BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig5910

Length=873
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776125.1|  PREDICTED: aspartic proteinase-like                181   9e-53   Nicotiana sylvestris
ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like                185   1e-50   Nicotiana tomentosiformis
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like                183   1e-49   Solanum tuberosum [potatoes]
ref|XP_009587050.1|  PREDICTED: aspartic proteinase-like                182   2e-49   Nicotiana tomentosiformis
emb|CDP04424.1|  unnamed protein product                                182   2e-49   Coffea canephora [robusta coffee]
ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like                181   4e-49   Solanum tuberosum [potatoes]
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                     180   8e-49   Solanum lycopersicum
ref|XP_003632941.1|  PREDICTED: aspartic proteinase A1                  180   2e-48   Vitis vinifera
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                     179   2e-48   Solanum lycopersicum
ref|XP_009797823.1|  PREDICTED: aspartic proteinase                     177   2e-47   Nicotiana sylvestris
ref|XP_012070867.1|  PREDICTED: aspartic proteinase A1-like             176   3e-47   Jatropha curcas
ref|XP_011096039.1|  PREDICTED: aspartic proteinase-like                173   5e-46   
dbj|BAB20971.1|  aspartic proteinase 3                                  172   7e-46   Nepenthes alata
gb|EYU27762.1|  hypothetical protein MIMGU_mgv1a004712mg                171   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_011461056.1|  PREDICTED: aspartic proteinase A1-like             171   4e-45   Fragaria vesca subsp. vesca
gb|ACX55830.1|  aspartic proteinase 2                                   170   6e-45   Castanea mollissima
gb|ACX55829.1|  aspartic proteinase 1                                   169   8e-45   Castanea mollissima
ref|XP_007211824.1|  hypothetical protein PRUPE_ppa004375mg             169   8e-45   Prunus persica
ref|XP_010096873.1|  Aspartic proteinase                                169   1e-44   Morus notabilis
ref|XP_002529926.1|  Aspartic proteinase precursor, putative            168   3e-44   Ricinus communis
ref|XP_008226860.1|  PREDICTED: aspartic proteinase A1-like             167   5e-44   Prunus mume [ume]
gb|KJB67251.1|  hypothetical protein B456_010G182400                    164   7e-44   Gossypium raimondii
gb|KJB67249.1|  hypothetical protein B456_010G182400                    164   1e-43   Gossypium raimondii
ref|XP_006449766.1|  hypothetical protein CICLE_v10014941mg             165   4e-43   Citrus clementina [clementine]
gb|EYU33885.1|  hypothetical protein MIMGU_mgv1a004716mg                165   4e-43   Erythranthe guttata [common monkey flower]
gb|KJB67250.1|  hypothetical protein B456_010G182400                    164   5e-43   Gossypium raimondii
ref|XP_010252464.1|  PREDICTED: aspartic proteinase A1-like             164   5e-43   Nelumbo nucifera [Indian lotus]
gb|KHG11144.1|  Aspartic proteinase                                     164   8e-43   Gossypium arboreum [tree cotton]
ref|XP_007026133.1|  Saposin-like aspartyl protease family protein      164   8e-43   
ref|XP_009361022.1|  PREDICTED: aspartic proteinase A1-like             164   8e-43   Pyrus x bretschneideri [bai li]
gb|KHG11143.1|  Aspartic proteinase                                     164   1e-42   Gossypium arboreum [tree cotton]
gb|KJB67244.1|  hypothetical protein B456_010G182400                    164   1e-42   Gossypium raimondii
gb|KJB67248.1|  hypothetical protein B456_010G182400                    164   1e-42   Gossypium raimondii
gb|KJB67247.1|  hypothetical protein B456_010G182400                    164   1e-42   Gossypium raimondii
gb|KDO78302.1|  hypothetical protein CISIN_1g010233mg                   163   1e-42   Citrus sinensis [apfelsine]
gb|KHG16917.1|  Asparticase                                             164   1e-42   Gossypium arboreum [tree cotton]
ref|XP_006389579.1|  aspartic endopeptidase family protein              163   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002518445.1|  Aspartic proteinase precursor, putative            163   2e-42   Ricinus communis
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g             163   3e-42   
gb|KDO78303.1|  hypothetical protein CISIN_1g010233mg                   162   3e-42   Citrus sinensis [apfelsine]
ref|XP_008366438.1|  PREDICTED: aspartic proteinase A1-like isofo...    162   3e-42   
ref|XP_008366439.1|  PREDICTED: aspartic proteinase A1-like isofo...    162   3e-42   
gb|KJB69259.1|  hypothetical protein B456_011G012800                    162   4e-42   Gossypium raimondii
ref|XP_006467405.1|  PREDICTED: aspartic proteinase-like isoform X2     162   4e-42   Citrus sinensis [apfelsine]
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1     163   4e-42   
ref|XP_008380299.1|  PREDICTED: aspartic proteinase A1-like             162   6e-42   
ref|XP_011008023.1|  PREDICTED: aspartic proteinase-like                162   6e-42   Populus euphratica
gb|KJB69260.1|  hypothetical protein B456_011G012800                    162   6e-42   Gossypium raimondii
ref|XP_002298827.2|  aspartic protease family protein                   161   8e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011046961.1|  PREDICTED: aspartic proteinase-like                161   9e-42   Populus euphratica
ref|XP_011046729.1|  PREDICTED: aspartic proteinase A1-like             160   1e-41   Populus euphratica
gb|KJB13725.1|  hypothetical protein B456_002G091100                    159   2e-41   Gossypium raimondii
gb|KDO62074.1|  hypothetical protein CISIN_1g010230mg                   157   3e-41   Citrus sinensis [apfelsine]
gb|KJB13726.1|  hypothetical protein B456_002G091100                    159   3e-41   Gossypium raimondii
gb|KJB13723.1|  hypothetical protein B456_002G091100                    158   9e-41   Gossypium raimondii
gb|KHG05834.1|  Asparticase                                             158   1e-40   Gossypium arboreum [tree cotton]
gb|KJB13719.1|  hypothetical protein B456_002G091100                    158   1e-40   Gossypium raimondii
gb|KHG04193.1|  Asparticase                                             158   1e-40   Gossypium arboreum [tree cotton]
gb|KJB13718.1|  hypothetical protein B456_002G091100                    158   1e-40   Gossypium raimondii
gb|KJB22152.1|  hypothetical protein B456_004G031800                    157   1e-40   Gossypium raimondii
gb|KDO62073.1|  hypothetical protein CISIN_1g010230mg                   157   1e-40   Citrus sinensis [apfelsine]
gb|KDO62072.1|  hypothetical protein CISIN_1g010230mg                   157   2e-40   Citrus sinensis [apfelsine]
gb|KDO62068.1|  hypothetical protein CISIN_1g010230mg                   157   3e-40   Citrus sinensis [apfelsine]
ref|XP_006452415.1|  hypothetical protein CICLE_v10008027mg             157   3e-40   Citrus clementina [clementine]
gb|KDO62069.1|  hypothetical protein CISIN_1g010230mg                   157   3e-40   Citrus sinensis [apfelsine]
ref|XP_006475035.1|  PREDICTED: aspartic proteinase-like                157   3e-40   Citrus sinensis [apfelsine]
gb|KJB22150.1|  hypothetical protein B456_004G031800                    156   6e-40   Gossypium raimondii
gb|KCW77002.1|  hypothetical protein EUGRSUZ_D01351                     156   8e-40   Eucalyptus grandis [rose gum]
ref|XP_010686810.1|  PREDICTED: aspartic proteinase A1-like             155   8e-40   Beta vulgaris subsp. vulgaris [field beet]
emb|CAC86004.1|  aspartic proteinase                                    155   1e-39   Theobroma cacao [chocolate]
ref|XP_010052871.1|  PREDICTED: aspartic proteinase                     155   1e-39   Eucalyptus grandis [rose gum]
ref|XP_012091315.1|  PREDICTED: aspartic proteinase-like                155   1e-39   Jatropha curcas
ref|XP_002279049.1|  PREDICTED: aspartic proteinase A1                  154   2e-39   Vitis vinifera
ref|XP_010099183.1|  Aspartic proteinase                                154   3e-39   Morus notabilis
ref|XP_010244475.1|  PREDICTED: aspartic proteinase A1-like isofo...    154   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010244477.1|  PREDICTED: aspartic proteinase A1-like isofo...    154   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_007153978.1|  hypothetical protein PHAVU_003G0808000g            144   1e-38   Phaseolus vulgaris [French bean]
gb|AEJ76922.1|  aspartic protease                                       145   2e-38   Dimocarpus longan [longan]
gb|KCW46980.1|  hypothetical protein EUGRSUZ_K00787                     151   3e-38   Eucalyptus grandis [rose gum]
ref|XP_010553449.1|  PREDICTED: aspartic proteinase A1                  151   4e-38   Tarenaya hassleriana [spider flower]
ref|XP_010035554.1|  PREDICTED: aspartic proteinase A1-like             150   6e-38   Eucalyptus grandis [rose gum]
gb|AAB60773.1|  Strong similarity to Brassica aspartic protease (...    148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011652603.1|  PREDICTED: aspartic proteinase                     148   3e-37   Cucumis sativus [cucumbers]
ref|XP_010546667.1|  PREDICTED: aspartic proteinase A1-like             148   4e-37   Tarenaya hassleriana [spider flower]
gb|KGN64503.1|  Aspartic proteinase                                     148   4e-37   
ref|XP_008224698.1|  PREDICTED: aspartic proteinase-like                147   6e-37   Prunus mume [ume]
ref|XP_008440898.1|  PREDICTED: aspartic proteinase                     147   7e-37   Cucumis melo [Oriental melon]
ref|NP_176419.2|  aspartic proteinase A2                                147   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007020768.1|  Aspartic proteinase A1                             147   1e-36   
emb|CAC86003.1|  aspartic proteinase                                    147   1e-36   Theobroma cacao [chocolate]
gb|KCW88767.1|  hypothetical protein EUGRSUZ_A01109                     145   1e-36   Eucalyptus grandis [rose gum]
gb|KDO54713.1|  hypothetical protein CISIN_1g009634mg                   145   2e-36   Citrus sinensis [apfelsine]
gb|KDO54714.1|  hypothetical protein CISIN_1g009634mg                   145   3e-36   Citrus sinensis [apfelsine]
ref|XP_010046321.1|  PREDICTED: aspartic proteinase A1-like             145   3e-36   Eucalyptus grandis [rose gum]
ref|XP_006447588.1|  hypothetical protein CICLE_v10017754mg             145   4e-36   
gb|KDO54711.1|  hypothetical protein CISIN_1g009634mg                   145   4e-36   Citrus sinensis [apfelsine]
ref|XP_007211538.1|  hypothetical protein PRUPE_ppa003924mg             145   4e-36   Prunus persica
ref|XP_006469663.1|  PREDICTED: aspartic proteinase-like                145   4e-36   Citrus sinensis [apfelsine]
ref|XP_007215237.1|  hypothetical protein PRUPE_ppa004349mg             144   7e-36   Prunus persica
gb|ACN24614.1|  aspartic acid protease                                  143   3e-35   Phaseolus vulgaris [French bean]
ref|XP_010926216.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    142   4e-35   
ref|XP_003529645.1|  PREDICTED: aspartic proteinase-like isoform X1     142   4e-35   Glycine max [soybeans]
gb|KHN35722.1|  Aspartic proteinase                                     142   4e-35   Glycine soja [wild soybean]
ref|XP_008229973.1|  PREDICTED: aspartic proteinase A1-like             142   5e-35   Prunus mume [ume]
ref|XP_007049085.1|  Aspartic protease isoform 2                        142   6e-35   
ref|XP_010926197.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    142   7e-35   Elaeis guineensis
ref|XP_002892661.1|  aspartyl protease family protein                   142   8e-35   
ref|XP_007049084.1|  Aspartic proteinase A1 isoform 1                   142   8e-35   
ref|XP_009353298.1|  PREDICTED: aspartic proteinase A1-like             141   9e-35   Pyrus x bretschneideri [bai li]
gb|AAC34854.1|  senescence-associated protein 4                         130   9e-35   Hemerocallis hybrid cultivar
ref|XP_004134774.1|  PREDICTED: aspartic proteinase-like                141   9e-35   Cucumis sativus [cucumbers]
ref|XP_009347130.1|  PREDICTED: aspartic proteinase A1-like             141   1e-34   Pyrus x bretschneideri [bai li]
ref|NP_172655.1|  aspartic proteinase A1                                141   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303952.1|  hypothetical protein CARUB_v10008798mg             141   1e-34   
ref|XP_011086197.1|  PREDICTED: aspartic proteinase A1-like isofo...    140   2e-34   Sesamum indicum [beniseed]
ref|XP_010458606.1|  PREDICTED: aspartic proteinase A1                  140   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010060310.1|  PREDICTED: aspartic proteinase A1-like             140   2e-34   Eucalyptus grandis [rose gum]
ref|XP_011086196.1|  PREDICTED: aspartic proteinase A1-like isofo...    140   2e-34   Sesamum indicum [beniseed]
gb|AAC49730.1|  aspartic proteinase                                     140   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764301.1|  PREDICTED: aspartic proteinase A1-like             137   3e-34   Nicotiana sylvestris
ref|XP_008797519.1|  PREDICTED: aspartic proteinase oryzasin-1-like     140   3e-34   Phoenix dactylifera
ref|XP_010476135.1|  PREDICTED: aspartic proteinase A1-like             140   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008342027.1|  PREDICTED: aspartic proteinase A1-like             140   4e-34   Malus domestica [apple tree]
gb|EPS66177.1|  hypothetical protein M569_08599                         137   5e-34   Genlisea aurea
ref|XP_010418214.1|  PREDICTED: aspartic proteinase A2 isoform X2       139   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010418210.1|  PREDICTED: aspartic proteinase A2 isoform X1       139   6e-34   Camelina sativa [gold-of-pleasure]
gb|AFH58568.1|  aspartic acid protease                                  139   7e-34   Ananas comosus
ref|XP_010493478.1|  PREDICTED: aspartic proteinase A1-like             139   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002886481.1|  aspartyl protease family protein                   139   9e-34   
ref|XP_006600236.1|  PREDICTED: aspartic proteinase 1 isoform X1        139   9e-34   
gb|AAN60347.1|  unknown                                                 130   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08632.1|  BnaC04g19410D                                          138   1e-33   Brassica napus [oilseed rape]
gb|KHN03495.1|  Aspartic proteinase                                     138   1e-33   Glycine soja [wild soybean]
ref|XP_010430270.1|  PREDICTED: aspartic proteinase A2-like             138   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006417290.1|  hypothetical protein EUTSA_v10007418mg             138   2e-33   Eutrema salsugineum [saltwater cress]
sp|O04057.1|ASPR_CUCPE  RecName: Full=Aspartic proteinase; Flags:...    137   2e-33   Cucurbita pepo
ref|NP_001237064.1|  aspartic proteinase 1 precursor                    137   2e-33   
ref|XP_004151126.1|  PREDICTED: aspartic proteinase A1-like             137   3e-33   Cucumis sativus [cucumbers]
ref|XP_008800699.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    137   3e-33   Phoenix dactylifera
ref|XP_008440022.1|  PREDICTED: aspartic proteinase-like isoform X2     137   3e-33   Cucumis melo [Oriental melon]
ref|XP_009123365.1|  PREDICTED: aspartic proteinase A2 isoform X1       137   3e-33   Brassica rapa
emb|CDY24888.1|  BnaA03g59920D                                          137   3e-33   Brassica napus [oilseed rape]
gb|KGN56078.1|  hypothetical protein Csa_3G066750                       137   3e-33   
ref|XP_008800700.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    137   4e-33   Phoenix dactylifera
ref|XP_008440021.1|  PREDICTED: aspartic proteinase-like isoform X1     137   4e-33   Cucumis melo [Oriental melon]
ref|XP_002524837.1|  Aspartic proteinase precursor, putative            136   5e-33   
gb|AAB03843.2|  aspartic proteinase                                     136   6e-33   Vigna unguiculata
ref|XP_006364164.1|  PREDICTED: aspartic proteinase-like                136   6e-33   Solanum tuberosum [potatoes]
ref|XP_006301275.1|  hypothetical protein CARUB_v10021675mg             136   6e-33   Capsella rubella
ref|XP_009600571.1|  PREDICTED: cyprosin-like                           135   1e-32   Nicotiana tomentosiformis
gb|ABG37021.1|  aspartic protease                                       135   1e-32   Nicotiana tabacum [American tobacco]
ref|XP_009123370.1|  PREDICTED: aspartic proteinase A2 isoform X2       134   1e-32   Brassica rapa
ref|XP_012087600.1|  PREDICTED: aspartic proteinase A1-like isofo...    135   2e-32   Jatropha curcas
ref|XP_012087602.1|  PREDICTED: aspartic proteinase A1-like isofo...    135   2e-32   Jatropha curcas
gb|AFB73927.2|  preprocirsin                                            134   4e-32   Cirsium vulgare
ref|XP_004287958.1|  PREDICTED: aspartic proteinase A1-like             134   4e-32   Fragaria vesca subsp. vesca
emb|CAA56373.1|  putative aspartic protease                             130   4e-32   Brassica oleracea
ref|XP_006391910.1|  hypothetical protein EUTSA_v10023414mg             133   7e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009395027.1|  PREDICTED: aspartic proteinase oryzasin-1-like     133   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003546159.1|  PREDICTED: aspartic proteinase-like                133   9e-32   Glycine max [soybeans]
gb|KHN33009.1|  Aspartic proteinase                                     133   9e-32   Glycine soja [wild soybean]
emb|CAA57510.1|  cyprosin                                               132   2e-31   Cynara cardunculus [cardoon]
gb|AJA72485.1|  arctiumsin                                              132   2e-31   Arctium minus
ref|XP_010924299.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    132   3e-31   
ref|XP_006838131.1|  PREDICTED: cyprosin                                131   4e-31   Amborella trichopoda
dbj|BAB20969.1|  aspartic proteinase 1                                  130   5e-31   Nepenthes alata
ref|XP_009358756.1|  PREDICTED: aspartic proteinase-like                130   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_009394234.1|  PREDICTED: aspartic proteinase oryzasin-1-like     130   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410967.1|  PREDICTED: aspartic proteinase oryzasin-1-like     130   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011100273.1|  PREDICTED: cyprosin-like                           130   1e-30   Sesamum indicum [beniseed]
ref|XP_009390744.1|  PREDICTED: aspartic proteinase oryzasin-1-like     130   1e-30   
emb|CDP10762.1|  unnamed protein product                                129   1e-30   Coffea canephora [robusta coffee]
ref|XP_008647844.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    129   1e-30   Zea mays [maize]
ref|XP_009118162.1|  PREDICTED: aspartic proteinase A1                  129   2e-30   Brassica rapa
ref|NP_001148782.1|  aspartic proteinase oryzasin-1 precursor           129   2e-30   Zea mays [maize]
ref|XP_009357472.1|  PREDICTED: aspartic proteinase-like                129   2e-30   Pyrus x bretschneideri [bai li]
gb|AGP76185.1|  aspartic proteinase                                     129   2e-30   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006654801.1|  PREDICTED: aspartic proteinase oryzasin-1-like     129   2e-30   
ref|XP_004243484.1|  PREDICTED: cyprosin-like                           129   2e-30   Solanum lycopersicum
ref|XP_004293311.1|  PREDICTED: aspartic proteinase A1                  128   4e-30   Fragaria vesca subsp. vesca
emb|CDY34819.1|  BnaA09g47450D                                          129   4e-30   Brassica napus [oilseed rape]
emb|CAA70340.1|  aspartic proteinase                                    128   4e-30   Centaurea calcitrapa
ref|XP_003610462.1|  Aspartic proteinase                                128   4e-30   Medicago truncatula
gb|AGE15494.1|  preprosilpepsin 1                                       128   4e-30   Silybum marianum [holy thistle]
ref|XP_003567869.1|  PREDICTED: phytepsin                               128   5e-30   Brachypodium distachyon [annual false brome]
dbj|BAA06876.1|  aspartic protease                                      127   6e-30   Oryza sativa [red rice]
ref|XP_008371074.1|  PREDICTED: aspartic proteinase                     127   6e-30   
gb|KJB13722.1|  hypothetical protein B456_002G091100                    115   6e-30   Gossypium raimondii
ref|XP_003534602.1|  PREDICTED: aspartic proteinase                     127   7e-30   Glycine max [soybeans]
ref|XP_008349314.1|  PREDICTED: aspartic proteinase-like                127   8e-30   
ref|NP_001056348.1|  Os05g0567100                                       127   1e-29   
dbj|BAB20973.1|  aspartic proteinase 5                                  125   1e-29   Nepenthes alata
ref|XP_009421489.1|  PREDICTED: aspartic proteinase oryzasin-1-like     127   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB20970.1|  aspartic proteinase 2                                  126   2e-29   Nepenthes alata
ref|XP_009416572.1|  PREDICTED: aspartic proteinase-like isoform X2     126   2e-29   
ref|XP_009416564.1|  PREDICTED: aspartic proteinase-like isoform X1     126   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007036022.1|  Aspartic proteinase, putative isoform 5            117   2e-29   
ref|XP_007036021.1|  Aspartic proteinase, putative isoform 4            117   2e-29   
ref|XP_007036019.1|  Aspartic proteinase A1, putative isoform 2         117   2e-29   
ref|XP_007036020.1|  Aspartic proteinase, putative isoform 3            117   2e-29   
emb|CDY21021.1|  BnaA08g25040D                                          125   3e-29   Brassica napus [oilseed rape]
ref|XP_009110686.1|  PREDICTED: aspartic proteinase A1-like             125   3e-29   Brassica rapa
ref|XP_007036018.1|  Aspartic proteinase, putative isoform 1            116   3e-29   
emb|CDY31221.1|  BnaC08g15160D                                          126   4e-29   Brassica napus [oilseed rape]
gb|AAB03108.1|  aspartic protease                                       125   4e-29   Brassica napus [oilseed rape]
dbj|BAB20972.1|  aspartic proteinase 4                                  125   4e-29   Nepenthes alata
gb|ADM73810.1|  aspartyl protease-like protein                          118   6e-29   Picea sitchensis
gb|ADM73798.1|  aspartyl protease-like protein                          118   7e-29   Picea sitchensis
gb|ADM73795.1|  aspartyl protease-like protein                          118   8e-29   Picea sitchensis
ref|XP_009415269.1|  PREDICTED: aspartic proteinase oryzasin-1-like     124   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961190.1|  PREDICTED: aspartic proteinase oryzasin-1-like     123   3e-28   Setaria italica
ref|NP_001150729.1|  aspartic proteinase oryzasin-1 precursor           122   5e-28   Zea mays [maize]
ref|XP_008784384.1|  PREDICTED: aspartic proteinase oryzasin-1-like     122   5e-28   Phoenix dactylifera
ref|XP_008800328.1|  PREDICTED: aspartic proteinase-like isoform X2     122   5e-28   
ref|XP_008800325.1|  PREDICTED: aspartic proteinase-like isoform X1     122   5e-28   Phoenix dactylifera
ref|XP_010529449.1|  PREDICTED: aspartic proteinase A3                  122   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_010271042.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    122   5e-28   Nelumbo nucifera [Indian lotus]
gb|ADM73842.1|  aspartyl protease-like protein                          115   6e-28   Picea sitchensis
ref|NP_001190671.1|  aspartic proteinase A3                             122   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192355.1|  aspartic proteinase A3                                122   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909333.1|  PREDICTED: aspartic proteinase-like                121   7e-28   Elaeis guineensis
ref|XP_009419881.1|  PREDICTED: aspartic proteinase oryzasin-1-like     121   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539213.1|  PREDICTED: aspartic proteinase A3-like isofo...    121   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010539208.1|  PREDICTED: aspartic proteinase A3-like isofo...    121   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010271040.1|  PREDICTED: aspartic proteinase-like isoform X1     121   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010271041.1|  PREDICTED: aspartic proteinase-like isoform X2     120   1e-27   Nelumbo nucifera [Indian lotus]
emb|CDY16668.1|  BnaA09g20460D                                          120   2e-27   Brassica napus [oilseed rape]
ref|XP_009114571.1|  PREDICTED: aspartic proteinase A3 isoform X1       120   2e-27   Brassica rapa
ref|XP_002872693.1|  aspartyl protease family protein                   120   2e-27   
ref|XP_011006459.1|  PREDICTED: cyprosin-like isoform X2                120   2e-27   Populus euphratica
dbj|BAE20413.1|  aspartic proteinase                                    120   2e-27   Triticum aestivum [Canadian hard winter wheat]
emb|CDX94554.1|  BnaC09g22820D                                          120   2e-27   
ref|XP_011006458.1|  PREDICTED: cyprosin-like isoform X1                120   3e-27   Populus euphratica
ref|XP_004507671.1|  PREDICTED: aspartic proteinase-like isoform X1     120   3e-27   Cicer arietinum [garbanzo]
ref|XP_006286432.1|  hypothetical protein CARUB_v10003637mg             120   3e-27   
gb|AHB32105.1|  aspartic proteinase                                     119   4e-27   Camellia sinensis [black tea]
ref|XP_010916100.1|  PREDICTED: aspartic proteinase oryzasin-1-like     119   5e-27   Elaeis guineensis
dbj|BAG16519.1|  putative aspartic protease                             119   6e-27   Capsicum chinense [bonnet pepper]
sp|P42210.1|ASPR_HORVU  RecName: Full=Phytepsin; AltName: Full=As...    119   8e-27   Hordeum vulgare [barley]
ref|XP_002302872.2|  aspartic endopeptidase family protein              118   1e-26   
ref|XP_006840365.1|  PREDICTED: aspartic proteinase A1                  118   1e-26   Amborella trichopoda
gb|ADE74632.1|  aspartic protease 1                                     118   1e-26   Nicotiana tabacum [American tobacco]
ref|XP_008649363.1|  PREDICTED: aspartic proteinase oryzasin-1-like     114   1e-26   Zea mays [maize]
dbj|BAA76870.1|  aspartic proteinase                                    118   2e-26   Helianthus annuus
emb|CAM12780.1|  aspartic proteinase                                    117   2e-26   Fagopyrum esculentum
ref|XP_007020767.1|  Aspartic proteinase A1                             117   2e-26   
ref|XP_011039044.1|  PREDICTED: aspartic proteinase-like                117   2e-26   Populus euphratica
ref|XP_010473444.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    117   2e-26   
gb|AFX73039.1|  preprogaline A                                          117   2e-26   Galium verum
ref|XP_008246320.1|  PREDICTED: aspartic proteinase-like                117   2e-26   Prunus mume [ume]
ref|NP_001275049.1|  Asp precursor                                      117   3e-26   Solanum tuberosum [potatoes]
gb|KHN43373.1|  Aspartic proteinase                                     117   3e-26   Glycine soja [wild soybean]
ref|XP_006603753.1|  PREDICTED: aspartic proteinase 2 isoform X1        117   3e-26   Glycine max [soybeans]
ref|XP_009608676.1|  PREDICTED: cyprosin-like                           117   3e-26   Nicotiana tomentosiformis
ref|XP_003567538.1|  PREDICTED: aspartic proteinase-like                117   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_009801963.1|  PREDICTED: cyprosin-like                           117   4e-26   Nicotiana sylvestris
ref|XP_010455726.1|  PREDICTED: aspartic proteinase A3 isoform X1       117   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010455729.1|  PREDICTED: aspartic proteinase A3 isoform X2       117   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010659762.1|  PREDICTED: aspartic proteinase A1 isoform X2       117   4e-26   Vitis vinifera
ref|XP_009114573.1|  PREDICTED: aspartic proteinase A3 isoform X2       116   4e-26   Brassica rapa
ref|XP_002276363.3|  PREDICTED: aspartic proteinase A1 isoform X1       117   5e-26   Vitis vinifera
gb|AAV84085.2|  aspartic proteinase 9                                   116   5e-26   Fagopyrum esculentum
ref|XP_006428328.1|  hypothetical protein CICLE_v10011525mg             115   5e-26   
ref|XP_007207363.1|  hypothetical protein PRUPE_ppa004505mg             116   6e-26   Prunus persica
gb|EMT30433.1|  Aspartic proteinase                                     115   8e-26   
ref|XP_003521645.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    115   8e-26   Glycine max [soybeans]
ref|XP_010241437.1|  PREDICTED: cyprosin-like                           115   9e-26   Nelumbo nucifera [Indian lotus]
ref|XP_011023864.1|  PREDICTED: aspartic proteinase-like                116   9e-26   Populus euphratica
pdb|1QDM|A  Chain A, Crystal Structure Of Prophytepsin, A Zymogen...    115   1e-25   Hordeum vulgare [barley]
ref|XP_002319454.2|  aspartic proteinase 2                              115   1e-25   Populus trichocarpa [western balsam poplar]
ref|NP_001237345.1|  aspartic proteinase 2                              115   2e-25   
ref|XP_010432806.1|  PREDICTED: aspartic proteinase A3-like isofo...    115   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007147707.1|  hypothetical protein PHAVU_006G147900g             115   2e-25   Phaseolus vulgaris [French bean]
ref|XP_006428329.1|  hypothetical protein CICLE_v10011525mg             115   2e-25   Citrus clementina [clementine]
ref|XP_010432791.1|  PREDICTED: aspartic proteinase A3-like isofo...    115   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010926196.1|  PREDICTED: aspartic proteinase oryzasin-1-like     114   4e-25   
gb|AAT77954.1|  Asp                                                     113   5e-25   Solanum tuberosum [potatoes]
ref|XP_007163289.1|  hypothetical protein PHAVU_001G222100g             113   6e-25   Phaseolus vulgaris [French bean]
ref|XP_006396693.1|  hypothetical protein EUTSA_v10028587mg             113   6e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006396692.1|  hypothetical protein EUTSA_v10028587mg             113   7e-25   
ref|XP_010496363.1|  PREDICTED: aspartic proteinase A3-like             113   7e-25   
gb|KDO45248.1|  hypothetical protein CISIN_1g010486mg                   112   9e-25   
ref|XP_004495808.1|  PREDICTED: aspartic proteinase-like                112   1e-24   
gb|KHN26195.1|  Aspartic proteinase                                     112   1e-24   
gb|EMS45559.1|  Aspartic proteinase                                     112   1e-24   
ref|XP_011087561.1|  PREDICTED: aspartic proteinase-like isoform X2     112   1e-24   
ref|XP_003555776.1|  PREDICTED: aspartic proteinase isoform X1          112   1e-24   
ref|XP_011087560.1|  PREDICTED: aspartic proteinase-like isoform X1     112   1e-24   
gb|ABI78942.1|  aspartic protease                                       112   1e-24   
ref|XP_009134301.1|  PREDICTED: aspartic proteinase A3-like             112   2e-24   
gb|ABR18322.1|  unknown                                                 111   2e-24   
emb|CDX90864.1|  BnaA03g25440D                                          112   2e-24   
gb|KDO45247.1|  hypothetical protein CISIN_1g010486mg                   112   2e-24   
gb|KDO45246.1|  hypothetical protein CISIN_1g010486mg                   112   2e-24   
emb|CDY21302.1|  BnaC03g29860D                                          112   3e-24   
ref|XP_004486175.1|  PREDICTED: aspartic proteinase-like isoform X1     111   3e-24   
gb|ABR16259.1|  unknown                                                 110   5e-24   
gb|AFW79472.1|  hypothetical protein ZEAMMB73_587615                    110   5e-24   
ref|XP_004967621.1|  PREDICTED: aspartic proteinase-like isoform X1     110   5e-24   
ref|XP_004494508.1|  PREDICTED: aspartic proteinase-like isoform X1     110   6e-24   
ref|NP_001234702.1|  aspartic protease precursor                        110   7e-24   
emb|CAA48939.1|  cyprosin                                               110   8e-24   
gb|ACF87177.1|  unknown                                                 110   9e-24   
ref|NP_001152501.1|  retrotransposon protein SINE subclass precursor    110   9e-24   
ref|XP_008355757.1|  PREDICTED: aspartic proteinase-like                108   9e-24   
ref|XP_003536026.1|  PREDICTED: aspartic proteinase-like isoform X1     110   9e-24   
gb|ACL54337.1|  unknown                                                 110   9e-24   
ref|XP_008348384.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    109   1e-23   
ref|XP_010324003.1|  PREDICTED: aspartic protease precursor isofo...    110   1e-23   
sp|P40782.2|CYPR1_CYNCA  RecName: Full=Cyprosin; Flags: Precursor       109   1e-23   
gb|EPS69682.1|  hypothetical protein M569_05082                         110   1e-23   
ref|XP_008655134.1|  PREDICTED: retrotransposon protein SINE subc...    110   1e-23   
gb|KEH36904.1|  fungal proteinase A, aspartic proteinase superfam...    109   2e-23   
gb|KDP23334.1|  hypothetical protein JCGZ_23167                         109   2e-23   
gb|AFK46704.1|  unknown                                                 109   2e-23   
gb|KHN04670.1|  Aspartic proteinase oryzasin-1                          108   2e-23   
ref|XP_012088818.1|  PREDICTED: aspartic proteinase-like                109   2e-23   
ref|XP_004302331.1|  PREDICTED: aspartic proteinase-like                108   3e-23   
ref|XP_008370344.1|  PREDICTED: aspartic proteinase-like                108   3e-23   
ref|XP_003546541.1|  PREDICTED: aspartic proteinase A1-like isofo...    108   3e-23   
gb|AES82361.2|  fungal proteinase A, aspartic proteinase superfam...    108   3e-23   
gb|KJB28875.1|  hypothetical protein B456_005G073800                    108   3e-23   
ref|XP_010038033.1|  PREDICTED: cyprosin-like                           108   3e-23   
ref|XP_006654022.1|  PREDICTED: aspartic proteinase-like                108   4e-23   
ref|XP_010649704.1|  PREDICTED: aspartic proteinase                     108   4e-23   
gb|KHG02139.1|  hypothetical protein F383_24995                         108   4e-23   
gb|KJB28874.1|  hypothetical protein B456_005G073800                    108   5e-23   
ref|XP_003626142.1|  Aspartic proteinase                                107   6e-23   
gb|KHN19190.1|  Aspartic proteinase oryzasin-1                          107   7e-23   
gb|AES82362.2|  fungal proteinase A, aspartic proteinase superfam...    107   7e-23   
ref|XP_010042427.1|  PREDICTED: aspartic proteinase-like isoform X2     107   7e-23   
ref|XP_006586640.1|  PREDICTED: uncharacterized protein LOC100500...    107   8e-23   
gb|EMS45962.1|  Aspartic proteinase                                     107   8e-23   
ref|XP_004247609.1|  PREDICTED: cyprosin                                107   8e-23   
ref|XP_007145043.1|  hypothetical protein PHAVU_007G205100g             107   9e-23   
ref|XP_010667516.1|  PREDICTED: aspartic proteinase A1-like             107   1e-22   
gb|EPS68187.1|  aspartic protease                                       107   1e-22   
dbj|BAJ91748.1|  predicted protein                                      106   1e-22   
ref|XP_010480290.1|  PREDICTED: aspartic proteinase A1-like             107   1e-22   
ref|XP_010042419.1|  PREDICTED: aspartic proteinase-like isoform X1     107   1e-22   
ref|XP_003626144.1|  Aspartic proteinase                                106   1e-22   
ref|XP_009771336.1|  PREDICTED: aspartic proteinase A1-like isofo...    107   1e-22   
ref|NP_001042785.1|  Os01g0290000                                       107   1e-22   
ref|XP_009771335.1|  PREDICTED: aspartic proteinase A1-like isofo...    107   1e-22   
gb|EEC70447.1|  hypothetical protein OsI_01478                          106   1e-22   
gb|KEH43130.1|  fungal proteinase A, aspartic proteinase superfam...    106   2e-22   
dbj|BAJ85473.1|  predicted protein                                      106   2e-22   
ref|XP_003633616.1|  PREDICTED: cyprosin-like isoform X2                106   2e-22   
ref|XP_010659757.1|  PREDICTED: cyprosin-like isoform X1                106   2e-22   
ref|XP_003626143.1|  Aspartic proteinase                                105   2e-22   
emb|CAN65745.1|  hypothetical protein VITISV_037763                     105   3e-22   
gb|EYU19381.1|  hypothetical protein MIMGU_mgv1a004925mg                105   4e-22   
ref|NP_001043786.1|  Os01g0663400                                       105   4e-22   
ref|XP_009366025.1|  PREDICTED: aspartic proteinase-like isoform X3     105   4e-22   
emb|CDP15176.1|  unnamed protein product                                105   4e-22   
dbj|BAE20414.1|  aspartic proteinase                                    105   4e-22   
ref|XP_009366024.1|  PREDICTED: aspartic proteinase-like isoform X2     105   4e-22   
ref|XP_009366023.1|  PREDICTED: aspartic proteinase-like isoform X1     105   5e-22   
ref|XP_006644474.1|  PREDICTED: aspartic proteinase oryzasin-1-like     105   6e-22   
gb|AFX73040.1|  preprofigain A                                          105   6e-22   
ref|XP_007036024.1|  Aspartic proteinase oryzasin-1 isoform 2         98.2    8e-22   
ref|XP_007036023.1|  Aspartic proteinase oryzasin-1 isoform 1         98.2    8e-22   
ref|XP_007138576.1|  hypothetical protein PHAVU_009G220600g             104   1e-21   
ref|XP_009778402.1|  PREDICTED: cyprosin-like isoform X2                104   1e-21   
emb|CAL07969.1|  aspartic proteinase                                    104   1e-21   
sp|Q9XFX3.1|CARDA_CYNCA  RecName: Full=Procardosin-A; Contains: R...    104   1e-21   
ref|XP_009778400.1|  PREDICTED: cyprosin-like isoform X1                104   1e-21   
gb|AGE15495.1|  preprosilpepsin 2                                       103   2e-21   
ref|XP_007031269.1|  Aspartic proteinase                                103   2e-21   
ref|XP_010271044.1|  PREDICTED: aspartic proteinase A1-like           93.2    2e-21   
ref|XP_010511325.1|  PREDICTED: aspartic proteinase A1-like isofo...    102   2e-21   
ref|XP_002992068.1|  hypothetical protein SELMODRAFT_186535           95.1    3e-21   
ref|XP_006363462.1|  PREDICTED: aspartic proteinase oryzasin-1-like     102   4e-21   
ref|XP_002512581.1|  Aspartic proteinase precursor, putative            102   4e-21   
gb|KJB26285.1|  hypothetical protein B456_004G235200                    102   5e-21   
ref|XP_010094903.1|  Aspartic proteinase                                102   6e-21   
gb|KEH32400.1|  fungal proteinase A, aspartic proteinase superfam...  99.4    6e-21   
gb|EMS54428.1|  Aspartic proteinase oryzasin-1                          102   7e-21   
ref|XP_002964099.1|  hypothetical protein SELMODRAFT_142401           95.5    7e-21   
ref|XP_002314336.2|  aspartic proteinase 2                              101   8e-21   
ref|XP_002891994.1|  hypothetical protein ARALYDRAFT_314946             101   9e-21   
ref|XP_010999327.1|  PREDICTED: aspartic proteinase-like                101   9e-21   
ref|XP_010511326.1|  PREDICTED: aspartic proteinase A1-like isofo...    101   1e-20   
dbj|BAA02242.1|  aspartic proteinase                                    101   1e-20   
ref|NP_001054586.1|  Os05g0137400                                       101   1e-20   
gb|EEE62252.1|  hypothetical protein OsJ_17039                          101   1e-20   
ref|XP_010241431.1|  PREDICTED: aspartic proteinase-like isoform X1     101   2e-20   
gb|KDP28021.1|  hypothetical protein JCGZ_19101                         100   2e-20   
ref|XP_010241432.1|  PREDICTED: aspartic proteinase-like isoform X2     101   2e-20   
ref|XP_010241436.1|  PREDICTED: cardosin-F-like isoform X5              100   2e-20   
ref|XP_010241434.1|  PREDICTED: aspartic proteinase-like isoform X4     101   2e-20   
ref|XP_010241433.1|  PREDICTED: aspartic proteinase-like isoform X3     101   2e-20   
ref|XP_012084224.1|  PREDICTED: cyprosin-like                           100   2e-20   
ref|XP_009616098.1|  PREDICTED: cyprosin-like                           100   3e-20   
ref|XP_003568979.1|  PREDICTED: aspartic proteinase                     100   3e-20   
ref|XP_010674482.1|  PREDICTED: aspartic proteinase-like                100   3e-20   
ref|XP_010024880.1|  PREDICTED: cyprosin-like                         85.5    5e-20   
ref|XP_009769839.1|  PREDICTED: aspartic proteinase A1-like           99.4    5e-20   
ref|XP_004488184.1|  PREDICTED: aspartic proteinase-like isoform X1   99.4    5e-20   
ref|XP_004488185.1|  PREDICTED: aspartic proteinase-like isoform X2   99.4    5e-20   
gb|KCW61403.1|  hypothetical protein EUGRSUZ_H04133                   85.1    5e-20   
ref|XP_009619374.1|  PREDICTED: cyprosin-like isoform X1              99.4    6e-20   
ref|XP_009619375.1|  PREDICTED: cyprosin-like isoform X2              99.4    6e-20   
ref|XP_006302162.1|  hypothetical protein CARUB_v10020172mg           99.4    6e-20   
gb|AAK48494.1|AF259982_1  putative aspartic protease                  99.4    7e-20   
ref|XP_010233477.1|  PREDICTED: aspartic proteinase oryzasin-1-like   99.4    7e-20   
emb|CDO98683.1|  unnamed protein product                              99.0    7e-20   
gb|ADP89523.1|  cathepsin D                                           90.1    1e-19   
ref|XP_010098748.1|  Aspartic proteinase                              98.2    1e-19   
ref|XP_010793424.1|  PREDICTED: cathepsin D                           89.0    1e-19   
ref|XP_007435358.1|  PREDICTED: cathepsin D-like                      85.5    1e-19   
gb|KHG03187.1|  Asparticase                                           98.2    2e-19   
ref|XP_007066674.1|  PREDICTED: cathepsin D                           83.2    2e-19   
ref|XP_010694065.1|  PREDICTED: cyprosin-like                         97.8    2e-19   
ref|XP_002964101.1|  hypothetical protein SELMODRAFT_166719           87.4    2e-19   
ref|XP_004508063.1|  PREDICTED: aspartic proteinase oryzasin-1-like   97.8    2e-19   
ref|XP_003595434.1|  Aspartic proteinase                              97.8    2e-19   
gb|KEH37701.1|  fungal proteinase A, aspartic proteinase superfam...  98.2    2e-19   
ref|XP_006134990.1|  PREDICTED: cathepsin D                           84.7    2e-19   
ref|XP_004297063.1|  PREDICTED: cyprosin-like                         97.4    2e-19   
gb|KEH37702.1|  fungal proteinase A, aspartic proteinase superfam...  97.8    2e-19   
ref|XP_010511324.1|  PREDICTED: aspartic proteinase oryzasin-1-li...  97.4    3e-19   
gb|KDO72242.1|  hypothetical protein CISIN_1g010195mg                 95.9    3e-19   
gb|AFX73038.1|  preprogaline A                                        97.4    3e-19   
gb|KJB28876.1|  hypothetical protein B456_005G073900                  95.9    3e-19   
ref|XP_010511323.1|  PREDICTED: aspartic proteinase-like isoform X1   97.4    3e-19   
gb|EMT30725.1|  Phytepsin                                             92.4    3e-19   
ref|XP_008920266.1|  PREDICTED: cathepsin D                           83.2    3e-19   
gb|KFP91444.1|  Cathepsin D                                           85.5    3e-19   
ref|XP_009873028.1|  PREDICTED: cathepsin D                           85.1    3e-19   
ref|XP_010549203.1|  PREDICTED: aspartic proteinase A1-like isofo...  97.1    3e-19   
ref|XP_007223268.1|  hypothetical protein PRUPE_ppa004486mg           97.1    3e-19   
ref|XP_003380300.1|  lysosomal aspartic protease                      87.4    4e-19   
ref|XP_010549201.1|  PREDICTED: aspartic proteinase A1-like isofo...  97.1    4e-19   
gb|KFQ41148.1|  Cathepsin D                                           84.7    5e-19   
ref|XP_008223613.1|  PREDICTED: aspartic proteinase-like              96.7    5e-19   
ref|XP_010191309.1|  PREDICTED: cathepsin D                           84.3    5e-19   
ref|XP_002964100.1|  hypothetical protein SELMODRAFT_438819           87.4    6e-19   
ref|XP_006642526.1|  PREDICTED: cathepsin D-like                      87.8    6e-19   
ref|XP_005499288.1|  PREDICTED: cathepsin D                           84.7    6e-19   
ref|XP_006419205.1|  hypothetical protein CICLE_v10004801mg           96.3    6e-19   
sp|O93428.2|CATD_CHIHA  RecName: Full=Cathepsin D; Flags: Precursor   88.2    7e-19   
ref|XP_006356104.1|  PREDICTED: aspartic proteinase A1-like           95.9    7e-19   
gb|EMC88033.1|  Cathepsin D                                           84.3    7e-19   
ref|XP_005307824.1|  PREDICTED: cathepsin D                           81.3    7e-19   
gb|KDO72241.1|  hypothetical protein CISIN_1g010195mg                 95.9    1e-18   
gb|EOB01251.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_008378420.1|  PREDICTED: aspartic proteinase-like isoform X1   95.9    1e-18   
gb|KDO72240.1|  hypothetical protein CISIN_1g010195mg                 95.9    1e-18   
ref|XP_006278899.1|  PREDICTED: cathepsin D                           84.0    1e-18   
ref|XP_006488712.1|  PREDICTED: aspartic proteinase A2-like           95.5    1e-18   
ref|XP_010709395.1|  PREDICTED: cathepsin D                           85.1    1e-18   
gb|KDO72239.1|  hypothetical protein CISIN_1g010195mg                 95.9    1e-18   
ref|XP_009286950.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_007576894.1|  PREDICTED: cathepsin D                           87.8    1e-18   
ref|XP_004969436.1|  PREDICTED: aspartic proteinase oryzasin-1-like   95.5    1e-18   
ref|XP_011597286.1|  PREDICTED: cathepsin D                           84.7    1e-18   
gb|KFM13833.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_005019794.1|  PREDICTED: cathepsin D isoform X2                84.7    1e-18   
ref|XP_001769293.1|  predicted protein                                95.5    1e-18   
ref|XP_009570148.1|  PREDICTED: cathepsin D isoform X2                84.7    1e-18   
gb|KFQ90991.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_006419206.1|  hypothetical protein CICLE_v10004801mg           95.5    1e-18   
ref|XP_009460737.1|  PREDICTED: cathepsin D                           84.7    1e-18   
gb|KFR11299.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_010011434.1|  PREDICTED: cathepsin D                           84.7    1e-18   
gb|KFO71893.1|  Cathepsin D                                           84.7    1e-18   
ref|NP_990508.1|  cathepsin D precursor                               84.7    1e-18   
ref|XP_010307224.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_010564304.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_009570147.1|  PREDICTED: cathepsin D isoform X1                84.7    1e-18   
gb|KGL98848.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_009326741.1|  PREDICTED: cathepsin D                           84.7    1e-18   
gb|KFW70237.1|  Cathepsin D                                           84.7    1e-18   
gb|KFQ42311.1|  Cathepsin D                                           84.7    1e-18   
gb|KFO07408.1|  Cathepsin D                                           84.7    1e-18   
gb|ABV59077.1|  cathepsin D                                           86.7    1e-18   
ref|XP_009933604.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_010151565.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_005237386.1|  PREDICTED: cathepsin D                           84.7    1e-18   
gb|KFW06830.1|  Cathepsin D                                           84.7    1e-18   
ref|XP_008502909.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_009484824.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_008390340.1|  PREDICTED: aspartic proteinase-like              95.1    1e-18   
ref|XP_009585254.1|  PREDICTED: cathepsin D                           84.3    1e-18   
ref|XP_010121911.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_010171443.1|  PREDICTED: cathepsin D                           84.7    1e-18   
ref|XP_003214815.1|  PREDICTED: cathepsin D                           85.5    1e-18   
gb|KFV96518.1|  Cathepsin D                                           84.3    1e-18   
gb|KFO96729.1|  Cathepsin D                                           84.7    1e-18   
gb|KFQ53320.1|  Cathepsin D                                           84.7    2e-18   
ref|XP_009635590.1|  PREDICTED: cathepsin D                           84.7    2e-18   
ref|XP_006026954.1|  PREDICTED: cathepsin D-like                      84.3    2e-18   
gb|KFZ63334.1|  Cathepsin D                                           84.7    2e-18   
gb|KFP14703.1|  Cathepsin D                                           84.7    2e-18   
gb|KFP43480.1|  Cathepsin D                                           84.7    2e-18   
gb|KFQ82471.1|  Cathepsin D                                           84.7    2e-18   
ref|XP_010292933.1|  PREDICTED: cathepsin D                           84.3    2e-18   
gb|KFP96850.1|  Cathepsin D                                           84.3    2e-18   
dbj|BAK55647.1|  cathepsin D                                          84.7    2e-18   



>ref|XP_009776125.1| PREDICTED: aspartic proteinase-like [Nicotiana sylvestris]
Length=162

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +RIGLKKMK D+NNR+AAR+E+K GD LR S+RKY N  G+ GD +DTDIV L
Sbjct  21   SSSNDGLMRIGLKKMKFDQNNRLAARIESKEGDVLRGSIRKY-NFRGKLGDFEDTDIVAL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F
Sbjct  80   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCF  125



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASV  579
            MG KA +VT+ LSSL+FPLA S SNDG VRIGLKK+K D+NNR+AAR+E+K G+++RAS+
Sbjct  1    MGAKAFLVTILLSSLLFPLALSTSNDGLVRIGLKKIKFDQNNRLAARVESKEGEAVRASI  60

Query  580  RKYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKC  759
            RKY N HG  G  +DTDIV LKNYMDAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPSSKC
Sbjct  61   RKYNNFHGNLGASEDTDIVALKNYMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKC  120

Query  760  YFSVPFFSIPSTPLANPVLTRRMGSLLKFITGLGSISG  873
            YFSVP F       +     ++ G       G G+ISG
Sbjct  121  YFSVPCFFHSKYKSSQSSTYKKNGKSAAIRYGTGAISG  158



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDGFVRIGLKKMK D NNR+AARLE+K GD LR S+RKY N  G+ GD +DTDIV L
Sbjct  21   SSSNDGFVRIGLKKMKFDHNNRLAARLESKEGDLLRPSIRKY-NFRGKLGDSEDTDIVAL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +     +
Sbjct  80   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAKYKSSLSSTYK  139

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  140  KNGESAAIQYGSGAISG  156



>ref|XP_009587050.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=510

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +RIGLKKMK D+NNR+AAR+E+K GD LRAS+RKY N  G+ GD +DTDIV L
Sbjct  21   SSSNDGLMRIGLKKMKFDQNNRLAARIESKEGDVLRASIRKY-NFRGKLGDSEDTDIVAL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +     +
Sbjct  80   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKFKSSESSTYK  139

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  140  KNGKSAAIQYGSGAISG  156



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS SNDG VRIGLKK+K D+NNR+A+RLE+K G++LR+S+RKY+   G+ GD  DTDIV
Sbjct  22   AFSSSNDGLVRIGLKKIKFDQNNRLASRLESKDGETLRSSIRKYH-FRGKLGDPADTDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +    
Sbjct  81   ALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYKSSQSST  140

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G   +   G G+ISG
Sbjct  141  YKKNGKSAEIHYGTGAISG  159



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASV  579
            MGVKA +VT FLS+L+FPLAFS SNDG VRIGLKK+K D+NNR+AARLE+K  ++LRAS+
Sbjct  1    MGVKAFLVTFFLSTLLFPLAFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASI  60

Query  580  RKYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKC  759
            RKY N  G  G  +DTDIV LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KC
Sbjct  61   RKY-NFRGDLGASEDTDIVALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC  119

Query  760  YFSVPFFSIPSTPLANPVLTRRMGSLLKFITGLGSISG  873
            YFSVP         +     ++ G+      G G+ISG
Sbjct  120  YFSVPCLFHSKYKSSQSSTYKKNGTSAAIHYGTGAISG  157



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASV  579
            MGVKA +V  FLS+L+FPLAFS SNDG VRIGLKK+K D+NNR+AARLE+K  ++LRAS+
Sbjct  1    MGVKAFLVAFFLSTLLFPLAFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASI  60

Query  580  RKYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKC  759
            RKY N  G  G  +DTDIV LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KC
Sbjct  61   RKY-NFRGDLGVSEDTDIVALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC  119

Query  760  YFSVPFFSIPSTPLANPVLTRRMGSLLKFITGLGSISG  873
            YFSVP         +     ++ G+      G G+ISG
Sbjct  120  YFSVPCLFHSKYKSSQSSTYKKNGTSAAIHYGTGAISG  157



>ref|XP_003632941.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_002262915.2| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_010655376.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
Length=514

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            + DG  RIGLKKMK+D+N+++AARLE+K G+SLRAS+RKY+  HG  GD QDTDIVGLKN
Sbjct  26   TTDGLFRIGLKKMKLDQNDQLAARLESKEGESLRASIRKYFR-HGNLGDSQDTDIVGLKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFSVP +       +     R+ 
Sbjct  85   YMDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSVPCYFHSKYKSSQSSTYRKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSADIHYGTGAISG  159



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDGFVRIGLKKMK D+NNR+AARLE+K  D +R S+RKY N  G+ GD +DTDIV L
Sbjct  21   SSSNDGFVRIGLKKMKFDQNNRLAARLESKERDLMRPSIRKY-NFRGKLGDSEDTDIVAL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +     +
Sbjct  80   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAKYKSSLSSTYK  139

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  140  KNGESAAIQYGSGAISG  156



>ref|XP_009797823.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
 ref|XP_009797831.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
Length=512

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKK+K D+NNR+AAR+E+K G++LRAS RKY NL G  G  +DTDIV LKN
Sbjct  24   SNDGLVRIGLKKIKFDQNNRLAARVESKEGEALRASFRKYNNLRGNLGASEDTDIVALKN  83

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPSSKCYFSVP         +     ++ 
Sbjct  84   YMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKCYFSVPCLFHSKYKSSQSSTYKKN  143

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  144  GKSAAIRYGTGAISG  158



>ref|XP_012070867.1| PREDICTED: aspartic proteinase A1-like [Jatropha curcas]
 gb|KDP39159.1| hypothetical protein JCGZ_00916 [Jatropha curcas]
Length=514

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F+ SNDG VRIGLKK K D+NNR+AA+ E+K G++LRAS+RKY+ LHG  GD +D DIV 
Sbjct  23   FAASNDGLVRIGLKKRKFDQNNRVAAQFESKEGEALRASIRKYH-LHGNLGDEEDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +        +    
Sbjct  82   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKAGHSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKPADIRYGTGAISG  159



>ref|XP_011096039.1| PREDICTED: aspartic proteinase-like [Sesamum indicum]
Length=511

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLK++K+D+NNR+A RLE+K  ++LRAS+RKY NL G+ GD  DTDIV LKN
Sbjct  26   SNDGLVRIGLKRLKLDQNNRVATRLESK--EALRASIRKY-NLRGKLGDAVDTDIVALKN  82

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSVP F       +     ++ 
Sbjct  83   YMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCFFHSKYKSSQSSTHKKN  142

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  143  GKPAAIHYGTGAISG  157



>dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]
Length=507

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG +RIGLKK   D+NNRIAARLE + G++ R+S+RKYY LHG  G+ ++TDIV 
Sbjct  15   FSDSNDGLLRIGLKKKIFDQNNRIAARLETEEGEARRSSLRKYY-LHGNLGNPEETDIVA  73

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVP +
Sbjct  74   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCY  120



>gb|EYU27762.1| hypothetical protein MIMGU_mgv1a004712mg [Erythranthe guttata]
Length=513

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG +RIGLKK+K+D NN +AARLE+K    LRAS+RKY N  G+ GD  DTDIV LKN
Sbjct  26   SNDGLLRIGLKKLKLDHNNGLAARLESKEAKDLRASIRKY-NFRGKLGDGSDTDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSVP +       +     ++ 
Sbjct  85   YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVPCYFHSKYKSSESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKTAAIRYGTGAISG  159



>ref|XP_011461056.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F  SNDG +R+GLKK K D+NNR+AA L+AK GD++RA + KY NL G  GD QD DIV 
Sbjct  23   FCASNDGLLRVGLKKKKFDQNNRVAANLQAKNGDAVRAVIHKY-NLRGTYGDDQDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  +  P    ++    
Sbjct  82   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  142  SKNGKPAAIQYGTGAISG  159



>gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima]
Length=513

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SN G VRIGLKKMK+DKNNR+AA+LE+K G+   AS+RKYY L G +GD +D DIV L
Sbjct  24   SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYY-LRGNSGDPEDIDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +
Sbjct  83   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACY  128



>gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima]
Length=513

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SN G VRIGLKKMK+DKNNR+AA+LE+K G+   AS+RKYY L G +GD +D DIV L
Sbjct  24   SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYY-LRGNSGDPEDIDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +
Sbjct  83   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACY  128



>ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
 gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
Length=514

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S+SNDG VR+GLKK K D+NNR+AA++E+K G++LRAS+ KY  L G   D QDTDIV L
Sbjct  24   SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKY-RLRGNLADSQDTDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFS+  +  P    ++     
Sbjct  83   KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSSSSSTYN  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKPAAIHYGTGAISG  159



>ref|XP_010096873.1| Aspartic proteinase [Morus notabilis]
 gb|EXB66327.1| Aspartic proteinase [Morus notabilis]
Length=514

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG VRIGLKK K D+NNR+AA++E+K G++ +AS+RKY  L G  GD +DTDIV 
Sbjct  23   FSASNDGLVRIGLKKRKFDQNNRVAAQIESKEGEAFKASIRKY-RLRGNLGDPEDTDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  +        +    
Sbjct  82   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSVACYFHSKYKSRSSSSY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSASIQYGTGAISG  159



>ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=514

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG VRIGLKK K D+NNR+AA+ E+K G++ RAS++KY+ + G  GD +D DIV L
Sbjct  24   SSSNDGLVRIGLKKRKFDQNNRVAAQFESKEGEAFRASIKKYH-IRGNLGDAEDIDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +             +
Sbjct  83   KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSGQSSTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKSADIHYGTGAISG  159



>ref|XP_008226860.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
 ref|XP_008226861.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=514

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S+SNDG VR+GLKK K D+NNR+AA++E+K G++LRAS+ KY  L G   D QD DIV L
Sbjct  24   SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKY-RLRGNLADSQDIDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFS+  +  P    ++     
Sbjct  83   KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSSSSSTYN  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKPAAIHYGTGAISG  159



>gb|KJB67251.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=369

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>gb|KJB67249.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=391

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>ref|XP_006449766.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
 gb|ESR63006.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
Length=514

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDIVG  639
            SNDG VRIGLKKMK+D NNR+AARLE+K G++LRASV+KY    NL     D +DTDIV 
Sbjct  26   SNDGLVRIGLKKMKLDPNNRLAARLESKHGEALRASVKKYGFPNNLR----DSEDTDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  +       +     
Sbjct  82   LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACYFHSKYKSSQSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+I+G
Sbjct  142  KKNGESASIQYGTGAIAG  159



>gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Erythranthe guttata]
Length=513

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+ +DG +RIGLKK+ +D+NNR+AARLE+K G+ LRAS+R+Y +  G+  +  +TDIV
Sbjct  22   AISEPDDGLIRIGLKKLNLDQNNRLAARLESKEGEELRASIRRY-SPRGKTVNNAETDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +    
Sbjct  81   ALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVSCFFHTKYKSSQSST  140

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  141  YKKNGKSAAIQYGTGAISG  159



>gb|KJB67250.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=465

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>ref|XP_010252464.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
 ref|XP_010252465.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
Length=514

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +RIGLKK K D+NN +AARLE++ G+ L+AS+RKY  L G  GD  DTD+V L
Sbjct  24   SASNDGLLRIGLKKRKFDQNNLLAARLESEGGEPLKASIRKY-RLRGNLGDSGDTDMVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSV  +       +     +
Sbjct  83   KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVACYFHSKYKSSQSTTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G   +   G G+I+G
Sbjct  143  KNGKSAEIHYGTGAIAG  159



>gb|KHG11144.1| Aspartic proteinase [Gossypium arboreum]
Length=514

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ K Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKSSESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>ref|XP_007026133.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
 gb|EOY28755.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
Length=514

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLK  645
            NDG VRIGLKKMK+D NNR+AARL++K G++LRAS++KY   H RN  GD ++TDIV LK
Sbjct  27   NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRASIKKY---HFRNNLGDSEETDIVALK  83

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NYMDAQY+GEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  +       ++    ++
Sbjct  84   NYMDAQYYGEIGIGTPTQKFTVIFDTGSSNLWVPSTKCYFSVACYFHEKYKASDSSTYKK  143

Query  826  MGSLLKFITGLGSISG  873
             G       G G+ISG
Sbjct  144  DGKPASIQYGTGAISG  159



>ref|XP_009361022.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=513

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +SNDG +RIGLKK K+D+NNR+AA++++K G+SLRA ++KY  L G   D QD DIV L
Sbjct  24   CESNDGLLRIGLKKRKLDQNNRVAAQIDSKEGESLRAVLQKY-RLGGNLADSQDIDIVSL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFGEIG+GTPPQKFTVIFDTGS+NLWVPSSKCYFS+  +  P    ++     
Sbjct  83   KNYMDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCYFSIACYLHPKYKSSSSSTYN  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKPAAIQYGTGAISG  159



>gb|KHG11143.1| Aspartic proteinase [Gossypium arboreum]
Length=520

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ K Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKSSESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>gb|KJB67244.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67245.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67246.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=514

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>gb|KJB67248.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=506

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>gb|KJB67247.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=510

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25   SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV  F       +     ++ 
Sbjct  85   YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  829  GSLLKFITGLGSISG  873
            G       G G+ISG
Sbjct  145  GKSASIQYGTGAISG  159



>gb|KDO78302.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=471

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  633
            S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  24   SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV  +       +   
Sbjct  80   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G G+I+G
Sbjct  140  TYKKNGESASIQYGTGAIAG  159



>gb|KHG16917.1| Asparticase [Gossypium arboreum]
Length=551

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
              + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH  +GD +DTDIV
Sbjct  69   VMTASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNHGDHEDTDIV  128

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       +    
Sbjct  129  ALKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKT  188

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  189  YKKNGKPASIQYGTGAISG  207



>ref|XP_006389579.1| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|ERP48493.1| aspartic endopeptidase family protein [Populus trichocarpa]
Length=512

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 3/138 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S+SNDG +RIGLKK+K DKNNRIAARL+++  ++LRAS+RKY NL G  G+ +DTDIV 
Sbjct  23   LSESNDGLLRIGLKKVKFDKNNRIAARLDSQ--EALRASIRKY-NLLGNLGESEDTDIVA  79

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY DAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY SV  +             
Sbjct  80   LKNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYNSGKSSSY  139

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G GSISG
Sbjct  140  KKNGKSAEIQYGSGSISG  157



>ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=511

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG VR+GLKKMK+D+N+R+AARLE+K  ++LRASVRKY    G  GD +DTDIV LKNY
Sbjct  27   NDGLVRLGLKKMKLDENSRLAARLESKNAEALRASVRKY----GLRGDSKDTDIVALKNY  82

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEIG+GTPPQKFTV+FDTGSSNLWVPSSKC FSV  F             ++ G
Sbjct  83   LDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSSKCIFSVACFFHSRYKSGQSSTYKKNG  142

Query  832  SLLKFITGLGSISG  873
               +   G G+ISG
Sbjct  143  KSAEIHYGSGAISG  156



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +RIGLKK+K+DKNNRIAARL++K  ++LRAS+RKY NL G  G+ +DTDIV L
Sbjct  64   SASNDGLLRIGLKKVKLDKNNRIAARLDSK--ETLRASIRKY-NLCGNLGESEDTDIVAL  120

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+D+QY+GEIGVG+PPQKFTVIFDTGSSNLWVPSSKCY SV  +             +
Sbjct  121  KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYDSGKSSTYK  180

Query  823  RMGSLLKFITGLGSISG  873
            + G   +   G GSISG
Sbjct  181  KNGKSAEIRYGSGSISG  197



>gb|KDO78303.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=491

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  633
            S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  24   SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV  +       +   
Sbjct  80   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G G+I+G
Sbjct  140  TYKKNGESASIQYGTGAIAG  159



>ref|XP_008366438.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Malus domestica]
Length=518

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             F +SNDG +RIGLKK K+D+NNR+A+++++  G++LRA+++KY  L G   D +D DIV
Sbjct  26   VFCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEALRAALQKY-RLGGNLADSEDIDIV  84

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  +  P    ++   
Sbjct  85   SLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSST  144

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+ISG
Sbjct  145  YNKNGKPAAIQYGTGAISG  163



>ref|XP_008366439.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Malus domestica]
Length=514

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F +SNDG +RIGLKK K+D+NNR+A+++++  G++LRA+++KY  L G   D +D DIV 
Sbjct  23   FCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEALRAALQKY-RLGGNLADSEDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  +  P    ++    
Sbjct  82   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  142  NKNGKPAAIQYGTGAISG  159



>gb|KJB69259.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=514

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH   GD +DTDIV L
Sbjct  23   TASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNLGDHEDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       +     +
Sbjct  83   KNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKPASIQYGTGAISG  159



>ref|XP_006467405.1| PREDICTED: aspartic proteinase-like isoform X2 [Citrus sinensis]
 ref|XP_006467406.1| PREDICTED: aspartic proteinase-like isoform X3 [Citrus sinensis]
 gb|KDO78299.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78300.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78301.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=514

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  633
            S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  24   SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV  +       +   
Sbjct  80   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G G+I+G
Sbjct  140  TYKKNGESASIQYGTGAIAG  159



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  633
            S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  108  SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  163

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV  +       +   
Sbjct  164  VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  223

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G G+I+G
Sbjct  224  TYKKNGESASIQYGTGAIAG  243



>ref|XP_008380299.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=513

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F +SNDG +RIGLKK K+D+NN +A+++++K G+SLRA+++KY  L G   D QD DIV 
Sbjct  23   FCESNDGLLRIGLKKRKLDQNNXVASQIDSKEGESLRATLQKY-RLGGNLADSQDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGS+NLWVPSSKC+FS+  +  P    ++    
Sbjct  82   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCFFSIACYLHPKYKSSSSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  142  NKNGKPAAIQYGTGAISG  159



>ref|XP_011008023.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011008024.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S+SNDG +RIGLKK+K DKNNRIAAR +++  ++LRAS+RKY NL G  G+ +DTDIV 
Sbjct  23   LSESNDGMLRIGLKKVKFDKNNRIAARFDSQ--EALRASIRKY-NLLGNLGESEDTDIVA  79

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY DAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY SV  +             
Sbjct  80   LKNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYNSGKSSSY  139

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G GSISG
Sbjct  140  KKNGKSAEIQYGSGSISG  157



>gb|KJB69260.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=521

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH   GD +DTDIV L
Sbjct  23   TASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNLGDHEDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       +     +
Sbjct  83   KNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  143  KNGKPASIQYGTGAISG  159



>ref|XP_002298827.2| aspartic protease family protein [Populus trichocarpa]
 gb|EEE83632.2| aspartic protease family protein [Populus trichocarpa]
Length=515

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 99/139 (71%), Gaps = 4/139 (3%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S  NDG +RIGLKK K ++NNR+AA+LE+K G+S    ++KY+ L    GD +DTDIV
Sbjct  26   ALSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGES----IKKYHLLRNLGGDAEDTDIV  81

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       ++   
Sbjct  82   SLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSHSRT  141

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G   +   G G+ISG
Sbjct  142  YKENGKSAEIHYGTGAISG  160



>ref|XP_011046961.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011046962.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +RIGLKK+K+DKNNRIAARL++K  ++LRAS+RKY NL    G+ +DTDIV L
Sbjct  24   SASNDGLLRIGLKKVKLDKNNRIAARLDSK--ETLRASIRKY-NLCSNLGESEDTDIVAL  80

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+D+QY+GEIGVG+PPQKFTVIFDTGSSNLWVPSSKCY SV  +             +
Sbjct  81   KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYDSGKSSTYK  140

Query  823  RMGSLLKFITGLGSISG  873
            + G   +   G GSISG
Sbjct  141  KNGKSAEIRYGSGSISG  157



>ref|XP_011046729.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
 ref|XP_011046731.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
Length=515

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S  NDG +RIGLKK K ++NNR+AA+LE+K GDS    ++KY+ L    GD +DTDIV 
Sbjct  27   LSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGDS----IKKYHLLRNLGGDAEDTDIVS  82

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       ++    
Sbjct  83   LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSHSRTY  142

Query  820  RRMGSLLKFITGLGSISG  873
            +  G   +   G G+ISG
Sbjct  143  KENGKSAEIHYGTGAISG  160



>gb|KJB13725.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=421

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV
Sbjct  21   VFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIV  78

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KDO62074.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=359

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV
Sbjct  22   VFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +            
Sbjct  81   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSST  140

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  141  YKKNGKSADIHYGTGAISG  159



>gb|KJB13726.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=456

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV
Sbjct  21   VFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIV  78

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KJB13723.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=508

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV
Sbjct  21   VFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIV  78

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KHG05834.1| Asparticase [Gossypium arboreum]
Length=511

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22   FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  80   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KJB13719.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=495

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV
Sbjct  21   VFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIV  78

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KHG04193.1| Asparticase [Gossypium arboreum]
Length=514

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS  ND  VRIGLKK KID+NNR+AA LE+K G +  A +RKY  LHG  G+ +D DIV
Sbjct  22   VFSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEGKASEAFLRKY-RLHGNLGESEDIDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+  +  P    +    
Sbjct  81   ALKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPKYKSSRSRT  140

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G G+ISG
Sbjct  141  YKANGKPADIQYGTGAISG  159



>gb|KJB13718.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13721.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13724.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=512

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV
Sbjct  21   VFSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIV  78

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  79   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  126



>gb|KJB22152.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
Length=428

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS  ND  VRIGLKK KID+NNR+AA LE+K   +  A +RKY  LHG  G+ +D DIV
Sbjct  22   VFSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEEKASEAFLRKY-RLHGNLGESEDIDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+  +  P    ++   
Sbjct  81   ALKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPKYKSSHSRT  140

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G G+ISG
Sbjct  141  YKANGKPADIQYGTGAISG  159



>gb|KDO62073.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=458

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV
Sbjct  22   VFSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +            
Sbjct  81   ALKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSST  140

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  141  YKKNGKSADIHYGTGAISG  159



>gb|KDO62072.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=492

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23   FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +             
Sbjct  82   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSADIHYGTGAISG  159



>gb|KDO62068.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=510

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23   FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +             
Sbjct  82   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSADIHYGTGAISG  159



>ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
 gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
Length=514

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23   FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +             
Sbjct  82   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSADIHYGTGAISG  159



>gb|KDO62069.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=505

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23   FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +             
Sbjct  82   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSADIHYGTGAISG  159



>ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO62070.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
 gb|KDO62071.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=514

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23   FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +             
Sbjct  82   LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G G+ISG
Sbjct  142  KKNGKSADIHYGTGAISG  159



>gb|KJB22150.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
 gb|KJB22151.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
Length=514

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS  ND  VRIGLKK KID+NNR+AA LE+K   +  A +RKY  LHG  G+ +D DIV
Sbjct  22   VFSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEEKASEAFLRKY-RLHGNLGESEDIDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+  +  P    ++   
Sbjct  81   ALKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPKYKSSHSRT  140

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G G+ISG
Sbjct  141  YKANGKPADIQYGTGAISG  159



>gb|KCW77002.1| hypothetical protein EUGRSUZ_D01351 [Eucalyptus grandis]
Length=514

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
             DG +R+GLKK K D N R+AARLE++ G  LR+S+R Y+ L+G  GD Q  DIVGLKNY
Sbjct  27   EDGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYH-LNGWRGDAQLPDIVGLKNY  85

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCY SV  F       +     +R G
Sbjct  86   LDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSKYQASQSSTYKRNG  145

Query  832  SLLKFITGLGSISG  873
                   G G+ISG
Sbjct  146  KSASIQYGTGAISG  159



>ref|XP_010686810.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +R+GLKK K D+N+RIA+RL +K  ++LR+S  KY  L G + DL+  DIV L
Sbjct  26   SSSNDGLLRVGLKKKKFDQNSRIASRLGSKEREALRSSFEKY--LLGNSEDLEGADIVAL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYMDAQYFG+IGVGTPPQ FTVIFDTGSSNLWVPSSKCYFS+P F       +     +
Sbjct  84   KNYMDAQYFGDIGVGTPPQTFTVIFDTGSSNLWVPSSKCYFSIPCFFHAKYKSSASSTYK  143

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  144  KNGKSAAIHYGTGAISG  160



>emb|CAC86004.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG VRIGLKKMK+D NNR+AARL++K G++LRA ++KY       GD ++TDIV LKNY
Sbjct  27   NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRAFIKKY-RFRNNLGDSEETDIVALKNY  85

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            MDAQY+GEIG+GTP QKFTVIFDTGSSNLWV S+KCYFSV  +       ++    ++ G
Sbjct  86   MDAQYYGEIGIGTPTQKFTVIFDTGSSNLWVSSTKCYFSVACYFHEKYKASDSSTYKKDG  145

Query  832  SLLKFITGLGSISG  873
                   G G+ISG
Sbjct  146  KPASIQYGTGAISG  159



>ref|XP_010052871.1| PREDICTED: aspartic proteinase [Eucalyptus grandis]
Length=522

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
             DG +R+GLKK K D N R+AARLE++ G  LR+S+R Y+ L+G  GD Q  DIVGLKNY
Sbjct  35   EDGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYH-LNGWRGDAQLPDIVGLKNY  93

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCY SV  F       +     +R G
Sbjct  94   LDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSKYQASQSSTYKRNG  153

Query  832  SLLKFITGLGSISG  873
                   G G+ISG
Sbjct  154  KSASIQYGTGAISG  167



>ref|XP_012091315.1| PREDICTED: aspartic proteinase-like [Jatropha curcas]
 gb|KDP20718.1| hypothetical protein JCGZ_21189 [Jatropha curcas]
Length=512

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 3/138 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +S  NDG VRIGLKK+K+D+N+RIAA+LE+K  ++ RASVRKY  L G  GD +D DIV 
Sbjct  23   YSVPNDGLVRIGLKKIKLDQNSRIAAQLESK--EASRASVRKY-GLRGNLGDSEDLDIVA  79

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQY+GEI VGTPPQKFTVIFDTGSSNLWVPSSKC+ S+  +       +     
Sbjct  80   LKNYMDAQYYGEIDVGTPPQKFTVIFDTGSSNLWVPSSKCFLSIACYFHSKYKSSQSSTY  139

Query  820  RRMGSLLKFITGLGSISG  873
            R+ G   +   G G+ISG
Sbjct  140  RQNGKSAEIQYGSGAISG  157



>ref|XP_002279049.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 emb|CBI26663.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS S+ G VRIGLKK   D+ NR+AAR+E+K G++L  S+RKY NLHG     + T +V 
Sbjct  23   FSASDGGLVRIGLKKRAFDQTNRLAARIESKQGEALGTSIRKY-NLHGNAAGSKHTYVVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            L NYMDAQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       +     
Sbjct  82   LHNYMDAQYFGEISIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTSADIHYGTGAISG  159



>ref|XP_010099183.1| Aspartic proteinase [Morus notabilis]
 gb|EXB77055.1| Aspartic proteinase [Morus notabilis]
Length=513

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S + D  +RIGLKK+K D N+RIAA+L+ K G+SLR S+RKY    GR GD  +TDIV L
Sbjct  24   SATGDSLLRIGLKKVKRDPNDRIAAQLDFKKGESLRDSIRKY-RPRGRLGDAPETDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +             +
Sbjct  83   KNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVSCYFHAKYKAGQSKTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G+      G GSI G
Sbjct  143  KNGTAAAIQYGTGSIEG  159



>ref|XP_010244475.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244476.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nelumbo nucifera]
Length=517

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 85/103 (83%), Gaps = 1/103 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKKMK+D+NNR+AA L+ +  + LRAS RKY+ L G + D   TDI+ LKNY
Sbjct  30   NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYH-LGGNHEDSGATDIISLKNY  88

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            MDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +
Sbjct  89   MDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACY  131



>ref|XP_010244477.1| PREDICTED: aspartic proteinase A1-like isoform X3 [Nelumbo nucifera]
Length=514

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKKMK+D+NNR+AA L+ +  + LRAS RKY+ L G + D   TDI+ LKNY
Sbjct  27   NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYH-LGGNHEDSGATDIISLKNY  85

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            MDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  +       +     ++ G
Sbjct  86   MDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSLSSTYKKNG  145

Query  832  SLLKFITGLGSISG  873
               +   G G+I+G
Sbjct  146  KSAEIQYGTGAIAG  159



>ref|XP_007153978.1| hypothetical protein PHAVU_003G0808000g, partial [Phaseolus vulgaris]
 gb|ESW25972.1| hypothetical protein PHAVU_003G0808000g, partial [Phaseolus vulgaris]
Length=143

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKK+K+D NNR+AAR+ +K  DS RAS+RK++ L    G  +DTDIV LKNY
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSK-DDSFRASIRKFH-LQNNFGGTEDTDIVALKNY  84

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            +DAQYFGEI +GT PQKFTVIFDTGSSNLWVPSS+C FSV  +
Sbjct  85   LDAQYFGEIAIGTSPQKFTVIFDTGSSNLWVPSSRCTFSVACY  127



>gb|AEJ76922.1| aspartic protease [Dimocarpus longan]
Length=222

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS   DG VRIGLKK K+D+ +R++ ++ +  G+++RA ++KY NL    GD  DTDIV
Sbjct  22   AFSAPKDGLVRIGLKKKKLDQISRVSGQINSNEGEAIRAPIKKY-NLRSNLGD-SDTDIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGE+G+GTP Q FTVIFDTGSSNLWVPSSKCYFSV  +            
Sbjct  80   SLKNYMDAQYFGEVGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYRSTQSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G G++SG
Sbjct  140  YKKNGTSAAIQYGTGAVSG  158



>gb|KCW46980.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=462

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S S+DG VRIGLKK K+D  NR+A +  +K G + R  +RKYY LH   GD +D DIV 
Sbjct  23   ISSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYY-LHNNLGDSEDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCY SV  +       ++    
Sbjct  82   LKNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKFKSSDSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G G+ISG
Sbjct  142  KKNGKSAEIHYGTGAISG  159



>ref|XP_010553449.1| PREDICTED: aspartic proteinase A1 [Tarenaya hassleriana]
Length=518

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+ +DG  RIGLKK+K+D NNR+A+RL +K  ++LRAS++++   H   GD  DTD+V
Sbjct  22   ASSERSDGTFRIGLKKLKLDPNNRLASRLGSKQEEALRASLKEF-RFHNNLGDSGDTDVV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLW+PSSKCY SV  F       +    
Sbjct  81   ALKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWIPSSKCYLSVACFFHNKYKSSRSTT  140

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  141  YKKNGKSASIHYGTGAISG  159



>ref|XP_010035554.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010035555.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW46979.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=514

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S S+DG VRIGLKK K+D  NR+A +  +K G + R  +RKYY LH   GD +D DIV 
Sbjct  23   ISSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYY-LHNNLGDSEDIDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCY SV  +       ++    
Sbjct  82   LKNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKFKSSDSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G G+ISG
Sbjct  142  KKNGKSAEIHYGTGAISG  159



>gb|AAB60773.1| Strong similarity to Brassica aspartic protease (gb|X77260) [Arabidopsis 
thaliana]
Length=433

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A+SK NDG  R+GLKK+K+D NNR+A R  +K  ++LR+S+R Y N  G  GD  D DIV
Sbjct  22   AYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLG--GDSGDADIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+  +       +    
Sbjct  80   PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAKYKSSRSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G GSISG
Sbjct  140  YKKSGKRAAIHYGSGSISG  158



>ref|XP_011652603.1| PREDICTED: aspartic proteinase [Cucumis sativus]
Length=514

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +R+GLKK+ +D  NR+AARLE+K  + L+A+ RKY N +G  G+  DTDIV L
Sbjct  24   SVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKY-NPNGNLGESSDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV          +     +
Sbjct  83   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G+      G G++SG
Sbjct  143  KNGTSASIRYGTGAVSG  159



>ref|XP_010546667.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
 ref|XP_010546675.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
Length=508

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = +1

Query  400  MGVKAlvvtlflsslvfplAFSKSNDGFV-RIGLKKMKIDKNNRIAARLEAKAGDSLRAS  576
            MGV ++ V +FLS L+   A S SNDG   RIGLKK+K+D N R A R+ ++  D+LRAS
Sbjct  1    MGVNSVAVAVFLSFLLSCSAASVSNDGRTFRIGLKKLKLDPNKRFAERIGSRQEDALRAS  60

Query  577  VRKYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSK  756
            +++++ L    GD  DTDIV LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSK
Sbjct  61   LKEFH-LQKNLGDSGDTDIVALKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSK  119

Query  757  CYFSVPFFSIPSTPLANPVLTRRMGSLLKFITGLGSISG  873
            CY SV  F       +     R+ G       G G+ISG
Sbjct  120  CYLSVACFFHSKYKSSRSSTYRKNGKSASIHYGTGAISG  158



>gb|KGN64503.1| Aspartic proteinase [Cucumis sativus]
Length=489

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +R+GLKK+ +D  NR+AARLE+K  + L+A+ RKY N +G  G+  DTDIV L
Sbjct  37   SVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKY-NPNGNLGESSDTDIVAL  95

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV          +     +
Sbjct  96   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  155

Query  823  RMGSLLKFITGLGSISG  873
            + G+      G G++SG
Sbjct  156  KNGTSASIRYGTGAVSG  172



>ref|XP_008224698.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=514

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKK+K+D NNR+AA+LE+K  ++LRAS+RKY+ L     D  D DIV LKNY
Sbjct  27   NDGLFRIGLKKVKLDPNNRVAAQLESKNVEALRASMRKYH-LPANLEDSGDIDIVSLKNY  85

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKC+FSV  +   +         ++ G
Sbjct  86   LDAQYYGEIAIGTPPQTFTVIFDTGSANLWVPSSKCHFSVACYFHANYKSGKSSTYKKNG  145

Query  832  SLLKFITGLGSISG  873
            +      G G+ISG
Sbjct  146  TSASIQYGTGAISG  159



>ref|XP_008440898.1| PREDICTED: aspartic proteinase [Cucumis melo]
Length=514

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 96/137 (70%), Gaps = 1/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +R+GLKK+K+D  NR+AARLE+K  + L+A+ RKY N +G   +  DTDIV L
Sbjct  24   SVSNDGLLRVGLKKIKLDPENRLAARLESKDAEILKAAFRKY-NPNGNLEESSDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV          +     +
Sbjct  83   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  142

Query  823  RMGSLLKFITGLGSISG  873
            + G+      G G++SG
Sbjct  143  KNGTSASIRYGTGAVSG  159



>ref|NP_176419.2| aspartic proteinase A2 [Arabidopsis thaliana]
 ref|NP_001031219.1| aspartic proteinase A2 [Arabidopsis thaliana]
 sp|Q8VYL3.1|APA2_ARATH RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic 
protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49856.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AAN13225.1| putative aspartic protease [Arabidopsis thaliana]
 dbj|BAH19961.1| AT1G62290 [Arabidopsis thaliana]
 gb|AEE33946.1| aspartic proteinase A2 [Arabidopsis thaliana]
 gb|AEE33947.1| aspartic proteinase A2 [Arabidopsis thaliana]
Length=513

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A+SK NDG  R+GLKK+K+D NNR+A R  +K  ++LR+S+R Y N  G  GD  D DIV
Sbjct  22   AYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLG--GDSGDADIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+  +       +    
Sbjct  80   PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAKYKSSRSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G GSISG
Sbjct  140  YKKSGKRAAIHYGSGSISG  158



>ref|XP_007020768.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12293.1| Aspartic proteinase A1 [Theobroma cacao]
Length=514

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SN+  VRIGLKK K D+N R+AA L++K  ++ RAS++KY  L G   + +D DIV
Sbjct  22   VFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKY-RLQGNLQESEDIDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  81   ALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  128



>emb|CAC86003.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS SN+  VRIGLKK K D+N R+AA L++K  ++ RAS++KY  L G   + +D DIV
Sbjct  22   VFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKY-RLQGNLQESEDIDIV  80

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  81   ALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACY  128



>gb|KCW88767.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=426

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS S++G +R+GLKK K+D+ NR+AA+  +K  ++L    RKY   HG NG+  DTDIV 
Sbjct  23   FSSSDNGLIRVGLKKRKLDQLNRVAAQRYSKERETLGGLGRKY-KFHGYNGEDDDTDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            LKNYMDAQY+GEIG+GTP QKFTV+FDTGSSNLWVPSSKCYFS+  +
Sbjct  82   LKNYMDAQYYGEIGIGTPAQKFTVVFDTGSSNLWVPSSKCYFSIACY  128



>gb|KDO54713.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=432

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22   AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV  +       ++   
Sbjct  80   ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  140  YKRNGTSAAIQYGTGAISG  158



>gb|KDO54714.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=492

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22   AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV  +       ++   
Sbjct  80   ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  140  YKRNGTSAAIQYGTGAISG  158



>ref|XP_010046321.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010046325.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW88765.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
 gb|KCW88766.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=514

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS S++G +R+GLKK K+D+ NR+AA+  +K  ++L    RKY   HG NG+  DTDIV 
Sbjct  23   FSSSDNGLIRVGLKKRKLDQLNRVAAQRYSKERETLGGLGRKY-KFHGYNGEDDDTDIVS  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            LKNYMDAQY+GEIG+GTP QKFTV+FDTGSSNLWVPSSKCYFS+  +
Sbjct  82   LKNYMDAQYYGEIGIGTPAQKFTVVFDTGSSNLWVPSSKCYFSIACY  128



>ref|XP_006447588.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
 gb|ESR60828.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
Length=486

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22   AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV  +       ++   
Sbjct  80   ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  140  YKRNGTSAAIQYGTGAISG  158



>gb|KDO54711.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=530

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  38   AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  95

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV  +       ++   
Sbjct  96   ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  155

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  156  YKRNGTSAAIQYGTGAISG  174



>ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
 gb|EMJ12737.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
Length=539

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKK+K+D NNR+AA+LE+K  ++LRAS+RKY+ L     D  D DI+ LKNY
Sbjct  52   NDGLFRIGLKKVKLDPNNRVAAQLESKNVEALRASMRKYH-LPANLEDSGDIDILPLKNY  110

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKC+FSV  +   +         ++ G
Sbjct  111  LDAQYYGEIAIGTPPQTFTVIFDTGSANLWVPSSKCHFSVACYFHANYKSGKSSTYKKNG  170

Query  832  SLLKFITGLGSISG  873
            +      G G+ISG
Sbjct  171  TSASIQYGTGAISG  184



>ref|XP_006469663.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO54712.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=514

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22   AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV  +       ++   
Sbjct  80   ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  140  YKRNGTSAAIQYGTGAISG  158



>ref|XP_007215237.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
 gb|EMJ16436.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
Length=515

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS +NDG VRIGLKKMKID+   +  R  A   +       + Y+L G  GD +DTDIV 
Sbjct  23   FSTTNDGLVRIGLKKMKIDQKCHMNRRSNANEQEETPGGPIRKYHLRGNLGDSEDTDIVA  82

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            LKNYMDAQYFGEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV  F
Sbjct  83   LKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACF  129



>gb|ACN24614.1| aspartic acid protease [Phaseolus vulgaris]
Length=513

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKK+K+D NNR+AAR+ +K  DS RAS+RK++ L    G  +DTDIV LKNY
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSK-DDSFRASIRKFH-LQNNFGGTEDTDIVALKNY  84

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQYFGEI +GT PQKFTVIFDTGSSNLWVPSS C FSV  +       +     ++ G
Sbjct  85   LDAQYFGEIAIGTSPQKFTVIFDTGSSNLWVPSSLCTFSVACYFHAKYRSSKSSTYKKNG  144

Query  832  SLLKFITGLGSISG  873
            +      G G+ISG
Sbjct  145  TAAAIQYGTGAISG  158



>ref|XP_010926216.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Elaeis 
guineensis]
Length=457

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 7/135 (5%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  648
            DG +RIGLKK  +D+N+R+AARL  K G  L   V   Y L G   NGD  +TDI+ LKN
Sbjct  28   DGLIRIGLKKKPMDENSRLAARLAEKEGKPL---VAGKYGLRGGLDNGD--ETDIISLKN  82

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +     ++ 
Sbjct  83   YMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSRYKSSRSSTYQKN  142

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  143  GKSADIHYGTGSIAG  157



>ref|XP_003529645.1| PREDICTED: aspartic proteinase-like isoform X1 [Glycine max]
 ref|XP_006584085.1| PREDICTED: aspartic proteinase-like isoform X2 [Glycine max]
Length=514

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +   NDG  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23   YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFH-LQNNFGGSEETDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV  +       +     
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTAAAIQYGTGAISG  159



>gb|KHN35722.1| Aspartic proteinase [Glycine soja]
Length=514

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +   NDG  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23   YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFH-LQNNFGGSEETDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV  +       +     
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTAAAIQYGTGAISG  159



>ref|XP_008229973.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=515

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKN---NRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD  630
            FS +NDG VRIGLKKMKID+    NR +  +E +  ++    +RKY+ L G  GD +DTD
Sbjct  23   FSTTNDGLVRIGLKKMKIDQKCHMNRRSNTIEQE--ETPGGPIRKYH-LRGNLGDSEDTD  79

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            IV LKNYMDAQYFGEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV  F
Sbjct  80   IVALKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACF  129



>ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao]
 gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao]
Length=514

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N+G VRIGL K K+D+ NR+A  +++K G   R  +RKY+ L G  G   D++IV 
Sbjct  23   FSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRTPLRKYH-LQGNLGASDDSEIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFSV  +       +     
Sbjct  82   LKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  QKNGTSAAIQYGTGAISG  159



>ref|XP_010926197.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926203.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926209.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 7/135 (5%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  648
            DG +RIGLKK  +D+N+R+AARL  K G  L   V   Y L G   NGD  +TDI+ LKN
Sbjct  28   DGLIRIGLKKKPMDENSRLAARLAEKEGKPL---VAGKYGLRGGLDNGD--ETDIISLKN  82

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVP F       +     ++ 
Sbjct  83   YMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSRYKSSRSSTYQKN  142

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  143  GKSADIHYGTGSIAG  157



>ref|XP_002892661.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68920.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS+ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA     Y+L    G+ +D D+V
Sbjct  22   AFSERNDGTFRVGLKKLKLDSKNRLAARVESKQDKPLRA-----YSL----GNSEDADVV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+I+G
Sbjct  133  YEKNGKSAAIHYGTGAIAG  151



>ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
 gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
Length=550

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  N+G VRIGL K K+D+ NR+A  +++K G   R  +RKY+ L G  G   D++IV 
Sbjct  23   FSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRTPLRKYH-LQGNLGASDDSEIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFSV  +       +     
Sbjct  82   LKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  QKNGTSAAIQYGTGAISG  159



>ref|XP_009353298.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=510

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 87/138 (63%), Gaps = 5/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S  NDG VRIGLKKMKID+   +  R     G ++R      Y+L    G+ +DTDIV 
Sbjct  23   ISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK-----YHLRSNLGESEDTDIVA  77

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  +  P    +     
Sbjct  78   LKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTY  137

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  138  TKNGKSAAIQYGTGAISG  155



>gb|AAC34854.1| senescence-associated protein 4 [Hemerocallis hybrid cultivar]
Length=517

 Score =   130 bits (326),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQD-TDI  633
            A S S +G VRI LKK   D+ +R+++RL A   + L+A     Y L G   D  D TDI
Sbjct  22   ALSASAEGLVRINLKKKPFDEKSRVSSRLSADEDEPLKAR----YGLRGGLNDGADSTDI  77

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
            + LKNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+
Sbjct  78   ISLKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSI  123


 Score = 45.1 bits (105),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  753  KVLFLGSVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            K  F  +   H+KY S +SSTY KNGK A IHYGTG
Sbjct  118  KCYFSIACLLHTKYKSGRSSTYHKNGKPAAIHYGTG  153



>ref|XP_004134774.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_011658133.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_011658134.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 gb|KGN49091.1| hypothetical protein Csa_6G513550 [Cucumis sativus]
Length=516

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S SN+GF+RIGLKK+K D+N+R  A LE+K G+ L +SV K+        + ++ DIV
Sbjct  24   ATSASNEGFLRIGLKKIKYDQNSRFKALLESKKGEFLGSSVGKHNQWGNNLEESKNADIV  83

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KC FS+  F            
Sbjct  84   PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCIFSLACFFHAKYQSGRSST  143

Query  817  TRRMGSLLKFITGLGSISG  873
             +R G+      G G+ISG
Sbjct  144  YKRNGTSAAIQYGSGAISG  162



>ref|XP_009347130.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=512

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 87/138 (63%), Gaps = 5/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S  NDG VRIGLKKMKID+   +  R     G ++R      Y+L    G+ +DTDIV 
Sbjct  23   ISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK-----YHLRSNLGESEDTDIVA  77

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  +  P    +     
Sbjct  78   LKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTY  137

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  138  TKNGKSAAIQYGTGAISG  155



>ref|NP_172655.1| aspartic proteinase A1 [Arabidopsis thaliana]
 sp|O65390.1|APA1_ARATH RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17620.1| Identical to aspartic proteinase cDNA gb|U51036 from A. thaliana. 
ESTs gb|N96313, gb|T21893, gb|R30158, gb|T21482, gb|T43650, 
gb|R64749, gb|R65157, gb|T88269, gb|T44552, gb|T22542, 
gb|T76533, gb|T44350, gb|Z34591, gb|AA728734, gb|T46003, gb|R65157, 
gb|N38290, gb|AA395468, gb|T20815 and gb|Z34173 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08243.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL08259.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL36330.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAM66979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAN71979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AEE28813.1| aspartic proteinase A1 [Arabidopsis thaliana]
Length=506

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AF++ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA          R GD  D D+V
Sbjct  22   AFAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAY---------RLGDSGDADVV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+I+G
Sbjct  133  YEKNGKAAAIHYGTGAIAG  151



>ref|XP_006303952.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
 gb|EOA36850.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
Length=538

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 90/139 (65%), Gaps = 10/139 (7%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS+ +DG VR+GLKK+K+D  NR+AAR+ +K    LR          G +GD  D D+V
Sbjct  55   AFSERSDGTVRVGLKKLKLDSKNRLAARVGSKQDKPLR----------GYSGDSGDADVV  104

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  105  ALKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  164

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+ISG
Sbjct  165  YEKNGKSAAIHYGTGAISG  183



>ref|XP_011086197.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Sesamum indicum]
Length=510

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            +D  +RI +KK+K+D N+R+AARLE+K G   R  VRKY  L G+  +  D+DIV L+NY
Sbjct  27   DDALIRIRVKKLKLDGNSRLAARLESKEG---RVPVRKYSPL-GKVVNNADSDIVELENY  82

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            MDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+P +       +     +  G
Sbjct  83   MDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSKYKSSQSSTYKMNG  142

Query  832  SLLKFITGLGSISG  873
                   G G+ISG
Sbjct  143  KSAAIQYGTGAISG  156



>ref|XP_010458606.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
 ref|XP_010458607.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
Length=506

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS+ NDG  R+GLKK+K+D  NR+AA   +K G+ LRA     Y L    GD  D D+V
Sbjct  22   AFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGEPLRA-----YTL----GDSGDADVV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+ISG
Sbjct  133  YEKNGKSAAIHYGTGAISG  151



>ref|XP_010060310.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010060311.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW66975.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
 gb|KCW66976.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=515

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S S+DG +RIGLK+ ++DKN+  AARL+   G  L       +NL+G   D  D+D+V 
Sbjct  23   LSASDDGLMRIGLKRRRLDKNSWNAARLDLNEGKLLMRPSAGMHNLNGNLRDSGDSDVVA  82

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIGVG+PPQ FTVIFDTGSSNLWVPS+KC+FS+  +  P    ++    
Sbjct  83   LKNYMDAQYFGEIGVGSPPQNFTVIFDTGSSNLWVPSAKCHFSLACYMHPRYKSSHSSTY  142

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G       G GSISG
Sbjct  143  KKNGKPADIHYGTGSISG  160



>ref|XP_011086196.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Sesamum indicum]
Length=561

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            +D  +RI +KK+K+D N+R+AARLE+K G   R  VRKY  L G+  +  D+DIV L+NY
Sbjct  78   DDALIRIRVKKLKLDGNSRLAARLESKEG---RVPVRKYSPL-GKVVNNADSDIVELENY  133

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            MDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+P +       +     +  G
Sbjct  134  MDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSKYKSSQSSTYKMNG  193

Query  832  SLLKFITGLGSISG  873
                   G G+ISG
Sbjct  194  KSAAIQYGTGAISG  207



>gb|AAC49730.1| aspartic proteinase [Arabidopsis thaliana]
Length=486

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 89/138 (64%), Gaps = 9/138 (7%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F++ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA          R GD  D D+V 
Sbjct  3    FAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAY---------RLGDSGDADVVV  53

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +     
Sbjct  54   LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTY  113

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+I+G
Sbjct  114  EKNGKAAAIHYGTGAIAG  131



>ref|XP_009764301.1| PREDICTED: aspartic proteinase A1-like [Nicotiana sylvestris]
Length=339

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 6/139 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS SNDG +R+G+KK K+D+ N+    +++   +S R      Y+L G  GD  DTDIV
Sbjct  22   AFSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART-----YHLVGNIGD-SDTDIV  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS++CYFS+  +  P    ++   
Sbjct  76   ALKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSLACYLHPKYKSSHSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G GSISG
Sbjct  136  YKKNGTSAAIRYGTGSISG  154



>ref|XP_008797519.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797520.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797521.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797522.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797523.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=512

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 90/135 (67%), Gaps = 7/135 (5%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  648
            DG +RIGLKK  +D+N+R+AARL  K G  L A     Y L G   NGD  +TDI+ LKN
Sbjct  28   DGLIRIGLKKKPMDQNSRLAARLVEKEGKPLVAG---KYGLRGGLENGD--ETDIISLKN  82

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  F       +     ++ 
Sbjct  83   YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFFHSRYKSSRSSTYQKN  142

Query  829  GSLLKFITGLGSISG  873
            G       G GS+SG
Sbjct  143  GKSAAIHYGTGSVSG  157



>ref|XP_010476135.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 89/139 (64%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS+ NDG  R+GLKK+K+D  NR+AA   +K G  LR      YNL    GD  D D+V
Sbjct  22   AFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGKLLRG-----YNL----GDSGDADVV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+ISG
Sbjct  133  YEKNGKSAAIHYGTGAISG  151



>ref|XP_008342027.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=538

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 87/138 (63%), Gaps = 5/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S  +DG VRIGLKKMKID+   +  R     G  +R      Y+L G  G+ +DTDIV 
Sbjct  51   ISTPSDGLVRIGLKKMKIDQTCHLNRRNNGTPGGPIRK-----YHLRGNLGESEDTDIVA  105

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  +  P    +     
Sbjct  106  LKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTY  165

Query  820  RRMGSLLKFITGLGSISG  873
             + G       G G+ISG
Sbjct  166  TKNGKSAAIQYGTGAISG  183



>gb|EPS66177.1| hypothetical protein M569_08599, partial [Genlisea aurea]
Length=361

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 92/139 (66%), Gaps = 2/139 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS  +D F+RIGLK++++D+N+ IAARL +K  + LR   R+        G+  DTDIV
Sbjct  20   AFSSPDDEFIRIGLKRLRLDQNDDIAARLGSKNVEELRNLFRRQTLRFA--GNSADTDIV  77

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEI +GTPPQKFTVIFDTGSSNLW+PSS+C+FS+          +    
Sbjct  78   ALKNYMDAQYFGEIAIGTPPQKFTVIFDTGSSNLWIPSSRCHFSIACLFHSKYKSSQSST  137

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G G+ISG
Sbjct  138  YKKNGKPAAIHYGTGAISG  156



>ref|XP_010418214.1| PREDICTED: aspartic proteinase A2 isoform X2 [Camelina sativa]
Length=479

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = +1

Query  457  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  633
            A S+SND G +R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22   ATSESNDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNY+DAQY+GEI +GTPPQKFTVIFDTGS+NLWVPS KC+ S+  F       +   
Sbjct  80   VALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAKYKSSRSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G GSISG
Sbjct  140  TYKKDGKRAAIHYGSGSISG  159



>ref|XP_010418210.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418211.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418212.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418213.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
Length=514

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = +1

Query  457  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  633
            A S+SND G +R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22   ATSESNDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNY+DAQY+GEI +GTPPQKFTVIFDTGS+NLWVPS KC+ S+  F       +   
Sbjct  80   VALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAKYKSSRSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G GSISG
Sbjct  140  TYKKDGKRAAIHYGSGSISG  159



>gb|AFH58568.1| aspartic acid protease [Ananas comosus]
Length=514

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 7/104 (7%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG---RNGDLQDTDIVG  639
            S DG VRIGLKK  ID+NNRIAARL  K    L A+ R  Y L G   + G+  +TDI+ 
Sbjct  26   SADGLVRIGLKKRPIDENNRIAARLVEKEEGPLLAARR--YGLRGAPLKEGE--ETDIIA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
            LKNYM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+
Sbjct  82   LKNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSI  125



>ref|XP_010493478.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
 ref|XP_010493486.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 88/139 (63%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS+ NDG  R+GLKK K+D  NR+AA   +K G  LRA     Y L    GD +D D V
Sbjct  22   AFSERNDGTFRVGLKKFKLDPKNRLAAHAGSKQGKPLRA-----YTL----GDSEDADAV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+ISG
Sbjct  133  YEKNGKSAAIHYGTGAISG  151



>ref|XP_002886481.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62740.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 91/137 (66%), Gaps = 2/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S+ NDG  R+GLKK+K+D NNR+A R  +K  ++LR+S+  Y N  G   D  D DIV L
Sbjct  24   SQRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLPSYNNNLGS--DSGDADIVPL  81

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+  F       +     +
Sbjct  82   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCFFHAKFKSSRSSTYK  141

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSISG
Sbjct  142  KSGKRAAIHYGSGSISG  158



>ref|XP_006600236.1| PREDICTED: aspartic proteinase 1 isoform X1 [Glycine max]
Length=514

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23   YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFH-LQNNFGGTEETDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV  +       +     
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTAAAIQYGTGAISG  159



>gb|AAN60347.1| unknown [Arabidopsis thaliana]
Length=110

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 75/106 (71%), Gaps = 9/106 (8%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
             DG  R+GLKK+K+D  NR+AAR+E+K    LRA          R GD  D D+V LKNY
Sbjct  3    KDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAY---------RLGDSGDADVVVLKNY  53

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIP  789
            +DAQY+GEI +GTPPQKFTV+ DTGSSNLWVPSSKCYFS+     P
Sbjct  54   LDAQYYGEIAIGTPPQKFTVVXDTGSSNLWVPSSKCYFSLACLLHP  99



>emb|CDY08632.1| BnaC04g19410D [Brassica napus]
Length=511

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+SNDG +R+GLKK+K+D NNR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19   ASSESNDGTLRVGLKKLKLDPNNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+  F       +    
Sbjct  76   ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G GSI+G
Sbjct  136  YKESGKRAAIHYGSGSIAG  154



>gb|KHN03495.1| Aspartic proteinase [Glycine soja]
Length=510

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23   YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFH-LQNNFGGTEETDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV  +       +     
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTAAAIQYGTGAISG  159



>ref|XP_010430270.1| PREDICTED: aspartic proteinase A2-like [Camelina sativa]
Length=514

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 92/140 (66%), Gaps = 3/140 (2%)
 Frame = +1

Query  457  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  633
            A S+SND G  R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22   ATSESNDDGTFRVGLKKLKLDPNNRLATRFGSNQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+ S+  F       +   
Sbjct  80   VALKNYLDAQYYGEISIGTPPQKFTVIFDTGSSNLWVPSGKCFLSLSCFFHAKYKSSRSS  139

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G GSISG
Sbjct  140  TYKKSGERAAIHYGSGSISG  159



>ref|XP_006417290.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
 dbj|BAJ34217.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35643.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
Length=506

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+ NDG VR+GLKK+K+D  NR+AAR+ ++    LRA     ++L    GD  D DIV
Sbjct  22   ASSERNDGTVRVGLKKLKLDPKNRLAARISSEQEKPLRA-----FSL----GDSGDADIV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  73   ALKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+I+G
Sbjct  133  YEKNGKSAAIHYGTGAIAG  151



>sp|O04057.1|ASPR_CUCPE RecName: Full=Aspartic proteinase; Flags: Precursor [Cucurbita 
pepo]
 dbj|BAA19607.1| aspartic endopeptidase [Cucurbita pepo]
Length=513

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S SNDG +R+GLKK+K+D  NR+AAR+E+K  + L+A+ RKY N  G  G+  DTDIV L
Sbjct  24   SASNDGLLRVGLKKIKLDPENRLAARVESKDAEILKAAFRKY-NPKGNLGESSDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWV   +C FSV
Sbjct  83   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWV-LCECLFSV  124



>ref|NP_001237064.1| aspartic proteinase 1 precursor [Glycine max]
 dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]
Length=514

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+R+++ L    G  ++TDIV 
Sbjct  23   YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRQFH-LQNNFGGTEETDIVA  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV  +       +     
Sbjct  82   LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G G+ISG
Sbjct  142  KKNGTAAAIQYGTGAISG  159



>ref|XP_004151126.1| PREDICTED: aspartic proteinase A1-like [Cucumis sativus]
 ref|XP_011650512.1| PREDICTED: aspartic proteinase A1-like [Cucumis sativus]
Length=513

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F  SNDG VRIGLK+ K  +NNR+A+++  K G SL+ SV KY       GD  D DIVG
Sbjct  23   FCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKY-QPSANLGDSDDFDIVG  81

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY  762
            LKNY++AQYFGEIG+GTPPQKF VIFDTGSSNLWVPSSKC+
Sbjct  82   LKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKCF  122



>ref|XP_008800699.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S   DG +R+GLKK  +D+N+R AARL  K G  L   V   Y L G  G+  +TDIV L
Sbjct  59   SAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPL---VAGKYGLRGGLGNGDETDIVSL  115

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+                R
Sbjct  116  KNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSRYTSTRSSTYR  175

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSISG
Sbjct  176  KNGKPADIHYGTGSISG  192



>ref|XP_008440022.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440023.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440024.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440026.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
Length=516

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S SN+GF+RIGLKK++ D+N+R  A LE+K G+ L  SV K+       G+ ++ D V
Sbjct  24   ATSASNEGFLRIGLKKIRSDQNSRFKALLESKKGEFLGPSVGKHNQWGNNLGESKNADNV  83

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKC FS+  F            
Sbjct  84   PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCVFSLACFFHARYQSGRSST  143

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G G+I+G
Sbjct  144  YKKNGTSAAIQYGSGAIAG  162



>ref|XP_009123365.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123366.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123367.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123369.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
Length=509

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19   ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+  F       +    
Sbjct  76   ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G GSISG
Sbjct  136  YKESGKRAAIHYGSGSISG  154



>emb|CDY24888.1| BnaA03g59920D [Brassica napus]
Length=511

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19   ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+  F       +    
Sbjct  76   ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G       G GSISG
Sbjct  136  YKESGKRAAIHYGSGSISG  154



>gb|KGN56078.1| hypothetical protein Csa_3G066750 [Cucumis sativus]
Length=535

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             F  SNDG VRIGLK+ K  +NNR+A+++  K G SL+ SV KY       GD  D DIV
Sbjct  82   VFCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKY-QPSANLGDSDDFDIV  140

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY  762
            GLKNY++AQYFGEIG+GTPPQKF VIFDTGSSNLWVPSSKC+
Sbjct  141  GLKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKCF  182



>ref|XP_008800700.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Phoenix 
dactylifera]
Length=512

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S   DG +R+GLKK  +D+N+R AARL  K G  L   V   Y L G  G+  +TDIV L
Sbjct  24   SAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPL---VAGKYGLRGGLGNGDETDIVSL  80

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+                R
Sbjct  81   KNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSRYTSTRSSTYR  140

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSISG
Sbjct  141  KNGKPADIHYGTGSISG  157



>ref|XP_008440021.1| PREDICTED: aspartic proteinase-like isoform X1 [Cucumis melo]
Length=548

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S SN+GF+RIGLKK++ D+N+R  A LE+K G+ L  SV K+       G+ ++ D V
Sbjct  56   ATSASNEGFLRIGLKKIRSDQNSRFKALLESKKGEFLGPSVGKHNQWGNNLGESKNADNV  115

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKC FS+  F            
Sbjct  116  PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCVFSLACFFHARYQSGRSST  175

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G G+I+G
Sbjct  176  YKKNGTSAAIQYGSGAIAG  194



>ref|XP_002524837.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF37557.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=456

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS  ND  VR+GLKK K D+ N  A  ++ K G+++RA+ +KY NL   N D  D DIV 
Sbjct  20   FSLHNDALVRVGLKKKKFDQVNIPAGTVDFKEGEAMRAATKKY-NLV-ENSD--DVDIVE  75

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLW+PSSKCYFSV  +       +     
Sbjct  76   LKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWIPSSKCYFSVACYFHSKYKASESSTY  135

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G GSISG
Sbjct  136  QKNGTSAAIRYGTGSISG  153



>gb|AAB03843.2| aspartic proteinase [Vigna unguiculata]
 gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata]
Length=513

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 2/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            NDG  RIGLKK+K+D NNR+AAR+ +   DS RAS+RK++ L        +TDIV LKNY
Sbjct  27   NDGLRRIGLKKIKLDPNNRLAARIGSN-DDSFRASIRKFH-LQNNFAGTGETDIVALKNY  84

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSS+C FS+  +             RR G
Sbjct  85   LDAQYYGEISIGTSPQKFTVIFDTGSSNLWVPSSRCTFSLACYFHAKYRSGRSSTYRRNG  144

Query  832  SLLKFITGLGSISG  873
            +      G G+I+G
Sbjct  145  TAAAIQYGTGAIAG  158



>ref|XP_006364164.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=508

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 92/138 (67%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG VR+G+KK K+D+ N++   +++    S R      Y L G  GD  DTDI+ 
Sbjct  23   FSVSNDGLVRVGIKKRKLDQTNQVFGGIDSNGVHSARK-----YRLGGNVGD-SDTDIIA  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS+KC+FS+  +  P    ++    
Sbjct  77   LKNYLDAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSLACYLHPKYKSSHSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G GSISG
Sbjct  137  KKNGTSAAIHYGTGSISG  154



>ref|XP_006301275.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
 gb|EOA34173.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
Length=514

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +++DG  R+ LKK+K+D +NR+AAR  +    +L++S+R Y N  G  GD  DTDIV L
Sbjct  25   ERNDDGTFRVSLKKLKLDPHNRLAARFGSNQEKALKSSLRSYSNNLG--GDSGDTDIVAL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+  F
Sbjct  83   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCF  128



>ref|XP_009600571.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=508

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG +R+G+KK K+D+ N+    +++   +S R      Y+L G  GD  DTDI+ 
Sbjct  23   FSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART-----YHLGGNIGD-SDTDIIA  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS++CYFS+  +  P    ++    
Sbjct  77   LKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSLACYLHPKYKSSHSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G GSISG
Sbjct  137  KKNGTSAAIRYGTGSISG  154



>gb|ABG37021.1| aspartic protease [Nicotiana tabacum]
Length=508

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG +R+G+KK K+D+ N+    +++   +S R      Y+L G  GD  DTDI+ 
Sbjct  23   FSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART-----YHLGGNIGD-SDTDIIA  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS++CYFS+  +  P    ++    
Sbjct  77   LKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSLACYLHPKYKSSHSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G GSISG
Sbjct  137  KKNGTSAAIRYGTGSISG  154



>ref|XP_009123370.1| PREDICTED: aspartic proteinase A2 isoform X2 [Brassica rapa]
Length=501

 Score =   134 bits (336),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19   ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFS  768
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS
Sbjct  76   ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFS  119


 Score = 33.9 bits (76),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +3

Query  792  YTSSQSSTYEKNGKSAEIHYGTG  860
            Y SS+SSTY+++GK A IHYG+G
Sbjct  120  YKSSRSSTYKESGKRAAIHYGSG  142



>ref|XP_012087600.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Jatropha curcas]
 ref|XP_012087601.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Jatropha curcas]
 gb|KDP24853.1| hypothetical protein JCGZ_24447 [Jatropha curcas]
Length=512

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNG--DLQDTD  630
            A S  N G +RIGLKK K+D+ NR A  +++K G+S+R + +KY   H RN   D  D +
Sbjct  19   ALSVHNVGLIRIGLKKRKMDQVNRPAGTIDSKEGESMRTATKKY---HFRNDLRDSGDAE  75

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
             V LKNY+DAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+  +       +  
Sbjct  76   FVTLKNYLDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSRYKSSES  135

Query  811  VLTRRMGSLLKFITGLGSISG  873
                + G+      G GSI+G
Sbjct  136  STYEKNGTSAAIRYGTGSIAG  156



>ref|XP_012087602.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Jatropha curcas]
Length=511

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNG--DLQDTD  630
            A S  N G +RIGLKK K+D+ NR A  +++K G+S+R + +KY   H RN   D  D +
Sbjct  19   ALSVHNVGLIRIGLKKRKMDQVNRPAGTIDSKEGESMRTATKKY---HFRNDLRDSGDAE  75

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
             V LKNY+DAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+  +       +  
Sbjct  76   FVTLKNYLDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSRYKSSES  135

Query  811  VLTRRMGSLLKFITGLGSISG  873
                + G+      G GSI+G
Sbjct  136  STYEKNGTSAAIRYGTGSIAG  156



>gb|AFB73927.2| preprocirsin [Cirsium vulgare]
Length=509

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S SNDG +R+GLKK K+D+ N+++       G S+    RK +   G   D  D+DI+
Sbjct  22   AISVSNDGLIRVGLKKRKVDQINQLSGH-----GASMEGKARKDFGFGGTLRD-SDSDII  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQY+GEIG+G PPQKFTVIFDTGSSNLWVPS+KCYFSV          ++   
Sbjct  76   ALKNYMDAQYYGEIGIGAPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G GSISG
Sbjct  136  YKKNGTSAAIQYGTGSISG  154



>ref|XP_004287958.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 92/140 (66%), Gaps = 6/140 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQ-DTDI  633
             S SNDG VRIGLKK+K+D+ ++I     A+ A  S+RA +++Y       GD   DTDI
Sbjct  23   LSTSNDGLVRIGLKKVKLDQTSQIHRDTNAQNAQGSVRAPLKEYR----LRGDYSGDTDI  78

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  F       +   
Sbjct  79   VELKNYMDAQYFGEIGIGTPVQKFTVIFDTGSSNLWVPSAKCYFSVACFFHSKYKSSQSS  138

Query  814  LTRRMGSLLKFITGLGSISG  873
               + G+      G G+I+G
Sbjct  139  SHTKNGTSAAIQYGTGAIAG  158



>emb|CAA56373.1| putative aspartic protease [Brassica oleracea]
Length=255

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 79/105 (75%), Gaps = 9/105 (9%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A ++ NDG  R+GLKK+K+D+ +RIAAR+ +K    LR      Y L    GD  D DIV
Sbjct  22   ASAERNDGTFRVGLKKLKLDRKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+
Sbjct  73   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSI  117



>ref|XP_006391910.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
 gb|ESQ29196.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
Length=511

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 80/105 (76%), Gaps = 5/105 (5%)
 Frame = +1

Query  466  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  645
            + NDG  RIGLKK+K+D NNR+AAR  +K  + L+  +R   NL G +GD    DIV LK
Sbjct  26   ERNDGTFRIGLKKLKLDPNNRLAARFGSKQ-EELK-EIRSNNNLLGDSGD---ADIVALK  80

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            NY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+  F
Sbjct  81   NYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCF  125



>ref|XP_009395027.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395028.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S + DG +RIGL+K  +D+N+R+A RL  K G +L     +Y    G   + +D DI+ L
Sbjct  26   SAAADGLIRIGLRKKALDENSRLAGRLLEKEGKALMGP--RYGLRGGLESNDEDADIISL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCYFS+  +       +      
Sbjct  84   KNYMNAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSQSSTYE  143

Query  823  RMGSLLKFITGLGSISG  873
            + G   +   G GSISG
Sbjct  144  KNGKTAEIHYGTGSISG  160



>ref|XP_003546159.1| PREDICTED: aspartic proteinase-like [Glycine max]
Length=507

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F   NDG  RIGLKK+K+D ++ +  +         R+S+RK++ L    G  +DTD+V 
Sbjct  23   FCAPNDGLRRIGLKKVKLDTDDVVGFK-------EFRSSIRKHH-LQNILGGAEDTDVVA  74

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  F       +     
Sbjct  75   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHARYRSSQSSTY  134

Query  820  RRMGSLLKFITGLGSISG  873
            R  G+      G G+ISG
Sbjct  135  RENGTSAAIQYGTGAISG  152



>gb|KHN33009.1| Aspartic proteinase [Glycine soja]
Length=504

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F   NDG  RIGLKK+K+D ++ +  +         R+S+RK++ L    G  +DTD+V 
Sbjct  20   FCAPNDGLRRIGLKKVKLDTDDVVGFK-------EFRSSIRKHH-LQNILGGAEDTDVVA  71

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV  F       +     
Sbjct  72   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHARYRSSQSSTY  131

Query  820  RRMGSLLKFITGLGSISG  873
            R  G+      G G+ISG
Sbjct  132  RENGTSAAIQYGTGAISG  149



>emb|CAA57510.1| cyprosin [Cynara cardunculus]
Length=509

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 93/141 (66%), Gaps = 10/141 (7%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDT--D  630
            AFS SN G +R+GLKK K+D+ N+++       G S+ A  RK +   G  G L+D+  D
Sbjct  22   AFSVSNGGLLRVGLKKRKVDQINQLSGH-----GVSMEAKARKDF---GFGGALRDSGSD  73

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
            I+ LKNYMDAQY+GEIG+G+PPQKFTVIFDTGSSNLWVPS+KCYFSV          ++ 
Sbjct  74   IIALKNYMDAQYYGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHS  133

Query  811  VLTRRMGSLLKFITGLGSISG  873
               ++ G+      G GSISG
Sbjct  134  STYKKNGTSAAIQYGTGSISG  154



>gb|AJA72485.1| arctiumsin [Arctium minus]
Length=509

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS SN G +R+GLKK K+D+ N++        G S+    RK +   G   D  D+DI+
Sbjct  22   AFSVSNGGLIRVGLKKRKVDQINQLRGH-----GASMEGKARKDFGFGGTLRD-SDSDII  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQY+GEIG+G PPQKFTVIFDTGSSNLWVPS+KCYFSV          ++   
Sbjct  76   ALKNYMDAQYYGEIGIGAPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G GSISG
Sbjct  136  YKKNGTSAAIQYGTGSISG  154



>ref|XP_010924299.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase oryzasin-1-like 
[Elaeis guineensis]
Length=546

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 88/135 (65%), Gaps = 8/135 (6%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  648
            DG +RIGLKK  +D+N+R+AARL  + G  L A     Y L G   NGD  +TDI+ LKN
Sbjct  63   DGLIRIGLKKKPMDQNSRLAARL-VEEGKPLMAG---KYGLRGGPENGD--ETDIISLKN  116

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  F             ++ 
Sbjct  117  YMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYRSTRSSTYQKN  176

Query  829  GSLLKFITGLGSISG  873
            G       G GSISG
Sbjct  177  GKPADIHYGTGSISG  191



>ref|XP_006838131.1| PREDICTED: cyprosin [Amborella trichopoda]
 gb|ERN00700.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
Length=513

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  654
            +G VRIGLKK  +D N+ +A+R+ A  G + +   RK+  L G   +  D DI+ LKNYM
Sbjct  27   NGLVRIGLKKKSLDPNSLLASRIAAGDGKASKTQPRKFCGLRGNTLN-SDEDIISLKNYM  85

Query  655  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGS  834
            DAQY+GEIGVG+PPQ FTVIFDTGSSNLWVPSSKCYFSV  +       +     +  G 
Sbjct  86   DAQYYGEIGVGSPPQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASKSSSYKENGK  145

Query  835  LLKFITGLGSISG  873
              +   G GS+SG
Sbjct  146  SCEIHYGTGSVSG  158



>dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]
Length=514

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            ND  +R+GLKK K+D+ NR ++    K  +S+  ++RKY  L    G+  D DI+ LKNY
Sbjct  27   NDRLLRVGLKKRKLDQINRFSSLYGCKGKESINPAIRKY-GLGNGLGNSDDADIISLKNY  85

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            M+AQYFGEIG+GTPPQKFT+IFDTGSSNLWVPS+KCYFS+  +       +      + G
Sbjct  86   MNAQYFGEIGIGTPPQKFTLIFDTGSSNLWVPSAKCYFSIACYFHSKYKSSLSSSYTKNG  145

Query  832  SLLKFITGLGSISG  873
               +   G G+ISG
Sbjct  146  KSAEIHYGTGAISG  159



>ref|XP_009358756.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 89/139 (64%), Gaps = 9/139 (6%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIV  636
            S  NDG  RI LKK+K+D N+R+AA+LE+K G      +RKY  L    G+ +  D DIV
Sbjct  21   SAPNDGLSRIALKKVKLDSNDRVAAQLESKNG------LRKY-RLPSNLGEPESGDVDIV  73

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  F            
Sbjct  74   SLKNYLDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYFSLACFFHAKYDSGQSRT  133

Query  817  TRRMGSLLKFITGLGSISG  873
             +  G+      G G+ISG
Sbjct  134  YKNNGTSASIQYGTGAISG  152



>ref|XP_009394234.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 86/135 (64%), Gaps = 6/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S DG VRIGLKK  +D+N+R AARL        R S+ + +    +NG+  D DI+ LKN
Sbjct  26   SADGLVRIGLKKKPLDENDRFAARLVQDG----RRSISREHGFRLKNGE--DVDIISLKN  79

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGE+G+G+P QKFTVIFDTGSSNLWVPSSKCYFS+  F             ++ 
Sbjct  80   YMNAQYFGEVGIGSPSQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYKSTRSSSYQKN  139

Query  829  GSLLKFITGLGSISG  873
            G       G GSISG
Sbjct  140  GKSAAIHYGSGSISG  154



>ref|XP_009410967.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410968.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410969.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG-RNGDLQDTDIVGLK  645
            S DG VRI LKK  +D+N R+AARL     +  R   RK    HG R G+ +DTDIV LK
Sbjct  26   SADGLVRIKLKKKPLDENGRLAARL---VQERRRLMARK----HGFRLGNGEDTDIVSLK  78

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NYM+AQYFGEIG+G+P QKFTVIFDTGSSNLWVPSSKCYFSV  F             ++
Sbjct  79   NYMNAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSSKCYFSVACFLHSRYKSTRSSTYQK  138

Query  826  MGSLLKFITGLGSISG  873
             G       G G+ISG
Sbjct  139  NGKSAAIHYGSGAISG  154



>ref|XP_011100273.1| PREDICTED: cyprosin-like [Sesamum indicum]
Length=504

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 87/139 (63%), Gaps = 9/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
             FS   DG +RIGLKK K+++ NR +  L +K G S         NL G N ++  TDI+
Sbjct  20   VFSARADGLLRIGLKKRKLNQINRFSETLGSKQGGS--------NNLGGVN-EVSGTDII  70

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV          +    
Sbjct  71   SLKNYLDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYKSSRSST  130

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G       G GSISG
Sbjct  131  YKKNGKSAAIHYGTGSISG  149



>ref|XP_009390744.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 91/150 (61%), Gaps = 14/150 (9%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDT---  627
            F+ S DG VRIGLKK  +D+N R+A RL    G  L  + RKY   LH R+G   D    
Sbjct  23   FAVSADGLVRIGLKKRPLDQNGRLATRLSRDEG-LLAPAARKYGLPLH-RDGLRLDPGLD  80

Query  628  --------DIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFS  783
                    D+V LKNYM+AQYFGEIG+G+PPQ FTV+FDTGSSNLWVPSSKCYFSV  + 
Sbjct  81   GPAGPDAGDVVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACYF  140

Query  784  IPSTPLANPVLTRRMGSLLKFITGLGSISG  873
             P    +     ++ G       G GSISG
Sbjct  141  HPKYKSSQSSTYQKNGKSANIHYGTGSISG  170



>emb|CDP10762.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SND  +R+ LKK K+D+ +R +  ++   G   R + R+       N    DTDI+ 
Sbjct  23   FSASNDKLIRVALKKTKLDQISRFSGNVDLTEGGFARINRRR------GNVVQSDTDIIA  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPS KCYFSV  +        +    
Sbjct  77   LKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSVKCYFSVACYFHSKYKSGHSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G GSISG
Sbjct  137  KKNGKSAEIHYGTGSISG  154



>ref|XP_008647844.1| PREDICTED: aspartic proteinase oryzasin-1 isoform X1 [Zea mays]
 gb|ACN27572.1| unknown [Zea mays]
 gb|ACR38429.1| unknown [Zea mays]
 gb|AFW79205.1| aspartic proteinase oryzasin-1 isoform 1 [Zea mays]
 gb|AFW79206.1| aspartic proteinase oryzasin-1 isoform 2 [Zea mays]
Length=510

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 88/135 (65%), Gaps = 4/135 (3%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S++G VR+ LKK+ +D+N R+AARL A+    L   + +  N  G  GD  D+D++ LKN
Sbjct  24   SSEGLVRVALKKLPVDQNGRVAARLSAEERQRL---LLRGANALGSGGD-DDSDVIALKN  79

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIGVG+P QKFTVIFDTGSSNLWVPSSKCYFS+  +             ++ 
Sbjct  80   YMNAQYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKN  139

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  140  GKPAAIRYGTGSIAG  154



>ref|XP_009118162.1| PREDICTED: aspartic proteinase A1 [Brassica rapa]
Length=506

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 78/105 (74%), Gaps = 9/105 (9%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV
Sbjct  22   ASAERNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+
Sbjct  73   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSI  117



>ref|NP_001148782.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG32889.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=510

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 88/135 (65%), Gaps = 4/135 (3%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S++G VR+ LKK+ +D+N R+AARL A+    L   + +  N  G  GD  D+D++ LKN
Sbjct  24   SSEGLVRVALKKLPVDQNGRVAARLSAEERQRL---LLRGSNALGSGGD-DDSDVIALKN  79

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIGVG+P QKFTVIFDTGSSNLWVPSSKCYFS+  +             ++ 
Sbjct  80   YMNAQYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKN  139

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  140  GKPAAIRYGTGSIAG  154



>ref|XP_009357472.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
 ref|XP_009357473.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 9/136 (7%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIVGLK  645
            NDG  RIGLK++K+D N+R+AA+LE+K G      +RKY  L    G+ +  D DIV LK
Sbjct  24   NDGLSRIGLKRVKLDSNDRVAAQLESKYG------LRKY-RLPSNLGESESGDVDIVSLK  76

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NY+DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKCYFS   +             ++
Sbjct  77   NYLDAQYYGEIAIGTPPQPFTVIFDTGSANLWVPSSKCYFSFACYFHARYKSGQSKTYKK  136

Query  826  MGSLLKFITGLGSISG  873
             G+      G G+ISG
Sbjct  137  NGTSASIQYGTGAISG  152



>gb|AGP76185.1| aspartic proteinase [Brassica rapa subsp. chinensis]
Length=506

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV L
Sbjct  24   AEGNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIVTL  74

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
            KNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+
Sbjct  75   KNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSI  117



>ref|XP_006654801.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=509

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            + + +G VRI LKK  ID+N+R+AA+L  + G + R  +R   +L G      + DIV L
Sbjct  22   ASAAEGLVRIALKKRPIDENSRVAAQLSGEEG-ARRLGLRGANSLGGGG---SEGDIVAL  77

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  F             +
Sbjct  78   KNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYKSGQSSTYQ  137

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSI+G
Sbjct  138  KNGKPAAIQYGTGSIAG  154



>ref|XP_004243484.1| PREDICTED: cyprosin-like [Solanum lycopersicum]
Length=508

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG VR+ +KK K+D+ N +   +++    S R      Y L G  GD  D+ I+ 
Sbjct  23   FSVSNDGLVRVEIKKRKLDQTNHVFGGIDSNGVHSARK-----YRLGGNVGD-SDSGIIA  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS+KC+FS+  +  P    ++    
Sbjct  77   LKNYLDAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSLACYLHPKYKSSHSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G+      G GSISG
Sbjct  137  KKNGTSAAIHYGTGSISG  154



>ref|XP_004293311.1| PREDICTED: aspartic proteinase A1 [Fragaria vesca subsp. vesca]
Length=512

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 88/135 (65%), Gaps = 6/135 (4%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTDIVGLKN  648
            NDG VRIGLKK+K D N R+AA  +   G     S+RKY +  +  + + +D DIV LKN
Sbjct  28   NDGLVRIGLKKVKPDANQRLAAGYKNGEG-----SIRKYRFGSNVGDAEGEDIDIVKLKN  82

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            Y+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPS+KCYFSV  +       ++    ++ 
Sbjct  83   YLDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSNKCYFSVACYFHAKYKSSDSSTYKKN  142

Query  829  GSLLKFITGLGSISG  873
            G       G GSISG
Sbjct  143  GKSAAIQYGTGSISG  157



>emb|CDY34819.1| BnaA09g47450D [Brassica napus]
Length=615

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 77/103 (75%), Gaps = 9/103 (9%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV L
Sbjct  133  AEGNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIVTL  183

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
            KNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+
Sbjct  184  KNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSI  226



>emb|CAA70340.1| aspartic proteinase [Centaurea calcitrapa]
Length=509

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS SN G +R+GLKK K+D+ N++        G S+    RK +   G   D  D+DI+
Sbjct  22   AFSASNGGLLRVGLKKRKVDQINQLRNH-----GASMEGKARKDFGFGGSLRD-SDSDII  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQY+GEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV          ++   
Sbjct  76   ELKNYMDAQYYGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G GSISG
Sbjct  136  YKKNGTSAAIQYGTGSISG  154



>ref|XP_003610462.1| Aspartic proteinase [Medicago truncatula]
 gb|AES92659.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=519

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 11/140 (8%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAG-------DSLRASVRKYYNLHGRNGDLQDTDI  633
            DG  RI LKK+++D+NN++AA   A AG       DSL++S+RKY NL     + Q+TDI
Sbjct  30   DGLRRIALKKIQLDRNNKLAAAAAAAAGGRRTKDTDSLQSSIRKY-NLAN---NYQETDI  85

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV  +           
Sbjct  86   VALKNYLDAQYYGEISIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSTKST  145

Query  814  LTRRMGSLLKFITGLGSISG  873
              R+ G+      G G+ISG
Sbjct  146  TYRKNGTAAAIQYGTGAISG  165



>gb|AGE15494.1| preprosilpepsin 1 [Silybum marianum]
Length=506

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 87/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            AFS SN G VR+GLKK K+D+ N+++       G S+    RK +       D  D+DI+
Sbjct  22   AFSVSNGGLVRVGLKKRKVDQINQLSGH-----GASMEGKARKDFGFGSTLRD-SDSDII  75

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQY+GEIG+G P QKFTVIFDTGSSNLWVPS+KCYFSV          ++   
Sbjct  76   ALKNYMDAQYYGEIGIGEPAQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  817  TRRMGSLLKFITGLGSISG  873
             ++ G+      G GSISG
Sbjct  136  YKKNGTSAAIQYGTGSISG  154



>ref|XP_003567869.1| PREDICTED: phytepsin [Brachypodium distachyon]
Length=505

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 83/135 (61%), Gaps = 12/135 (9%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLKN  648
            +G VRI LKK  ID+NNR+A RL  + G           +L G N  G   + DIV L+N
Sbjct  26   EGLVRIALKKRPIDQNNRVATRLSGEEGQ----------HLGGANSLGSEDEGDIVALQN  75

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+  +             ++ 
Sbjct  76   YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYFHSRYKAGQSSTYKKN  135

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  136  GKPAAIQYGTGSIAG  150



>dbj|BAA06876.1| aspartic protease [Oryza sativa]
 dbj|BAA06875.1| aspartic protease [Oryza sativa]
Length=509

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            + + +G VRI LKK  ID+N+R+AARL  + G + R  +R   +L G      + DIV L
Sbjct  22   ASAEEGLVRIALKKRPIDENSRVAARLSGEEG-ARRLGLRGANSLGGGG---GEGDIVAL  77

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+  F             +
Sbjct  78   KNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQ  137

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSI+G
Sbjct  138  KNGKPAAIQYGTGSIAG  154



>ref|XP_008371074.1| PREDICTED: aspartic proteinase [Malus domestica]
Length=508

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 9/108 (8%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIV  636
            S  NDG  RIGLKK+K+D N+ +AA+LE+K G      +RKY  L    G+ +  D DIV
Sbjct  21   SAPNDGLSRIGLKKVKLDSNDWVAAQLESKNG------LRKY-RLPSNLGEPESGDVDIV  73

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYMDAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCY S+  F
Sbjct  74   SLKNYMDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYVSLACF  121



>gb|KJB13722.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=492

 Score =   115 bits (288),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22   FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  640  LKNYMDAQYFGEIGVGTPPQKFTV  711
            LKNYMDAQYFGEIG+GTPPQ FT+
Sbjct  80   LKNYMDAQYFGEIGIGTPPQNFTI  103


 Score = 43.5 bits (101),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + +FHS+Y SS SSTY  NGK A+I YGTG
Sbjct  104  ACYFHSRYKSSHSSTYNANGKPADIKYGTG  133



>ref|XP_003534602.1| PREDICTED: aspartic proteinase [Glycine max]
 gb|KHN40871.1| Aspartic proteinase [Glycine soja]
Length=507

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            F   NDG  RIGLKK+K++ ++        +     R+S+RK++ L    G  ++TD+V 
Sbjct  23   FCAPNDGLGRIGLKKVKLNTHD-------VEGLKEFRSSIRKHH-LQNILGGAEETDVVA  74

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  F       +     
Sbjct  75   LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFMHARYRSSQSSTY  134

Query  820  RRMGSLLKFITGLGSISG  873
            R  G+      G G+ISG
Sbjct  135  RENGTSAAIQYGTGAISG  152



>ref|XP_008349314.1| PREDICTED: aspartic proteinase-like [Malus domestica]
Length=507

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 88/136 (65%), Gaps = 9/136 (7%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIVGLK  645
            NDG  RIGLK++K+D N+R+AA+LE+K  + LR      Y L    G+ +  D DIV LK
Sbjct  24   NDGLSRIGLKRVKLDSNDRVAAQLESK--NRLRK-----YRLPSNLGESESGDVDIVSLK  76

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NY+DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKCYFS   +             ++
Sbjct  77   NYLDAQYYGEIAIGTPPQPFTVIFDTGSTNLWVPSSKCYFSFACYFHARYKSGQSKTYKK  136

Query  826  MGSLLKFITGLGSISG  873
             G+      G G+ISG
Sbjct  137  NGTSASIQYGTGAISG  152



>ref|NP_001056348.1| Os05g0567100 [Oryza sativa Japonica Group]
 sp|Q42456.2|ASPR1_ORYSJ RecName: Full=Aspartic proteinase oryzasin-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAU10663.1| aspartic proteinase oryzasin 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18262.1| Os05g0567100 [Oryza sativa Japonica Group]
 gb|EAY99059.1| hypothetical protein OsI_21016 [Oryza sativa Indica Group]
 gb|ACA50495.1| aspartic proteinase oryzasin 1 [Oryza sativa Japonica Group]
 dbj|BAG90572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96074.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96985.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64719.1| hypothetical protein OsJ_19575 [Oryza sativa Japonica Group]
Length=509

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            + + +G VRI LKK  ID+N+R+AARL  + G + R  +R   +L G      + DIV L
Sbjct  22   ASAAEGLVRIALKKRPIDENSRVAARLSGEEG-ARRLGLRGANSLGGGG---GEGDIVAL  77

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+  F             +
Sbjct  78   KNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQ  137

Query  823  RMGSLLKFITGLGSISG  873
            + G       G GSI+G
Sbjct  138  KNGKPAAIQYGTGSIAG  154



>dbj|BAB20973.1| aspartic proteinase 5 [Nepenthes alata]
Length=358

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS S DG VRIGLK+   D N+  A R+  KAG  +   ++++    G +    DTDIV 
Sbjct  20   FSTSADGLVRIGLKRQFSDSNSIRAVRIARKAG--MNQGLKRFQYSFGDS----DTDIVY  73

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEIG+G+PPQKF+VIFDTGSSNLWVPSSKCYFSV  +       +     
Sbjct  74   LKNYLDAQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSKSSTY  133

Query  820  RRMGSLLKFITGLGSISG  873
             ++G   +   G GSISG
Sbjct  134  TKIGKSCEIDYGSGSISG  151



>ref|XP_009421489.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 89/145 (61%), Gaps = 11/145 (8%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNL--------HGRNGDLQ-  621
            S +G VRIGLKK  +D+N R+AARL       + A+ RKY  L        HG +G  + 
Sbjct  24   SANGLVRIGLKKRPLDRNGRLAARLSHPEELGVLAA-RKYGPLLRDSLGLEHGPDGPAEP  82

Query  622  -DTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTP  798
             D +IV LKNYM+AQYFGEIG+G+PPQ FTV+FDTGSSNLWVPSSKCYFSV  F      
Sbjct  83   DDGNIVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACFFHAKYK  142

Query  799  LANPVLTRRMGSLLKFITGLGSISG  873
                   ++ G       G GS+SG
Sbjct  143  SGRSSTYQKNGKTANIHYGTGSVSG  167



>dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]
Length=514

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  654
            D  +R+GLKK K+D+ NR+++    K   S   S+ K+  L    G+  D DI+ LKNYM
Sbjct  28   DRLLRVGLKKRKLDQINRLSSHYGCKGKGSTSPSIWKH-GLGNGLGNSDDADIISLKNYM  86

Query  655  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGS  834
            DAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPS+KCYFS+  +  P           + G 
Sbjct  87   DAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSFKSSTYAKNGK  146

Query  835  LLKFITGLGSISG  873
                  G G+ISG
Sbjct  147  SAAIHYGTGAISG  159



>ref|XP_009416572.1| PREDICTED: aspartic proteinase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=505

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 86/141 (61%), Gaps = 18/141 (13%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ------DTD  630
            S+DG +R+ LKK  +D+N   AAR+           VRK  N+H +N          D D
Sbjct  23   SSDGLLRVKLKKRPLDRNTLDAARI-----------VRKE-NMHSQNNAFHHNLEDSDID  70

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
            IV LKNYMDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKC+FSVP +        + 
Sbjct  71   IVSLKNYMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHKYKSGSS  130

Query  811  VLTRRMGSLLKFITGLGSISG  873
               R+ G   K   G G+ISG
Sbjct  131  STYRKNGKSCKITYGSGTISG  151



>ref|XP_009416564.1| PREDICTED: aspartic proteinase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 86/141 (61%), Gaps = 18/141 (13%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ------DTD  630
            S+DG +R+ LKK  +D+N   AAR+           VRK  N+H +N          D D
Sbjct  45   SSDGLLRVKLKKRPLDRNTLDAARI-----------VRKE-NMHSQNNAFHHNLEDSDID  92

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
            IV LKNYMDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKC+FSVP +        + 
Sbjct  93   IVSLKNYMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHKYKSGSS  152

Query  811  VLTRRMGSLLKFITGLGSISG  873
               R+ G   K   G G+ISG
Sbjct  153  STYRKNGKSCKITYGSGTISG  173



>ref|XP_007036022.1| Aspartic proteinase, putative isoform 5 [Theobroma cacao]
 gb|EOY06948.1| Aspartic proteinase, putative isoform 5 [Theobroma cacao]
Length=418

 Score =   117 bits (294),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 15/109 (14%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-----I  633
            S+DG VR+GLKK + D N+  AAR++ K  DS+ A         G      D+D      
Sbjct  23   SSDGLVRVGLKKQRFDINSINAARIKGK--DSMYAK--------GEGSTTHDSDDSTLNT  72

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            V LKNY+D QYFGEIG+G+PPQKFTVIFDTGSSNLW+PSS CYFSV  F
Sbjct  73   VSLKNYLDVQYFGEIGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACF  121


 Score = 39.7 bits (91),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + FFHS+Y SS+SSTY + GK  +IHY +G
Sbjct  119  ACFFHSRYNSSKSSTYTEIGKPCKIHYSSG  148



>ref|XP_007036021.1| Aspartic proteinase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06947.1| Aspartic proteinase, putative isoform 4, partial [Theobroma cacao]
Length=456

 Score =   117 bits (292),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 15/109 (14%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-----I  633
            S+DG VR+GLKK + D N+  AAR++ K  DS+ A         G      D+D      
Sbjct  23   SSDGLVRVGLKKQRFDINSINAARIKGK--DSMYAK--------GEGSTTHDSDDSTLNT  72

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            V LKNY+D QYFGEIG+G+PPQKFTVIFDTGSSNLW+PSS CYFSV  F
Sbjct  73   VSLKNYLDVQYFGEIGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACF  121


 Score = 40.0 bits (92),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + FFHS+Y SS+SSTY + GK  +IHY +G
Sbjct  119  ACFFHSRYNSSKSSTYTEIGKPCKIHYSSG  148



>ref|XP_007036019.1| Aspartic proteinase A1, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY06945.1| Aspartic proteinase A1, putative isoform 2, partial [Theobroma 
cacao]
Length=489

 Score =   117 bits (292),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 15/109 (14%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-----I  633
            S+DG VR+GLKK + D N+  AAR++ K  DS+ A         G      D+D      
Sbjct  23   SSDGLVRVGLKKQRFDINSINAARIKGK--DSMYAK--------GEGSTTHDSDDSTLNT  72

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            V LKNY+D QYFGEIG+G+PPQKFTVIFDTGSSNLW+PSS CYFSV  F
Sbjct  73   VSLKNYLDVQYFGEIGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACF  121


 Score = 40.0 bits (92),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + FFHS+Y SS+SSTY + GK  +IHY +G
Sbjct  119  ACFFHSRYNSSKSSTYTEIGKPCKIHYSSG  148



>ref|XP_007036020.1| Aspartic proteinase, putative isoform 3, partial [Theobroma cacao]
 gb|EOY06946.1| Aspartic proteinase, putative isoform 3, partial [Theobroma cacao]
Length=456

 Score =   117 bits (292),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 15/109 (14%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-----I  633
            S+DG VR+GLKK + D N+  AAR++ K  DS+ A         G      D+D      
Sbjct  23   SSDGLVRVGLKKQRFDINSINAARIKGK--DSMYAK--------GEGSTTHDSDDSTLNT  72

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            V LKNY+D QYFGEIG+G+PPQKFTVIFDTGSSNLW+PSS CYFSV  F
Sbjct  73   VSLKNYLDVQYFGEIGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACF  121


 Score = 40.0 bits (92),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + FFHS+Y SS+SSTY + GK  +IHY +G
Sbjct  119  ACFFHSRYNSSKSSTYTEIGKPCKIHYSSG  148



>emb|CDY21021.1| BnaA08g25040D [Brassica napus]
Length=526

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A ++ NDG VR+GLKK+K D    ++AR    A  S   +  + YNL    GD  D DIV
Sbjct  41   ASAERNDGTVRVGLKKLKSDPQIHLSAR----AFGSHEENPPRAYNL----GDSGDADIV  92

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  93   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  152

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+I+G
Sbjct  153  YEKNGKSAAIHYGTGAIAG  171



>ref|XP_009110686.1| PREDICTED: aspartic proteinase A1-like [Brassica rapa]
Length=507

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 86/139 (62%), Gaps = 8/139 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A ++ NDG VR+GLKK+K D    ++AR    A  S   +  + YNL    GD  D DIV
Sbjct  22   ASAERNDGTVRVGLKKLKSDPQIHLSAR----AFGSHEENPPRAYNL----GDSGDADIV  73

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+     P    +    
Sbjct  74   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  133

Query  817  TRRMGSLLKFITGLGSISG  873
              + G       G G+I+G
Sbjct  134  YEKNGKSAAIHYGTGAIAG  152



>ref|XP_007036018.1| Aspartic proteinase, putative isoform 1 [Theobroma cacao]
 gb|EOY06944.1| Aspartic proteinase, putative isoform 1 [Theobroma cacao]
Length=507

 Score =   116 bits (291),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 15/109 (14%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-----I  633
            S+DG VR+GLKK + D N+  AAR++ K  DS+ A         G      D+D      
Sbjct  23   SSDGLVRVGLKKQRFDINSINAARIKGK--DSMYAK--------GEGSTTHDSDDSTLNT  72

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            V LKNY+D QYFGEIG+G+PPQKFTVIFDTGSSNLW+PSS CYFSV  F
Sbjct  73   VSLKNYLDVQYFGEIGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACF  121


 Score = 40.0 bits (92),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  771  SVFFHSKYTSSQSSTYEKNGKSAEIHYGTG  860
            + FFHS+Y SS+SSTY + GK  +IHY +G
Sbjct  119  ACFFHSRYNSSKSSTYTEIGKPCKIHYSSG  148



>emb|CDY31221.1| BnaC08g15160D [Brassica napus]
Length=595

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 105/170 (62%), Gaps = 10/170 (6%)
 Frame = +1

Query  370  LKFLCEF*VKMGV--KAlvvtlflsslvfplAFSKSNDGFVRIGLKKMKIDKNNRIAARL  543
            L+F C    +MG+  + + V+L +S L+F  A ++ NDG  R+GLKK+K+D    +AAR 
Sbjct  79   LRFSCHSFGEMGIYSRTVAVSLVVSFLLFLSASAERNDGTFRVGLKKLKLDPKGGLAAR-  137

Query  544  EAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDT  723
               A  S + +  + YNL    GD  D DIV LKNY+DAQY+GEI +GTPPQKFTV+FDT
Sbjct  138  ---AFGSHQENPPRAYNL----GDSGDADIVTLKNYLDAQYYGEIAIGTPPQKFTVVFDT  190

Query  724  GSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGSLLKFITGLGSISG  873
            GSSNLWVPSSKCYFS+     P    +      + G       G G+I+G
Sbjct  191  GSSNLWVPSSKCYFSIACLLHPKYKSSRSSTYEKNGKSAAIHYGTGAIAG  240



>gb|AAB03108.1| aspartic protease [Brassica napus]
 emb|CDY34613.1| BnaC08g41720D [Brassica napus]
Length=506

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 9/105 (9%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A ++ NDG  R+GLKK+K D  +RIAA + +K    LR      Y L    GD  D DIV
Sbjct  22   ASAERNDGTFRVGLKKLKFDPRSRIAAPVGSKQLKPLRG-----YGL----GDSGDADIV  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV  771
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+
Sbjct  73   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSI  117



>dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata]
Length=505

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
            FS S DG VRIGLK+   D N+  A R+  KAG  +   ++++    G +    DTDIV 
Sbjct  20   FSTSADGLVRIGLKRQFSDSNSIRAVRIARKAG--MNQGLKRFQYSFGDS----DTDIVY  73

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+GEIG+G+PPQKF+VIFDTGSSNLWVPSSKCYFSV  +       +     
Sbjct  74   LKNYLDAQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSKSSTY  133

Query  820  RRMGSLLKFITGLGSISG  873
             ++G   +   G GSISG
Sbjct  134  TKIGKSCEIDYGSGSISG  151



>gb|ADM73810.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73811.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73815.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73820.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73826.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73827.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73835.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S ++DG VR+GLKK  +D     AAR   + G      VRK+    G   +  + D V L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHTERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACY  129



>gb|ADM73798.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73799.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73800.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73806.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73812.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73828.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73829.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73830.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73831.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73832.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73836.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73837.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73838.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73839.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73841.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S ++DG VR+GLKK  +D     AAR   + G      VRK+    G   +  + D V L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHAERLVRKFGLRGGPGLNSNEGDYVPL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACY  129



>gb|ADM73795.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73796.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73797.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73801.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73802.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73803.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73804.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73805.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73807.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73808.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73809.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73813.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73814.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73816.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73817.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73818.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73819.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73821.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73822.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73823.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73824.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73825.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73833.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73834.1| aspartyl protease-like protein, partial [Picea sitchensis]
 gb|ADM73840.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S ++DG VR+GLKK  +D     AAR   + G      VRK+    G   +  + D V L
Sbjct  24   SCADDGLVRVGLKKKPLDLKTLRAARASMRNGCHAERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACY  129



>ref|XP_009415269.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S   DGF+RIGLKK  +D+++R+A+R+  K   SL    RKY    G   D  D D + L
Sbjct  26   SAEEDGFIRIGLKKKPLDESSRLASRIMDKERKSLMG--RKYGLGDGLE-DEGDADYISL  82

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNYM+AQYFGEIGVGTP QKFTVIFDTGSSNLWVPS+KCYFS+  +
Sbjct  83   KNYMNAQYFGEIGVGTPAQKFTVIFDTGSSNLWVPSAKCYFSLACY  128



>ref|XP_004961190.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 75/108 (69%), Gaps = 11/108 (10%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIV  636
            + + +G VRI LKK  ID+N+R+A RL A+    L         L G N  G   + DI+
Sbjct  22   ASAAEGLVRIALKKRAIDQNSRVAERLSAEEKQRL---------LRGANSLGSGGEGDII  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYM+AQYFGEIGVGTP QKFTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  73   ALKNYMNAQYFGEIGVGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACY  120



>ref|NP_001150729.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG40142.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=518

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +1

Query  478  GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYMD  657
            G VR+ LKK  +D+N R+AARL A+  +  R  +R    L    GD  D+D++ L  Y +
Sbjct  34   GLVRVALKKQPVDQNARVAARLSAE--ERQRLLLRGANALGSAGGD-DDSDVIALNXYXN  90

Query  658  AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGSL  837
            AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFS+  +             ++ G  
Sbjct  91   AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKNGKP  150

Query  838  LKFITGLGSISG  873
                 G G+I+G
Sbjct  151  AAIQYGTGAIAG  162



>ref|XP_008784384.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=518

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 90/140 (64%), Gaps = 1/140 (1%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTDI  633
            AF  S DG  RIGLKK  +D+N+R+AARL  +  ++   + RKY Y   G  G  ++ ++
Sbjct  24   AFPVSADGVFRIGLKKRALDQNSRLAARLAVREEEAAALAARKYGYFEPGPVGPGEEGNV  83

Query  634  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPV  813
            V LKNYM+AQYF EIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFSV  +       +   
Sbjct  84   VALKNYMNAQYFAEIGLGSPPQNFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSLSS  143

Query  814  LTRRMGSLLKFITGLGSISG  873
              ++ G       G GS+SG
Sbjct  144  TYQKNGRSANIHYGTGSVSG  163



>ref|XP_008800328.1| PREDICTED: aspartic proteinase-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S+DG +RIGLKK  +D     AA++  K    ++ +      LH    D  D DI+ LKN
Sbjct  24   SSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKN-----GLHHSLAD-SDVDIISLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +       ++     + 
Sbjct  78   YMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHRYRASSSATYTKN  137

Query  829  GSLLKFITGLGSISG  873
            G   +   G G+ISG
Sbjct  138  GESCEITYGSGAISG  152



>ref|XP_008800325.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800326.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 83/135 (61%), Gaps = 6/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S+DG +RIGLKK  +D     AA++  K    ++ +      LH    D  D DI+ LKN
Sbjct  24   SSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKN-----GLHHSLAD-SDVDIISLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +       ++     + 
Sbjct  78   YMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHRYRASSSATYTKN  137

Query  829  GSLLKFITGLGSISG  873
            G   +   G G+ISG
Sbjct  138  GESCEITYGSGAISG  152



>ref|XP_010529449.1| PREDICTED: aspartic proteinase A3 [Tarenaya hassleriana]
Length=507

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 9/137 (7%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +S+DG +RIGL+K++ D NN +AARL +K          +   L G      D+ I+ L
Sbjct  25   EESDDGILRIGLRKIRQDWNNGLAARLGSK---------NRAPPLEGYRPSNGDSGIIAL  75

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+  F       +     +
Sbjct  76   KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSKYKSSESETYQ  135

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  136  KNGKPASIRYGTGAISG  152



>ref|XP_010271042.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X3 [Nelumbo 
nucifera]
Length=468

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 83/138 (60%), Gaps = 11/138 (8%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAG---DSLRASVRKYYNLHGRNGDLQDTDIVG  639
            SN G VRIGLKK ++D  +  AAR   K G   D L        NL  RN D  D DIV 
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLE-------NLP-RNLDSSDVDIVS  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+G+PPQ FTVIFDTGSSNLWVPS KCYFS+  +             
Sbjct  77   LKNYMDAQYFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSKFKADLSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
             ++G+      G GSISG
Sbjct  137  TKIGNSCNIHYGSGSISG  154



>gb|ADM73842.1| aspartyl protease-like protein, partial [Picea sitchensis]
Length=141

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
            S ++DG VR+GLK   +D     AAR   + G      VRK+    G   +  + D V L
Sbjct  24   SCADDGLVRVGLKNKPLDLKTLRAARASMRNGCHEERLVRKFGLRGGPGFNSNEGDYVPL  83

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            KNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +
Sbjct  84   KNYLDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACY  129



>ref|NP_001190671.1| aspartic proteinase A3 [Arabidopsis thaliana]
 gb|AEE82391.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=504

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 6/137 (4%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             ++ DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V L
Sbjct  26   ERNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGS-HWSPKHYFRLNDENADM-----VPL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV  +       +     R
Sbjct  80   KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYR  139

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  140  KNGKPASIRYGTGAISG  156



>ref|NP_192355.1| aspartic proteinase A3 [Arabidopsis thaliana]
 sp|Q9XEC4.1|APA3_ARATH RecName: Full=Aspartic proteinase A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD29758.1|AF076243_5 putative aspartic protease [Arabidopsis thaliana]
 gb|AAK50111.1|AF372974_1 AT4g04460/T26N6_7 [Arabidopsis thaliana]
 emb|CAB77914.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AEE82390.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=508

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 6/137 (4%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             ++ DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V L
Sbjct  26   ERNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGS-HWSPKHYFRLNDENADM-----VPL  79

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV  +       +     R
Sbjct  80   KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYR  139

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  140  KNGKPASIRYGTGAISG  156



>ref|XP_010909333.1| PREDICTED: aspartic proteinase-like [Elaeis guineensis]
Length=507

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 82/135 (61%), Gaps = 6/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S+DG +RIGLKK  +D     AA+   K    ++ +      LH    D  D DIV LKN
Sbjct  24   SSDGLLRIGLKKKHLDVETLNAAKSARKVITHMQKN-----GLHRSLAD-SDVDIVSLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +       ++     + 
Sbjct  78   YMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHRYKASSSTTYTKN  137

Query  829  GSLLKFITGLGSISG  873
            G   +   G G+ISG
Sbjct  138  GESCEITYGSGAISG  152



>ref|XP_009419881.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 83/133 (62%), Gaps = 2/133 (2%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  654
            D  +RIGL+K  + +N RIAARL  K G  L A  R++    G   + +D DIV LKNY+
Sbjct  30   DALIRIGLRKKPLGENGRIAARLLDKEGKDLMA--RRHGLRGGVGSNEEDEDIVSLKNYL  87

Query  655  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGS  834
            +AQYFGEIG+G+P QKFTVIFDTGSSNLW+PSSKC  SV  +             ++ G 
Sbjct  88   NAQYFGEIGIGSPAQKFTVIFDTGSSNLWIPSSKCILSVACYFHSKYKSTASSTYQKNGK  147

Query  835  LLKFITGLGSISG  873
              +   G GSISG
Sbjct  148  SAEIHYGSGSISG  160



>ref|XP_010539213.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539218.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539226.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 9/136 (7%)
 Frame = +1

Query  466  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  645
            K++DG +RIGLKK+K+D+NN +  +      + L A   ++ +    NG     DIV LK
Sbjct  26   KNDDGMLRIGLKKIKLDRNNWVGLK------NWLLAPGARHRDYRMSNGA---ADIVALK  76

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NY+DAQY+GEI VGTPPQKF VIFDTGSSNLWVPSSKCYFS+  F       +     R+
Sbjct  77   NYLDAQYYGEISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSKFKSSESETYRK  136

Query  826  MGSLLKFITGLGSISG  873
             G       G G+ISG
Sbjct  137  NGKPASIRYGTGAISG  152



>ref|XP_010539208.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 85/136 (63%), Gaps = 9/136 (7%)
 Frame = +1

Query  466  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  645
            K++DG +RIGLKK+K+D+NN +  +      + L A   ++ +    NG     DIV LK
Sbjct  37   KNDDGMLRIGLKKIKLDRNNWVGLK------NWLLAPGARHRDYRMSNGA---ADIVALK  87

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NY+DAQY+GEI VGTPPQKF VIFDTGSSNLWVPSSKCYFS+  F       +     R+
Sbjct  88   NYLDAQYYGEISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSKFKSSESETYRK  147

Query  826  MGSLLKFITGLGSISG  873
             G       G G+ISG
Sbjct  148  NGKPASIRYGTGAISG  163



>ref|XP_010271040.1| PREDICTED: aspartic proteinase-like isoform X1 [Nelumbo nucifera]
Length=511

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 83/138 (60%), Gaps = 11/138 (8%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAG---DSLRASVRKYYNLHGRNGDLQDTDIVG  639
            SN G VRIGLKK ++D  +  AAR   K G   D L        NL  RN D  D DIV 
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLE-------NLP-RNLDSSDVDIVS  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+G+PPQ FTVIFDTGSSNLWVPS KCYFS+  +             
Sbjct  77   LKNYMDAQYFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSKFKADLSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
             ++G+      G GSISG
Sbjct  137  TKIGNSCNIHYGSGSISG  154



>ref|XP_010271041.1| PREDICTED: aspartic proteinase-like isoform X2 [Nelumbo nucifera]
Length=508

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 83/138 (60%), Gaps = 11/138 (8%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAG---DSLRASVRKYYNLHGRNGDLQDTDIVG  639
            SN G VRIGLKK ++D  +  AAR   K G   D L        NL  RN D  D DIV 
Sbjct  25   SNGGLVRIGLKKKQLDPTSINAARHAKKLGRYADGLE-------NLP-RNLDSSDVDIVS  76

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQYFGEIG+G+PPQ FTVIFDTGSSNLWVPS KCYFS+  +             
Sbjct  77   LKNYMDAQYFGEIGIGSPPQNFTVIFDTGSSNLWVPSVKCYFSISCYFHSKFKADLSSTY  136

Query  820  RRMGSLLKFITGLGSISG  873
             ++G+      G GSISG
Sbjct  137  TKIGNSCNIHYGSGSISG  154



>emb|CDY16668.1| BnaA09g20460D [Brassica napus]
Length=507

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV L
Sbjct  26   EQKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFRLNDAN-----SDIVPL  78

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+  +        +    +
Sbjct  79   KNYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYK  138

Query  823  RMGSLLKFITGLGSISG  873
            R G       G G+ISG
Sbjct  139  RNGKPASIRYGTGAISG  155



>ref|XP_009114571.1| PREDICTED: aspartic proteinase A3 isoform X1 [Brassica rapa]
Length=507

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV L
Sbjct  26   EQKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFRLNDAN-----SDIVPL  78

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+  +        +    +
Sbjct  79   KNYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYK  138

Query  823  RMGSLLKFITGLGSISG  873
            R G       G G+ISG
Sbjct  139  RNGKPASIRYGTGAISG  155



>ref|XP_002872693.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48952.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (64%), Gaps = 7/137 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +  DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V L
Sbjct  26   ERKGDGTIRIGLKKRKLDRSNRLASQLFLKNRGSW--SPKDYFRLNDANADM-----VPL  78

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV  +       +     R
Sbjct  79   KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYR  138

Query  823  RMGSLLKFITGLGSISG  873
            + G       G G+ISG
Sbjct  139  KNGKPASIRYGTGAISG  155



>ref|XP_011006459.1| PREDICTED: cyprosin-like isoform X2 [Populus euphratica]
Length=514

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 86/145 (59%), Gaps = 12/145 (8%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGDL  618
             S  +DG +RIGLKK K+D+  R            E   G S  A+ +KYYNL    G+ 
Sbjct  20   LSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNL----GET  75

Query  619  QDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTP  798
            +  DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +      
Sbjct  76   E-ADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKYK  134

Query  799  LANPVLTRRMGSLLKFITGLGSISG  873
             +      + G+      G GSISG
Sbjct  135  SSASTTYVKNGTSAAIQYGTGSISG  159



>dbj|BAE20413.1| aspartic proteinase [Triticum aestivum]
Length=508

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 83/136 (61%), Gaps = 12/136 (9%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDL---QDTDIVGLK  645
            +G VRI LKK  ID+N+R+A  L  +          + + L G +  L   ++ DIV LK
Sbjct  26   EGLVRIALKKRAIDRNSRVAKSLSDR---------EEVHLLGGASNTLPSEEEGDIVSLK  76

Query  646  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRR  825
            NYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+  +             ++
Sbjct  77   NYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHARYKAGASSTYKK  136

Query  826  MGSLLKFITGLGSISG  873
             G       G GSI+G
Sbjct  137  NGKPAAIQYGTGSIAG  152



>emb|CDX94554.1| BnaC09g22820D [Brassica napus]
Length=507

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  642
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV L
Sbjct  26   EQKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFCLNDAN-----SDIVPL  78

Query  643  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTR  822
            KNY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+  +        +    +
Sbjct  79   KNYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYK  138

Query  823  RMGSLLKFITGLGSISG  873
            R G       G G+ISG
Sbjct  139  RNGKPASIRYGTGAISG  155



>ref|XP_011006458.1| PREDICTED: cyprosin-like isoform X1 [Populus euphratica]
Length=536

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 86/146 (59%), Gaps = 12/146 (8%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGD  615
              S  +DG +RIGLKK K+D+  R            E   G S  A+ +KYYNL    G+
Sbjct  19   VLSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNL----GE  74

Query  616  LQDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPST  795
              + DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +     
Sbjct  75   -TEADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKY  133

Query  796  PLANPVLTRRMGSLLKFITGLGSISG  873
              +      + G+      G GSISG
Sbjct  134  KSSASTTYVKNGTSAAIQYGTGSISG  159



>ref|XP_004507671.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004507672.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 ref|XP_004507673.1| PREDICTED: aspartic proteinase-like isoform X3 [Cicer arietinum]
Length=498

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 82/135 (61%), Gaps = 17/135 (13%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            SNDG  RIGLKK+K+D+NN++AA + +                  +  + ++TDIV LKN
Sbjct  26   SNDGLRRIGLKKIKLDRNNKLAAGIRSN-----------------KLVETEETDIVALKN  68

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            Y+DAQY+GEI +G  PQKFTVIFDTGSSNLWVPSSKC FSV  +             R+ 
Sbjct  69   YLDAQYYGEIAIGNSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSRQSNTYRKN  128

Query  829  GSLLKFITGLGSISG  873
            G+      G G+ISG
Sbjct  129  GTAAAIQYGTGAISG  143



>ref|XP_006286432.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
 gb|EOA19330.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
Length=503

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 8/138 (6%)
 Frame = +1

Query  463  SKSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             ++ DG +RIGLKK K+D++NR+A++L  K  G S   S + ++ L+G N D+     V 
Sbjct  26   ERNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGGSW--SPKDHFRLNGANADM-----VP  78

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV  +       +     
Sbjct  79   LKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHTKYKASQSSTY  138

Query  820  RRMGSLLKFITGLGSISG  873
            R+ G       G G+I+G
Sbjct  139  RKNGKPASIRYGTGAIAG  156



>gb|AHB32105.1| aspartic proteinase [Camellia sinensis]
Length=507

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            +FS S++  +R+GLKK K+D+  R+    E  +G S R      Y L G   D  DTDI+
Sbjct  22   SFSASDNRLIRVGLKKRKLDQIKRLGE--EGFSGASERN-----YRLRGNFED-SDTDII  73

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
             LKNYM+AQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV  +
Sbjct  74   SLKNYMNAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSAKCYFSVACY  121



>ref|XP_010916100.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916101.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916102.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 91/145 (63%), Gaps = 8/145 (6%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY----YNLHGRNGDLQD  624
            AF  S DG  RIGLKK  +D+N+R+AARL  +   +   + RKY        G  G  ++
Sbjct  19   AFPVSADGVFRIGLKKKALDQNSRLAARLAVRKEAAAALAARKYGFFEPGPVGPVGPGEE  78

Query  625  TDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVP--FFSIPSTP  798
             ++V LKNYM+AQYFGEIG+G+P Q FTVIFDTGSSNLWVPSSKCYFSV   F S   + 
Sbjct  79   GNVVALKNYMNAQYFGEIGLGSPAQNFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKST  138

Query  799  LANPVLTRRMGSLLKFITGLGSISG  873
            L++     + G       G GS+SG
Sbjct  139  LSSTY--EKNGGSANIHYGTGSVSG  161



>dbj|BAG16519.1| putative aspartic protease [Capsicum chinense]
Length=506

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 5/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S+D  +RIGLKK  +D N+  AAR+       L+    K+ N   +  D  D DIV LKN
Sbjct  23   SSDNLLRIGLKKHHVDVNSINAARVA-----RLQDRYGKHLNGLEKKSDGSDVDIVPLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            Y+DAQY+GEIG+G+PPQKF VIFDTGSSNLWVPSS+CYFS+  +              R 
Sbjct  78   YLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHHKYKAGKSSTYTRN  137

Query  829  GSLLKFITGLGSISG  873
            G       G GSISG
Sbjct  138  GKSCSIRYGTGSISG  152



>sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: 
RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: 
Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 
16 kDa subunit; Contains: RecName: Full=Phytepsin 
11 kDa subunit; Flags: Precursor [Hordeum vulgare]
 emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 80/135 (59%), Gaps = 11/135 (8%)
 Frame = +1

Query  475  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNG--DLQDTDIVGLKN  648
            +G VRI LKK  ID+N+R+A  L       L         L G N     ++ DIV LKN
Sbjct  28   EGLVRIALKKRPIDRNSRVATGLSGGEEQPL---------LSGANPLRSEEEGDIVALKN  78

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+  +             ++ 
Sbjct  79   YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKN  138

Query  829  GSLLKFITGLGSISG  873
            G       G GSI+G
Sbjct  139  GKPAAIQYGTGSIAG  153



>ref|XP_002302872.2| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|EEE82145.2| aspartic endopeptidase family protein [Populus trichocarpa]
Length=514

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 85/145 (59%), Gaps = 12/145 (8%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGDL  618
             S  +DG +RIGLKK K+D   R            E   G S  A+ +KYYN+    G+ 
Sbjct  20   LSARDDGLMRIGLKKKKLDHLGRRVVPGSVNFIPEEEGGGASKPAATKKYYNI----GE-  74

Query  619  QDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTP  798
             + DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+  +      
Sbjct  75   TEADIVALKNYLDAQYYGEITIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKYK  134

Query  799  LANPVLTRRMGSLLKFITGLGSISG  873
             +      + G+      G GSISG
Sbjct  135  SSASTTYVKNGTSAAIQYGTGSISG  159



>ref|XP_006840365.1| PREDICTED: aspartic proteinase A1 [Amborella trichopoda]
 gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
Length=510

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 86/134 (64%), Gaps = 4/134 (3%)
 Frame = +1

Query  472  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  651
            ND  VRIGLKK   D     A ++ AK G+  R +VR Y  L  + GD  D DIV LKNY
Sbjct  26   NDRLVRIGLKKKGFDLQTLTARKIVAK-GNPPR-NVRNYEILR-KLGD-SDVDIVSLKNY  81

Query  652  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMG  831
            +DAQY+GEIG+G+P Q FTV+FDTGSSNLWVPSSKCYFS+P +       +      ++G
Sbjct  82   LDAQYYGEIGIGSPSQTFTVVFDTGSSNLWVPSSKCYFSLPCYFHSKYKASKSSTYTKIG  141

Query  832  SLLKFITGLGSISG  873
            +  +   G GSISG
Sbjct  142  NSCEIHYGTGSISG  155



>gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum]
Length=506

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 84/135 (62%), Gaps = 5/135 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S+D  +R+GLKK  +D N+  AAR+ A+  D    +V     +  + GD  D DIV LKN
Sbjct  23   SSDNLLRVGLKKQSLDVNSINAARV-ARLQDRYGKNVN---GIEKKLGD-SDLDIVSLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRM  828
            Y+DAQY+GEIGVG+PPQKF VIFDTGSSNLWVPSS+CYFS+  +       +      R 
Sbjct  78   YLDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHSKYKASKSTTYTRN  137

Query  829  GSLLKFITGLGSISG  873
            G       G GSISG
Sbjct  138  GESCSIRYGTGSISG  152



>ref|XP_008649363.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
Length=225

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            S++G VR+ LKK  +D+N R+A  L  +    L   + +  N  G  G+  D+D++ LKN
Sbjct  73   SSEGLVRVALKKQPVDQNGRVATCLSVEERQRL---LLRGANALGSGGE-DDSDVIALKN  128

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF  780
            YM+AQY GEIGVG+P  KFTVIFDTGSSNLWVPSSKCYF +  +
Sbjct  129  YMNAQYVGEIGVGSPQHKFTVIFDTGSSNLWVPSSKCYFLIACY  172



>dbj|BAA76870.1| aspartic proteinase [Helianthus annuus]
Length=509

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 10/141 (7%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTD  630
            AFS +  G +R+GLKK K ++ NR++       G S+  + R+ +  +   RN    + D
Sbjct  22   AFSSTKGGLLRVGLKKRKTNQFNRVSEH-----GLSMEGTDRRNFGFYDTLRN---SEGD  73

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
            ++ LKNYMDAQYFGEIG+GTPPQKFTV+FDTGS+NLWVPSSKC+ SV          +  
Sbjct  74   VIVLKNYMDAQYFGEIGIGTPPQKFTVVFDTGSANLWVPSSKCFLSVACLFHQKYKASRS  133

Query  811  VLTRRMGSLLKFITGLGSISG  873
               ++ G+      G G+ISG
Sbjct  134  STYKKNGTAAAIQYGTGAISG  154



>emb|CAM12780.1| aspartic proteinase [Fagopyrum esculentum]
Length=506

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 81/139 (58%), Gaps = 7/139 (5%)
 Frame = +1

Query  457  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  636
            A S +N+  VR+GLKK K+D  NR A+R   K        + + Y L    GD  DT I+
Sbjct  20   ALSVANNDLVRVGLKKRKLDPTNRPASRFGCKK------HLMQKYGLGNGFGD-DDTGII  72

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVL  816
             LKNYMDAQYFGEI +GTP Q FTVIFDTGSSNLWVPS KCY S+  F       +    
Sbjct  73   SLKNYMDAQYFGEIAIGTPSQTFTVIFDTGSSNLWVPSGKCYLSIACFFHSKYKSSKSST  132

Query  817  TRRMGSLLKFITGLGSISG  873
              + G   +   G G+ISG
Sbjct  133  YVKNGKSAEIHYGTGAISG  151



>ref|XP_007020767.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12292.1| Aspartic proteinase A1 [Theobroma cacao]
Length=470

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD-IV  636
            F   +DG VRIGLK+ KID N+ +AA L+ +   S  A  RK+Y L G+ G+ ++ D IV
Sbjct  23   FPNPSDGLVRIGLKRRKIDANSNMAALLDPRERKSSNAFTRKWY-LGGKFGEGRNNDHIV  81

Query  637  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPL  801
             LKNY++ QYF EIG+G PPQ F VIF TGSSNLWVPSSKC+FS+  +  P+  L
Sbjct  82   VLKNYVNVQYFAEIGIGIPPQNFFVIFYTGSSNLWVPSSKCFFSLACYLHPNEDL  136



>ref|XP_011039044.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039045.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039046.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=506

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 88/142 (62%), Gaps = 19/142 (13%)
 Frame = +1

Query  469  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  648
            ++ G VRIGLKK +ID +   AAR+  + G S   +   +++L        D DI+ LKN
Sbjct  23   NSSGLVRIGLKKRRIDLDTIKAARIARQEGKSGAGANSLFHDL-----GTSDADIIPLKN  77

Query  649  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFF-------SIPSTPLAN  807
            Y+DAQY GEIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFS+  +       S+ ST + N
Sbjct  78   YLDAQYVGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSLSSTYIKN  137

Query  808  PVLTRRMGSLLKFITGLGSISG  873
                   G+  +   G GSISG
Sbjct  138  -------GNSCEIHYGSGSISG  152



>ref|XP_010473444.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A2-like [Camelina 
sativa]
Length=498

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 86/141 (61%), Gaps = 13/141 (9%)
 Frame = +1

Query  457  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTD  630
            A S+SND G  R+GLKK+        A R  +   ++LR+S R Y  NL G +GD    D
Sbjct  25   ASSESNDDGTFRVGLKKL--------ATRFGSSQEEALRSSFRSYNINLGGDSGD---AD  73

Query  631  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANP  810
            IV LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+ S+  F       +  
Sbjct  74   IVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFLSISCFFHAKYKSSRS  133

Query  811  VLTRRMGSLLKFITGLGSISG  873
               ++ G       G GSISG
Sbjct  134  STYKKDGKRAAIHYGSGSISG  154



>gb|AFX73039.1| preprogaline A [Galium verum]
Length=506

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 83/138 (60%), Gaps = 9/138 (7%)
 Frame = +1

Query  460  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  639
             S S    VR+ LKK K+D+ NR+A       G   R S R    L+G  G   D+DI+ 
Sbjct  23   LSASETKLVRVSLKKAKLDQVNRLA-------GSVPRGSAR-INRLYGNMGS-SDSDIIA  73

Query  640  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLT  819
            LKNYMDAQY+GEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFS   +        +    
Sbjct  74   LKNYMDAQYYGEIGIGTPAQKFTVIFDTGSSNLWVPSTKCYFSPACYFHSKYNSKHSSTY  133

Query  820  RRMGSLLKFITGLGSISG  873
            ++ G   +   G GSI+G
Sbjct  134  KKNGKSAEIHYGTGSIAG  151



>ref|XP_008246320.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=506

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +1

Query  478  GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYMD  657
            G VRIGLKK  +D     AAR E +A  + R S++     H       D DIV L NYMD
Sbjct  24   GLVRIGLKKRPLDLQTIKAARAEREA--NYRGSLKGMNQNHYLGS--SDEDIVPLNNYMD  79

Query  658  AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPFFSIPSTPLANPVLTRRMGSL  837
            AQY+GEIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFS+  +       +       +G+ 
Sbjct  80   AQYYGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHTRYKSSKSSTYTAIGTS  139

Query  838  LKFITGLGSISG  873
             K   G GSISG
Sbjct  140  AKITYGSGSISG  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1963610081719