRKEMVSTII------KETNSKFFTIATA--LKFSTCKEI  134

Query  482  AKCVggggggsiggsKTVDLPLPREWGLPPTS  577
            ++        S+  SKT D PLP EWG PPTS
Sbjct  135  SRNCKAIKKESVEDSKTFDFPLPPEWGFPPTS  166



>ref|XP_010271608.1| PREDICTED: uncharacterized protein LOC104607635 [Nelumbo nucifera]
Length=179

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 82/158 (52%), Gaps = 22/158 (14%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            H  KGSV+CLDCTH  +    LSG+KV VKC   K ++MATT+  GSFET      + S 
Sbjct  25   HQVKGSVSCLDCTHHES----LSGLKVVVKCDKVKKLSMATTDNTGSFET---ELPTDSS  77

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNA  484
                +C AK+LG  RQL    K   SK+V    A E+D       T S PL FYT C   
Sbjct  78   VPSSNCLAKLLGGPRQLCSYKKNLVSKIV---KAHETDA-----YTISTPLNFYTSCSQE  129

Query  485  K-------CVggggggsiggsKTVDLPLPREWGLPPTS  577
                             IG SKT+++PLP EWGL P+S
Sbjct  130  SKNPSSPSSSSSTQTPEIGSSKTINIPLPPEWGLAPSS  167



>ref|NP_001237809.1| uncharacterized protein LOC100305605 precursor [Glycine max]
 gb|ACU13371.1| unknown [Glycine max]
Length=134

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (58%), Gaps = 14/123 (11%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + +G V C+DCTH ++    LS +KVSV+C G K +A+ATTE DGSF+   +      P
Sbjct  25   QMVQGRVFCVDCTHNYD----LSDIKVSVRCDGVKKLALATTENDGSFKVD-LPLDHTKP  79

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCP-N  481
            SSV +C AK+LG   QLY+  +   S+++     G+  +S     T S PL F T CP N
Sbjct  80   SSVKNCLAKLLGGPVQLYVSRENQVSQII----KGKEQNS----YTISTPLSFRTSCPLN  131

Query  482  AKC  490
             KC
Sbjct  132  TKC  134



>ref|XP_008461260.1| PREDICTED: uncharacterized protein LOC103499896 [Cucumis melo]
Length=184

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 78/157 (50%), Gaps = 19/157 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            +  K  ++CLDC   ++     SG  + VKC   KN+ +A T+ DGSFET +    +   
Sbjct  29   NTLKAKISCLDCQSNYD----FSGNLIMVKCERVKNLTIAITKADGSFETPLPSDMASVD  84

Query  305  ssvvsc----sAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYT-  469
            S          AK++G + QL+   K   S ++      +  +S+ + + T+  LRF T 
Sbjct  85   SEAAPPPPKCIAKLVGGSHQLFASRKELVSTII------KETNSKFFTIATA--LRFSTC  136

Query  470  KCPNAKCVggggggsiggsKTVDLP-LPREWGLPPTS  577
            K  N KC       SI  SKT DLP LP EWG PPTS
Sbjct  137  KEINRKC-KAIKKESIEDSKTFDLPNLPPEWGFPPTS  172



>ref|XP_010421032.1| PREDICTED: uncharacterized protein LOC104706531 [Camelina sativa]
Length=172

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 70/147 (48%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC H  +     SG++V VKC GEK    A    DGSF T      +      +
Sbjct  31   GKVSCLDCHHDFD----FSGIRVLVKCDGEKKQITAMAASDGSFLTV---LPAAYKKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V+      S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELVM------SKHDSK-VLTTSNPLPFSLSCP--KPTE  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNVGNMIGDSKTVNFPGAGGFGFPPAS  161



>ref|XP_010493327.1| PREDICTED: uncharacterized protein LOC104770577 [Camelina sativa]
Length=172

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 70/147 (48%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKVSCLDCHRNFD----FSGIKVLIKCNGEKKQITAMAASDGSFRSV---LPAAEKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY    +  S++V+      S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPEQLYAHKHSMVSELVM------SKHDSK-VLTTSNPLAFSLSCP--KPTE  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNLGNMIGDSKTVNFPGAGGFGFPPAS  161



>ref|XP_010454505.1| PREDICTED: uncharacterized protein LOC104736250 [Camelina sativa]
Length=172

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 69/147 (47%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SG+KV VKC GEK    A    DGSF +      +      +
Sbjct  31   GKVSCLDCHRDFD----FSGIKVLVKCDGEKKQITAMASSDGSFRSV---LPAADKKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V+      S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELVM------SKHDSK-VLTTSNPLAFSLSCP--KPTE  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNVGTMIGDSKTVNFPGAGGFGFPPAS  161



>gb|AAM65948.1| unknown [Arabidopsis thaliana]
Length=172

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 70/147 (48%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC H  +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKISCLDCHHDFD----FSGIKVLLKCDGEKKQITAMAAADGSFRSV---LPTADKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV------KSKHDSK-VLTTSNPLAFSLSCP--KPSR  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKT++ P    +G PP S
Sbjct  135  DDIGSMIGDSKTINFPGAGGFGFPPAS  161



>ref|XP_006400748.1| hypothetical protein EUTSA_v10014830mg [Eutrema salsugineum]
 gb|ESQ42201.1| hypothetical protein EUTSA_v10014830mg [Eutrema salsugineum]
Length=172

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 68/145 (47%), Gaps = 16/145 (11%)
 Frame = +2

Query  143  VTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvvsc  322
            VTCLDC H  +     SGVKV +KC GEK      T  DG+F +      +      + C
Sbjct  33   VTCLDCHHDFD----FSGVKVLLKCDGEKKTITVMTASDGTFRSV---LPTADNKRSMKC  85

Query  323  sAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVggg  502
             AK+LG   QLY       S++V+      S H+   + TTS PL F   CP  K  G  
Sbjct  86   LAKLLGGPEQLYAHRHNLVSELVM------SKHNSK-VFTTSNPLSFSLSCP--KPTGDN  136

Query  503  gggsiggsKTVDLPLPREWGLPPTS  577
                IG SKTV+ P    +G PP S
Sbjct  137  VEDVIGDSKTVNFPGTGGFGFPPAS  161



>ref|XP_006288782.1| hypothetical protein CARUB_v10002103mg [Capsella rubella]
 gb|EOA21680.1| hypothetical protein CARUB_v10002103mg [Capsella rubella]
Length=172

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 69/147 (47%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKVSCLDCHRDFD----FSGIKVLLKCDGEKKQITAMAASDGSFRSV---LPAADKKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V+      S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPDQLYAHKHDLFSELVM------SKHDSK-VLTTSNPLAFSLSCP--KPTQ  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNVGDMIGDSKTVNFPGMGSFGFPPAS  161



>ref|XP_006408713.1| hypothetical protein EUTSA_v10002110mg [Eutrema salsugineum]
 gb|ESQ50166.1| hypothetical protein EUTSA_v10002110mg [Eutrema salsugineum]
Length=163

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 71/150 (47%), Gaps = 26/150 (17%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            + KG V+C DC H +++    SG+ +SV C   K     +T++ G F + +      +  
Sbjct  28   LIKGKVSCFDCPHDYDY----SGIMISVSCSHTKTRFTVSTDKKGEFMSELPSRDKSNCE  83

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAK  487
                  A++ G+ +QLY   +  +SK+V      E D         S  L F   CP + 
Sbjct  84   ------AELQGSFKQLYASTRNVKSKIVKL----EGDK-----YGLSSKLIFLKSCPRS-  127

Query  488  CVggggggsiggsKTVDLPLPREWGLPPTS  577
                   GS G SKTVDLP+P EWGL PTS
Sbjct  128  ------LGSFGSSKTVDLPVPPEWGLAPTS  151



>ref|NP_568418.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAK44030.1|AF370215_1 unknown protein [Arabidopsis thaliana]
 dbj|BAB08342.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL15213.1| unknown protein [Arabidopsis thaliana]
 gb|AED93025.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 69/147 (47%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC    +     SG+KV +KC GEK    A    DGSF +      +      +
Sbjct  31   GKISCLDCHRDFD----FSGIKVLLKCDGEKKQITAVAAADGSFRSV---LPTADKKGSI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F   CP  K   
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV------KSKHDSK-VLTTSNPLAFSLSCP--KPSR  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKT++ P    +G PP S
Sbjct  135  DDIGSMIGDSKTINFPGAGGFGFPPAS  161



>emb|CDY35685.1| BnaC02g09510D [Brassica napus]
Length=171

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 71/150 (47%), Gaps = 16/150 (11%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            +F G V+CLDC    +     SGVKV +KC GEK         DGSF +      +    
Sbjct  27   LFHGKVSCLDCHRGFD----FSGVKVLLKCEGEKKHITTMATSDGSFRSV---LPTNDRK  79

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAK  487
              ++C AK+LG   QLY       S++V      +S H    ++TTS PL F   CP  K
Sbjct  80   HSMNCLAKLLGGPEQLYAHKHNMVSELV------KSKHDTK-VLTTSNPLSFSLSCP--K  130

Query  488  CVggggggsiggsKTVDLPLPREWGLPPTS  577
              G   G  IG SKTV+ P    +G PP S
Sbjct  131  PTGDNVGNMIGDSKTVNFPGTGGFGFPPAS  160



>ref|XP_009126543.1| PREDICTED: uncharacterized protein LOC103851442 [Brassica rapa]
Length=172

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 70/147 (48%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC +  +     SGVKV +KC GEK         DGSF +      +      +
Sbjct  31   GKVSCLDCHNDFD----FSGVKVLLKCEGEKKTITTMATSDGSFRSV---LLTADKKRSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C AK+LG   QLY       S++V      +S H    ++TTS PL F   CP  K  G
Sbjct  84   NCLAKLLGGPEQLYAHKHNMVSELV------KSKHDTK-VLTTSNPLSFSLSCP--KPTG  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNVGNMIGDSKTVNFPGTGGFGFPPAS  161



>ref|XP_002872002.1| hypothetical protein ARALYDRAFT_351266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48261.1| hypothetical protein ARALYDRAFT_351266 [Arabidopsis lyrata subsp. 
lyrata]
Length=172

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 68/149 (46%), Gaps = 20/149 (13%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G ++CLDC    +     SG+KV +KC GEK    A    DGSF +      +       
Sbjct  31   GKISCLDCHRDFD----FSGIKVLLKCDGEKKQITAMAASDGSFRSV---LPTADKKGSE  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRH--YIMTTSEPLRFYTKCPNAKC  490
            +C AK+LG   QLY       S++V         +S+H   ++T S PL F   CP  K 
Sbjct  84   NCLAKLLGGPEQLYAHKHNLVSELV---------NSKHDSKVLTISNPLAFSLSCP--KP  132

Query  491  VggggggsiggsKTVDLPLPREWGLPPTS  577
                 G  IG SKT++ P    +G PP S
Sbjct  133  TQDDVGSMIGDSKTINFPGAGGFGFPPAS  161



>ref|XP_006845425.1| PREDICTED: uncharacterized protein LOC18435316 [Amborella trichopoda]
 gb|ERN07100.1| hypothetical protein AMTR_s00019p00092150 [Amborella trichopoda]
Length=186

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 74/161 (46%), Gaps = 20/161 (12%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            HV +  ++CLDCT    H     GV + +KC  EK + +A T+  GSF+   +  S  S 
Sbjct  24   HVVEDQISCLDCTKHQAH-----GVGLVIKCDSEKPI-LAVTDRTGSFKA-EITTSKTSA  76

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC---  475
                +C A +LG   +L        SK V  A   +   S +Y + T  PL F +     
Sbjct  77   PLEDTCYASLLGPRNKLCSFKNNQASKFVKSAKYHKDPSSSYYALFT--PLSFSSSDCVS  134

Query  476  -------PNAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                   P+ K V          SKT+DLP+PREWGL PTS
Sbjct  135  MANRKIKPDFK-VEDTKQDGSKSSKTIDLPVPREWGLAPTS  174



>gb|KFK44754.1| hypothetical protein AALP_AA1G298500 [Arabis alpina]
Length=165

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 24/147 (16%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+C DC + +++    SG+ +S+ C   K     +T++ G F +          S   
Sbjct  30   GKVSCFDCPNDYDY----SGIMISISCSHSKTHFTVSTDKKGEFRS------KLPLSIEP  79

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            +C A++ G+ +QLY      ++K+V     GE++         S  L F   CP +    
Sbjct  80   NCEAELQGSFKQLYASKTNVKAKIV--KLTGENNK-----YGLSSKLIFLKSCPRS----  128

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
                GS   SKT+D P+PREWGL PTS
Sbjct  129  ---LGSFASSKTIDFPVPREWGLAPTS  152



>gb|AFK49274.1| unknown [Medicago truncatula]
Length=112

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
             + KG V+C DC   ++     SG+KVS+KC G KNMAMATTE DGSF     L +S + 
Sbjct  25   QMVKGKVSCNDCAQDYD----FSGIKVSMKCEGVKNMAMATTENDGSFMVD--LSTSHAK  78

Query  305  ssvvscsAKILGATRQLYIPMKACESKVV  391
                +C AK+LG    LY   +   S++V
Sbjct  79   LPYDNCHAKLLGGPNNLYASRRNQFSQIV  107



>emb|CDY09139.1| BnaA02g05650D [Brassica napus]
Length=172

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 68/147 (46%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC    +     SGVKV ++C GEK         DGSF +      +      +
Sbjct  31   GKVSCLDCHRDFD----FSGVKVLLQCDGEKKPVTTLAASDGSFRSV---VQTADKKQEI  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
             C AK+LG   QLY       S++V      +S H    ++TTS PL F   CP  K  G
Sbjct  84   KCLAKLLGGPEQLYAHKHNMVSELV------KSKHDTT-VLTTSNPLSFTLSCP--KPTG  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
               G  IG SKTV+ P    +G PP S
Sbjct  135  DNVGNMIGNSKTVNFPGTGGFGFPPAS  161



>ref|XP_010521643.1| PREDICTED: uncharacterized protein LOC104800521 [Tarenaya hassleriana]
Length=165

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 65/148 (44%), Gaps = 28/148 (19%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKC-GGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            G V+C DC    +     SG+K+ V C    K   + TT + G F       +    ++ 
Sbjct  32   GKVSCSDCPDDFD----FSGIKIMVSCENTRKRFTVTTTNKKGDF------MAELPSANP  81

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
             S  A+I G   QLY   K  +S +V   A G  D         S PL F   CP+    
Sbjct  82   SSFVAEIRGGPTQLYGSRKNVKSNIV--KAYGRPDG-----YALSSPLIFSISCPSG---  131

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                   +G SKTVDLPLP EWGL PTS
Sbjct  132  -------LGSSKTVDLPLPPEWGLAPTS  152



>ref|NP_001158898.1| hypothetical protein precursor [Zea mays]
 gb|ACF84309.1| unknown [Zea mays]
 gb|AFW71695.1| hypothetical protein ZEAMMB73_204218 [Zea mays]
Length=225

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 64/119 (54%), Gaps = 13/119 (11%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKN----MAMATTEEDGSFETTvvlpssk  298
             +GSV CLDC   H+    LSGV V+VKC G+ +    +  A T+  G+F+       ++
Sbjct  42   LRGSVACLDCAEGHD----LSGVVVAVKCAGDGDGSAGLHAAQTDGRGNFDVA---VPAE  94

Query  299  spssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC  475
            + +S   C+A++LGAT QL  P     ++VV     G + +   Y++ +   L F+T+C
Sbjct  95   ASASGAPCAARVLGATEQLCAPWGLTVARVVPARGPGSASYPASYVLGSR--LAFFTRC  151



>ref|XP_004140163.2| PREDICTED: uncharacterized protein LOC101219078 [Cucumis sativus]
 gb|KGN48034.1| hypothetical protein Csa_6G425710 [Cucumis sativus]
Length=187

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 69/160 (43%), Gaps = 28/160 (18%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            ++ KG V CLDC  +++    LSG+ V  KC     +  ATT  DG FE  +     +  
Sbjct  35   YILKGKVLCLDCHASYD----LSGIVVMAKCEKVGKVVTATTAVDGGFEAELPSDECE--  88

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC---  475
                   A++ G   QLY   K   + +V     G SD     I   S PL F + C   
Sbjct  89   -------ARLAGGRNQLYASRKDIVAGIV--KGVGGSDE----IYGISTPLAFCSSCRCR  135

Query  476  ------PNAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                    A+       G  G SKT +LPLP EWG+ P+S
Sbjct  136  SIGASSTEAEKYCKADAGKFGSSKTFNLPLPPEWGMAPSS  175



>ref|XP_008449582.1| PREDICTED: uncharacterized protein LOC103491422 [Cucumis melo]
Length=189

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 70/160 (44%), Gaps = 28/160 (18%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            ++ KG V CLDC  +++    L+G+ V  KC     +  ATT +DG FE  +     +  
Sbjct  37   YILKGKVLCLDCHASYD----LAGIVVMAKCEKVGKVVTATTAKDGGFEAELPSDECE--  90

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC---  475
                   A++ G   QLY   K   + +V     G SD     I   S PL F + C   
Sbjct  91   -------ARLAGGRNQLYAATKDMVAGIV--KGVGGSDE----IYGISTPLAFCSSCRCR  137

Query  476  ------PNAKCVggggggsiggsKTVDLPLPREWGLPPTS  577
                    A+       G  G SKT +LPLP EWG+ P+S
Sbjct  138  SIGASSTEAEKYCKVVAGKFGSSKTFNLPLPPEWGMAPSS  177



>emb|CDY04490.1| BnaA07g13160D [Brassica napus]
Length=163

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 66/148 (45%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC   +++    SG+ +SV C   K     +T++ G F + +           
Sbjct  30   EGKVSCYDCPSDYDY----SGIMISVSCSHSKTRFTVSTDKKGEFMSELPSRVKSDCE--  83

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
                AK+ G+ +QLY   K   SK+V      E D         S  L F   CP +   
Sbjct  84   ----AKLQGSFKQLYASKKNIMSKIV----KLEGDK-----YGLSSKLIFLKSCPRS---  127

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                  S G SKTVDLP+P EWGL PTS
Sbjct  128  ----LRSFGSSKTVDLPVPPEWGLAPTS  151



>ref|NP_001144082.1| uncharacterized protein LOC100276913 precursor [Zea mays]
 gb|ACG37784.1| hypothetical protein [Zea mays]
Length=225

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 13/119 (11%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKN----MAMATTEEDGSFETTvvlpssk  298
             +GSV CLDC   H+    LSGV V+VKC G+ +    +  A T+  G+F+       + 
Sbjct  42   LRGSVACLDCDEEHD----LSGVVVAVKCAGDDDGGAGLHAAQTDGRGNFDVA---VPAA  94

Query  299  spssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKC  475
            + +S   C+A++LGAT QL  P     ++VV   A G + +   Y++ +   L F+T+C
Sbjct  95   ASASGAPCAARVLGATEQLCAPWGLTXARVVPARAPGSASYPASYVLGSR--LAFFTRC  151



>gb|KFK23135.1| hypothetical protein AALP_AAs65178U000400 [Arabis alpina]
Length=172

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 67/147 (46%), Gaps = 16/147 (11%)
 Frame = +2

Query  137  GSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvv  316
            G V+CLDC   ++     SG+KV +KC GEK       + DGSF++      +      +
Sbjct  31   GKVSCLDCHRDYD----FSGIKVLLKCDGEKKTVTTMADSDGSFQSA---LPTSKEKGSM  83

Query  317  scsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVg  496
            SC AK+LG   QLY    A +  +V      + D     + TTS  L F   CP  K  G
Sbjct  84   SCLAKLLGGPDQLY----AHKHNMVSELVKSKRDSK---VFTTSNSLSFSLSCP--KPTG  134

Query  497  gggggsiggsKTVDLPLPREWGLPPTS  577
                  IG  KT++ P    +G PP S
Sbjct  135  NNAEEMIGDYKTINFPGVGGFGFPPAS  161



>ref|XP_010931111.1| PREDICTED: uncharacterized protein LOC105052104 [Elaeis guineensis]
Length=194

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 59/119 (50%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksp  304
            H  KGSV C DCT +HN    L+GV V+VKC  EK +  A T   G FE  +   SS   
Sbjct  26   HSLKGSVACFDCT-SHN----LAGVFVAVKCNHEKRLLPALTNNKGYFEVEIPTKSSPPS  80

Query  305  ssvvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPN  481
            SS   C  ++LG   QL    K+  SK+V      ES     Y + T  PL F+  CP+
Sbjct  81   SSPPDCLVRLLGGPEQLCSFKKSMTSKIVKAQGLEES-----YALAT--PLTFFRSCPS  132



>emb|CDX71455.1| BnaC04g16900D [Brassica napus]
Length=163

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 66/150 (44%), Gaps = 26/150 (17%)
 Frame = +2

Query  128  VFKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpssksps  307
            + +G V+C DC   +++    SG+ +SV C   K     +T++ G F + +         
Sbjct  28   LVEGKVSCYDCPSDYDY----SGIMISVSCSHSKTRFTVSTDKKGEFMSELPSRVKSDCE  83

Query  308  svvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAK  487
                  A++ G+ +QLY   K   SK+V      E D         S  L F   CP + 
Sbjct  84   ------AELQGSFKQLYASKKNIMSKIV----KLEGDK-----YGLSSKLIFLKSCPRS-  127

Query  488  CVggggggsiggsKTVDLPLPREWGLPPTS  577
                    S   SKTVDLP+P EWGL PTS
Sbjct  128  ------LRSFSSSKTVDLPVPPEWGLAPTS  151



>ref|XP_006293390.1| hypothetical protein CARUB_v10024152mg, partial [Capsella rubella]
 gb|EOA26288.1| hypothetical protein CARUB_v10024152mg, partial [Capsella rubella]
Length=179

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 65/148 (44%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC + +++    SG+ V V C   K     TT++ G F +          S  
Sbjct  46   EGKVSCFDCPNDYDY----SGITVGVSCSDSKTRFTVTTDKKGEFMS------ELPSSVK  95

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
             +C A++ G+ +QLY      +SK+V          S+         L F   CP +   
Sbjct  96   SNCEAELKGSFKQLYASKNNVKSKIVNLGGDKYGLSSK---------LIFLKSCPRS---  143

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 G    SKTVD P+P EWGL PTS
Sbjct  144  ----LGPFSSSKTVDFPVPPEWGLAPTS  167



>ref|NP_850100.2| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AEC07988.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=173

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 65/148 (44%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC + +++    SG+ V V C         TT++ G F       S       
Sbjct  40   EGKVSCFDCPNDYDY----SGITVGVSCSHTNTRFTVTTDKKGDF------ISELPSKIE  89

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
             +C A++ G+ +QLY      +SK+V          S+         L F   CP +   
Sbjct  90   SNCEAELQGSVKQLYASKNNVKSKIVKLGGDKYGLSSK---------LFFLKSCPRS---  137

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 GS   SKTVDLP+P EWGL PTS
Sbjct  138  ----FGSFSSSKTVDLPVPPEWGLAPTS  161



>ref|NP_001189617.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 ref|NP_001189618.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAS65937.1| At2g27385 [Arabidopsis thaliana]
 gb|AAS88776.1| At2g27385 [Arabidopsis thaliana]
 dbj|BAF01424.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07989.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AEC07990.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=162

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 65/148 (44%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC + +++    SG+ V V C         TT++ G F       S       
Sbjct  29   EGKVSCFDCPNDYDY----SGITVGVSCSHTNTRFTVTTDKKGDF------ISELPSKIE  78

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
             +C A++ G+ +QLY      +SK+V          S+         L F   CP +   
Sbjct  79   SNCEAELQGSVKQLYASKNNVKSKIVKLGGDKYGLSSK---------LFFLKSCPRS---  126

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 GS   SKTVDLP+P EWGL PTS
Sbjct  127  ----FGSFSSSKTVDLPVPPEWGLAPTS  150



>ref|XP_009103596.1| PREDICTED: uncharacterized protein LOC103829663 [Brassica rapa]
Length=163

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 64/143 (45%), Gaps = 26/143 (18%)
 Frame = +2

Query  149  CLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssvvscsA  328
            C DC   +++    SG+ +SV C   K     +T++ G F + +               A
Sbjct  35   CYDCPSDYDY----SGIMISVSCSHSKTRFTVSTDKKGEFMSELPSRVKSDCE------A  84

Query  329  KILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCVggggg  508
            K+ G+ +QLY   K   SK+V      E D    Y++++   L F   CP          
Sbjct  85   KLQGSFKQLYASKKNIMSKIV----KLEGDK---YVLSSK--LIFLKSCPR-------NL  128

Query  509  gsiggsKTVDLPLPREWGLPPTS  577
             S   SKTVDLP+P EWGL PTS
Sbjct  129  RSFSSSKTVDLPVPPEWGLAPTS  151



>ref|XP_002880912.1| At2g27385 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57171.1| At2g27385 [Arabidopsis lyrata subsp. lyrata]
Length=162

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 70/148 (47%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC + +++    SG+ V V C   K     TT++ G F + +      +    
Sbjct  29   EGKVSCFDCPNDYDY----SGIMVGVSCSHTKTHFTVTTDKKGEFMSKLPSSIESNCE--  82

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
                A++ G+ +QLY      +SK+V      + D  ++ +   S  L F    P +   
Sbjct  83   ----AELQGSFKQLYASKNNIKSKIV------KLDGDKYCL---SSKLIFLKSYPRS---  126

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 GS G SKTVDLP+P EWGL PTS
Sbjct  127  ----LGSFGSSKTVDLPVPPEWGLAPTS  150



>ref|XP_003581209.1| PREDICTED: uncharacterized protein LOC100827343 [Brachypodium 
distachyon]
Length=224

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 57/122 (47%), Gaps = 20/122 (16%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
             +G+V CLDC    N    LSGV V+VKC     +  A T+  G FE       +     
Sbjct  31   LRGTVACLDCAQQRN----LSGVVVAVKCANGTGVRAAETDGQGRFEVA---VPASRSKP  83

Query  311  vvscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSR----HYIMTTSEPLRFYTKCP  478
               C+A+ILG   QL  P +   S+VVV        H+R     Y +T+  PL  +T+C 
Sbjct  84   GSPCAARILGGPEQLCAPPRFAASRVVVA-------HARPGGGSYALTS--PLGVFTQCG  134

Query  479  NA  484
            +A
Sbjct  135  SA  136



>ref|XP_010473133.1| PREDICTED: uncharacterized protein LOC104752641 [Camelina sativa]
Length=164

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 65/148 (44%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC   +++    SG+ V V C         TT++ G F + +      +    
Sbjct  31   EGKVSCFDCPSDYDY----SGITVRVSCSHINTRFTVTTDKKGEFMSELPSRVKSNCE--  84

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
                A++ G+ +QLY      +SK+V      E D         S  L F   CP +   
Sbjct  85   ----AELQGSFKQLYASKNNVKSKIVKL----EGDK-----YGLSSKLIFLKSCPRS---  128

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 GS G SKTVD P+P EWGL PTS
Sbjct  129  ----LGSFGSSKTVDFPVPPEWGLAPTS  152



>gb|EMT13967.1| hypothetical protein F775_04212 [Aegilops tauschii]
Length=191

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 11/108 (10%)
 Frame = +2

Query  125  HVFKGSVTCLDCTHTHNHPPHLSGVKVSVKC-GGEKNMAMATTEEDGSFETTvvlpssks  301
               +GSVTCLDC   H    HLSGV V+V+C GG     +A T+  G+F           
Sbjct  31   QTLRGSVTCLDCPAGH----HLSGVVVTVECSGGAGPHVVARTDGGGNFGVA-----VPE  81

Query  302  pssvvscsAKILGATRQLYIPMKACESKVVVRAAAGE-SDHSRHYIMT  442
                  C A++LG T QL  P +   ++VVV    G  +  SR  + T
Sbjct  82   SVLASRCPARVLGGTEQLCAPRRLTVARVVVAGRPGSYARGSRSAVFT  129



>ref|XP_010513307.1| PREDICTED: uncharacterized protein LOC104789279 [Camelina sativa]
Length=264

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 65/148 (44%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC   +++    SG+ V V C         TT++ G F + +      +    
Sbjct  131  EGKVSCFDCPSDYDY----SGITVRVSCSHRNTRFTVTTDKKGEFMSELPSRVKSNCE--  184

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
                A++ G+ +QLY      +SK+V     G+           S  L F   CP     
Sbjct  185  ----AELQGSFKQLYASKNNVKSKIV--KLGGDK-------YGLSSKLIFLKSCPR----  227

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 GS G SKTVD+P+P EWGL PTS
Sbjct  228  ---NLGSFGSSKTVDIPVPPEWGLAPTS  252



>ref|XP_010417895.1| PREDICTED: uncharacterized protein LOC104703563 [Camelina sativa]
Length=164

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 63/148 (43%), Gaps = 26/148 (18%)
 Frame = +2

Query  134  KGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspssv  313
            +G V+C DC   +++    SG+ V V C         TT++ G F + +      +    
Sbjct  31   EGKVSCFDCPSDYDY----SGITVRVSCSHMNTRFTVTTDKKGEFMSELPSRVKSNCE--  84

Query  314  vscsAKILGATRQLYIPMKACESKVVVRAAAGESDHSRHYIMTTSEPLRFYTKCPNAKCV  493
                A++ G+ +QLY      +SK+V          S+         L F   CP +   
Sbjct  85   ----AELQGSFKQLYAFKNNAKSKIVKLGGDKYGLSSK---------LIFLKSCPRS---  128

Query  494  ggggggsiggsKTVDLPLPREWGLPPTS  577
                 G  G SKTVD P+P EWGL PTS
Sbjct  129  ----LGPFGSSKTVDFPVPPEWGLAPTS  152



>ref|XP_010236804.1| PREDICTED: uncharacterized protein LOC104584272 [Brachypodium 
distachyon]
Length=191

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 41/78 (53%), Gaps = 10/78 (13%)
 Frame = +2

Query  131  FKGSVTCLDCTHTHNHPPHLSGVKVSVKCGGEKNMAMATTEEDGSFETTvvlpsskspss  310
             +GSVTCLDC   H    HLSGV V+VKC G   +  A T+  GSF+           +S
Sbjct  34   LRGSVTCLDCAAGH----HLSGVVVAVKCTGGAGLHAAQTDGSGSFDVA------VPAAS  83

Query  311  vvscsAKILGATRQLYIP  364
               C+A++LG   QL  P
Sbjct  84   GSRCAARVLGGAEQLCAP  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1853757769455